F449735

General Info

Members Datasets Scaffolds Average Seq Length
466 256 932 331

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0038936|Ga0495686_0038936_428_1576
Length 382
Sequence MVLIFVLRGNCGLFRLASFLLSQFGYTFGMSVPHEKTMLKAFGINSGKVVDSASAGPDMAARALALARCTLQIEADAIIALHARLEGDTSIARAIALMMACQGRVVVSGIGKSGHIARKIAATLSSTGTPALFLHPAEAAHGDLGMVTPQDVVIAISYSGESSELLAILPIVKRMGAPLISITGKPASSLAQLADVHLDVAVAKEACPMGLAPTASTTVTLALGDALAVALLELRGFKEDDFARSHPGGALGRRLLTLVRDVMRSGDAVPAVAEDALLTDALLEITRKGMGMTAIVDADGRPLGVFTDGDLRRMLSTVQDFTSVKIRDVMHRKPHQLGPDQLAVDAVAVMEYFRINQILVVDTDGKLAGALHIHDLTRAKVI

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
233 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
234 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
235 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
236 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
237 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
238 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
239 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
240 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
241 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
242 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
243 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
244 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
245 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
246 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
247 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
248 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
249 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
250 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
251 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
252 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
253 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
254 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
255 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
256 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0.64
Rhizoplane 2.58
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0038936 3300047472 Bacteria 3039
2 SwRhRL2b_contig_81665 2162886007 Bacteria 1361
3 JGI25155J39150_1000125 3300002704 Bacteria 37391
4 JGI25156J39149_1000077 3300002705 Bacteria 74919
5 JGI25156J39149_1005076 3300002705 Bacteria 3880
6 JGI25154J39366_1000103 3300002738 Bacteria 74908
7 JGI25154J39366_1000178 3300002738 Bacteria 49620
8 JGI25157J39369_1000259 3300002741 Bacteria 38902
9 rootH2_10008170 3300003320 Bacteria 9963
10 Ga0055538_1000062 3300003751 Bacteria 105260
11 Ga0055539_1000093 3300003752 Bacteria 105260
12 Ga0055533_1000105 3300003756 Bacteria 105260
13 Ga0055532_1000034 3300003758 Bacteria 210984
14 Ga0055525_1000137 3300003759 Bacteria 105260
15 Ga0055541_1000063 3300003841 Bacteria 105260
16 Ga0058692_1000847 3300003856 Bacteria 12067
17 Ga0065704_10095130 3300005289 Bacteria 2504
18 Ga0065704_10097852 3300005289 Bacteria 2376
19 Ga0070676_10032034 3300005328 Bacteria 3009
20 Ga0068869_100221212 3300005334 Bacteria 1501
21 Ga0070692_10039590 3300005345 Bacteria 2407
22 Ga0070692_10048759 3300005345 Bacteria 2195
23 Ga0070669_100089793 3300005353 Bacteria 2302
24 Ga0070688_100006040 3300005365 Bacteria 6429
25 Ga0070694_100000391 3300005444 Bacteria 23747
26 Ga0070694_100032084 3300005444 Bacteria 3448
27 Ga0070708_100000627 3300005445 Bacteria 26774
28 Ga0070662_100113641 3300005457 Bacteria 2066
29 Ga0070685_10017908 3300005466 Bacteria 3802
30 Ga0070706_100131011 3300005467 Bacteria 2340
31 Ga0070698_100206759 3300005471 Bacteria 1898
32 Ga0070697_100000090 3300005536 Bacteria 75895
33 Ga0070697_100263566 3300005536 Bacteria 1476
34 Ga0068853_100105400 3300005539 Bacteria 2498
35 Ga0070665_100019235 3300005548 Bacteria 6852
36 Ga0070704_100016824 3300005549 Bacteria 4632
37 Ga0068855_100034892 3300005563 Bacteria 5994
38 Ga0068856_100174553 3300005614 Bacteria 2161
39 Ga0068852_100011378 3300005616 Bacteria 6696
40 Ga0068864_100054224 3300005618 Unclassified 3460
41 Ga0075428_100063790 3300006844 Bacteria 4034
42 Ga0079104_1001382 3300006946 Bacteria 16496
43 Ga0105240_10000799 3300009093 Bacteria 56992
44 Ga0114129_10003091 3300009147 Bacteria 23344
45 Ga0114129_10149040 3300009147 Bacteria 3202
46 Ga0105243_10007754 3300009148 Bacteria 8256
47 Ga0105241_10045159 3300009174 Bacteria 3341
48 Ga0105241_10078566 3300009174 Bacteria 2579
49 Ga0105248_10556035 3300009177 Bacteria 1295
50 Ga0105238_10136221 3300009551 Bacteria 2433
51 Ga0105238_10189307 3300009551 Bacteria 2034
52 Ga0105246_10160366 3300011119 Bacteria 1712
53 Ga0157369_10165378 3300013105 Unclassified 2333
54 Ga0163162_10136302 3300013306 Bacteria 2566
55 Ga0163163_10001469 3300014325 Bacteria 19935
56 Ga0163163_10514378 3300014325 Unclassified 1259
57 Ga0182008_10038749 3300014497 Bacteria 2383
58 Ga0213872_10003077 3300021361 Bacteria 9396
59 Ga0213875_10000028 3300021388 Bacteria 187813
60 Ga0213871_10013381 3300021441 Bacteria 1927
61 Ga0209435_100007 3300025206 Bacteria 516857
62 Ga0209435_100444 3300025206 Bacteria 8409
63 Ga0209784_100021 3300025224 Bacteria 408534
64 Ga0209566_100119 3300025225 Bacteria 105312
65 Ga0209674_100036 3300025226 Bacteria 408534
66 Ga0209147_100017 3300025229 Bacteria 516857
67 Ga0209563_100040 3300025230 Bacteria 408534
68 Ga0209258_100115 3300025242 Bacteria 190367
69 Ga0209646_1000044 3300025246 Bacteria 334596
70 Ga0209646_1000107 3300025246 Bacteria 163112
71 Ga0209026_1000063 3300025250 Bacteria 211324
72 Ga0209026_1002436 3300025250 Bacteria 7000
73 Ga0209677_100023 3300025253 Bacteria 408534
74 Ga0209759_1000048 3300025256 Bacteria 224817
75 Ga0209759_1000198 3300025256 Bacteria 95052
76 Ga0209455_1007850 3300025272 Bacteria 2964
77 Ga0207705_10001882 3300025909 Bacteria 16468
78 Ga0207654_10008227 3300025911 Bacteria 5264
79 Ga0207707_10208615 3300025912 Bacteria 1702
80 Ga0207695_10001014 3300025913 Bacteria 49482
81 Ga0207649_10029056 3300025920 Bacteria 3262
82 Ga0207694_10163767 3300025924 Bacteria 1798
83 Ga0207694_10165564 3300025924 Bacteria 1788
84 Ga0207687_10014439 3300025927 Bacteria 5168
85 Ga0207706_10095462 3300025933 Bacteria 2615
86 Ga0207706_10163959 3300025933 Bacteria 1953
87 Ga0207686_10090618 3300025934 Bacteria 2018
88 Ga0207709_10008958 3300025935 Bacteria 5521
89 Ga0207691_10248230 3300025940 Bacteria 1537
90 Ga0207711_10413701 3300025941 Bacteria 1254
91 Ga0207679_10188862 3300025945 Bacteria 1711
92 Ga0207667_10049646 3300025949 Bacteria 4431
93 Ga0207641_10077953 3300026088 Bacteria 2869
94 Ga0207648_10080697 3300026089 Bacteria 2838
95 Ga0207674_10047425 3300026116 Bacteria 4404
96 Ga0207674_10259855 3300026116 Bacteria 1684
97 Ga0207698_10002135 3300026142 Bacteria 11672
98 Ga0209588_1047034 3300027671 Bacteria 1395
99 Ga0265338_10001154 3300028800 Bacteria 43706
100 Ga0265332_10002576 3300031238 Bacteria 9182
101 Ga0265332_10082299 3300031238 Bacteria 1365
102 Ga0265320_10020014 3300031240 Bacteria 3641
103 Ga0265340_10100155 3300031247 Bacteria 1347
104 Ga0265339_10109064 3300031249 Unclassified 1434
105 Ga0265316_10026352 3300031344 Bacteria 4837
106 Ga0265313_10004356 3300031595 Bacteria 10934
107 Ga0316575_10001267 3300031665 Bacteria 8041
108 Ga0316579_10075569 3300031691 Bacteria 1601
109 Ga0265314_10008084 3300031711 Bacteria 9052
110 Ga0265314_10014186 3300031711 Bacteria 6390
111 Ga0265342_10025984 3300031712 Bacteria 3674
112 Ga0316576_10001504 3300031727 Bacteria 12591
113 Ga0316576_10025852 3300031727 Bacteria 4113
114 Ga0316576_10111487 3300031727 Bacteria 2050
115 Ga0316576_10162513 3300031727 Bacteria 1684
116 Ga0316578_10037857 3300031728 Bacteria 2780
117 Ga0307405_10176965 3300031731 Bacteria 1528
118 Ga0316577_10074412 3300031733 Unclassified 1897
119 Ga0307413_10262172 3300031824 Bacteria 1289
120 Ga0307410_10120942 3300031852 Bacteria 1909
121 Ga0316583_10035925 3300032133 Bacteria 1759
122 Ga0316585_10005495 3300032137 Bacteria 3579
123 Ga0373929_0000004 3300035085 Bacteria 462745
124 Ga0373955_0277338 3300035172 Bacteria 1008
125 Ga0316574_0078553 3300035398 Bacteria 2092
126 Ga0316574_0109081 3300035398 Bacteria 1774
127 Ga0316582_0008189 3300036647 Bacteria 5607
128 Ga0316582_0045829 3300036647 Bacteria 2754
129 Ga0316584_0108477 3300036712 Bacteria 2077
130 Ga0395899_0031221 3300037312 Bacteria 4004
131 Ga0395899_0039535 3300037312 Bacteria 3530
132 Ga0395900_0002597 3300037418 Bacteria 19748
133 Ga0395900_0070626 3300037418 Bacteria 3590
134 Ga0395898_0037552 3300037466 Bacteria 4804
135 Ga0395898_0144000 3300037466 Bacteria 2281
136 Ga0395898_0162354 3300037466 Bacteria 2137
137 Ga0395898_0187657 3300037466 Bacteria 1975
138 Ga0395905_0000200 3300037471 Bacteria 93008
139 Ga0395905_0102524 3300037471 Bacteria 2686
140 Ga0436364_0302973 3300037853 Bacteria 187060
141 Ga0395901_0001076 3300038443 Bacteria 29192
142 Ga0395901_0095841 3300038443 Bacteria 3109
143 Ga0395901_0173565 3300038443 Bacteria 2261
144 Ga0395901_0211257 3300038443 Bacteria 2031
145 Ga0436360_0119357 3300039438 Bacteria 3547
146 Ga0436361_0951855 3300039447 Bacteria 7513
147 Ga0439438_019758 3300041405 Bacteria 1900
148 Ga0439431_0002553 3300041997 Bacteria 4018
149 Ga0439448_0003545 3300042005 Bacteria 4332
150 Ga0439450_011105 3300042008 Bacteria 1754
151 Ga0451577_0240267 3300042876 Bacteria 1639
152 Ga0466966_0022675 3300044684 Bacteria 4118
153 Ga0466964_0008040 3300044706 Bacteria 3953
154 Ga0453684_0006851 3300044712 Bacteria 21408
155 Ga0453684_0188339 3300044712 Bacteria 2416
156 Ga0466959_0032834 3300045049 Bacteria 3842
157 Ga0451576_0016111 3300045051 Bacteria 8260
158 Ga0451576_0407886 3300045051 Bacteria 1425
159 Ga0466958_0080704 3300045836 Bacteria 2001
160 Ga0466967_0011831 3300045976 Bacteria 6637
161 Ga0466967_0025158 3300045976 Bacteria 4905
162 Ga0495617_000027 3300046452 Bacteria 157385
163 Ga0495627_000277 3300046453 Bacteria 51556
164 Ga0495590_0000053 3300046457 Bacteria 103329
165 Ga0495590_0002275 3300046457 Bacteria 8017
166 Ga0495590_0079368 3300046457 Bacteria 1155
167 Ga0495591_000500 3300046458 Bacteria 30952
168 Ga0495591_010151 3300046458 Bacteria 3674
169 Ga0495638_0037507 3300046460 Bacteria 3083
170 Ga0495653_0052356 3300046463 Bacteria 3128
171 Ga0495650_0000431 3300046471 Bacteria 67716
172 Ga0495650_0000582 3300046471 Bacteria 51082
173 Ga0495650_0011511 3300046471 Bacteria 4839
174 Ga0495580_0058717 3300046472 Unclassified 2705
175 Ga0495580_0065881 3300046472 Bacteria 2536
176 Ga0495582_0003170 3300046473 Bacteria 9235
177 Ga0495605_0000135 3300046474 Bacteria 95104
178 Ga0495605_0012191 3300046474 Bacteria 4773
179 Ga0495605_0015501 3300046474 Bacteria 4142
180 Ga0495605_0020640 3300046474 Bacteria 3499
181 Ga0495605_0026339 3300046474 Bacteria 3023
182 Ga0495605_0035842 3300046474 Bacteria 2505
183 Ga0495605_0049840 3300046474 Bacteria 2044
184 Ga0495639_0103322 3300046475 Bacteria 1347
185 Ga0495584_0000713 3300046491 Bacteria 21919
186 Ga0495584_0001504 3300046491 Bacteria 13869
187 Ga0495584_0002767 3300046491 Bacteria 9805
188 Ga0495584_0004737 3300046491 Bacteria 7282
189 Ga0495584_0087823 3300046491 Bacteria 1567
190 Ga0495585_0000466 3300046492 Bacteria 38653
191 Ga0495585_0008237 3300046492 Bacteria 6328
192 Ga0495585_0012462 3300046492 Bacteria 5009
193 Ga0495585_0042221 3300046492 Bacteria 2555
194 Ga0495585_0072659 3300046492 Bacteria 1873
195 Ga0495596_0007284 3300046500 Bacteria 5002
196 Ga0495596_0007978 3300046500 Bacteria 4737
197 Ga0495596_0015867 3300046500 Bacteria 3140
198 Ga0495596_0025519 3300046500 Bacteria 2388
199 Ga0495607_0000264 3300046501 Bacteria 56345
200 Ga0495607_0002410 3300046501 Bacteria 15261
201 Ga0495607_0004458 3300046501 Bacteria 10274
202 Ga0495607_0006913 3300046501 Bacteria 7910
203 Ga0495607_0013419 3300046501 Bacteria 5370
204 Ga0495607_0036021 3300046501 Bacteria 2987
205 Ga0495583_0002349 3300046506 Bacteria 16382
206 Ga0495583_0003787 3300046506 Bacteria 11232
207 Ga0495583_0010812 3300046506 Bacteria 5285
208 Ga0495583_0013027 3300046506 Bacteria 4667
209 Ga0495583_0051393 3300046506 Bacteria 1879
210 Ga0495583_0055998 3300046506 Bacteria 1780
211 Ga0495583_0062646 3300046506 Bacteria 1655
212 Ga0495606_0001657 3300046507 Bacteria 28942
213 Ga0495606_0004035 3300046507 Bacteria 14973
214 Ga0495606_0006559 3300046507 Bacteria 10699
215 Ga0495606_0104391 3300046507 Bacteria 1720
216 Ga0495606_0123590 3300046507 Bacteria 1546
217 Ga0495606_0137678 3300046507 Bacteria 1444
218 Ga0495610_0007656 3300046512 Bacteria 7139
219 Ga0495610_0060696 3300046512 Bacteria 1799
220 Ga0495616_0000333 3300046513 Bacteria 37273
221 Ga0495616_0003764 3300046513 Bacteria 9679
222 Ga0495616_0015793 3300046513 Bacteria 4190
223 Ga0495616_0018132 3300046513 Bacteria 3871
224 Ga0495616_0030355 3300046513 Bacteria 2841
225 Ga0495616_0044418 3300046513 Bacteria 2253
226 Ga0495616_0131892 3300046513 Bacteria 1144
227 Ga0495630_0051331 3300046517 Bacteria 3087
228 Ga0495630_0527075 3300046517 Bacteria 906
229 Ga0495631_0001600 3300046518 Bacteria 13546
230 Ga0495631_0002985 3300046518 Bacteria 9358
231 Ga0495631_0004324 3300046518 Bacteria 7576
232 Ga0495631_0010049 3300046518 Bacteria 4701
233 Ga0495632_0000069 3300046519 Bacteria 107707
234 Ga0495632_0000177 3300046519 Bacteria 65209
235 Ga0495632_0001178 3300046519 Bacteria 22245
236 Ga0495632_0001980 3300046519 Bacteria 16262
237 Ga0495632_0003331 3300046519 Bacteria 11455
238 Ga0495632_0012042 3300046519 Bacteria 5008
239 Ga0495632_0024295 3300046519 Bacteria 3221
240 Ga0495632_0094643 3300046519 Bacteria 1412
241 Ga0495637_0000053 3300046520 Bacteria 99739
242 Ga0495637_0006479 3300046520 Bacteria 5873
243 Ga0495643_0003928 3300046522 Bacteria 10651
244 Ga0495643_0005232 3300046522 Bacteria 8828
245 Ga0495643_0012850 3300046522 Bacteria 5036
246 Ga0495644_0001533 3300046523 Bacteria 9433
247 Ga0495644_0025951 3300046523 Bacteria 2223
248 Ga0495648_0005653 3300046524 Bacteria 10349
249 Ga0495648_0012325 3300046524 Bacteria 6385
250 Ga0495648_0022662 3300046524 Bacteria 4317
251 Ga0495648_0027822 3300046524 Bacteria 3777
252 Ga0495666_0000177 3300046526 Bacteria 27146
253 Ga0495642_0000137 3300046528 Bacteria 42614
254 Ga0495642_0000441 3300046528 Bacteria 21882
255 Ga0495642_0004645 3300046528 Bacteria 5319
256 Ga0495642_0014293 3300046528 Bacteria 3075
257 Ga0495642_0061333 3300046528 Bacteria 1560
258 Ga0495642_0082240 3300046528 Bacteria 1357
259 Ga0495652_0005568 3300046529 Bacteria 11846
260 Ga0495654_0049964 3300046530 Bacteria 2045
261 Ga0495665_0005443 3300046531 Bacteria 6856
262 Ga0495640_0049509 3300046533 Bacteria 2897
263 Ga0495587_0084837 3300046536 Bacteria 1834
264 Ga0495609_0000007 3300046538 Bacteria 398812
265 Ga0495609_0001446 3300046538 Bacteria 15772
266 Ga0495609_0002140 3300046538 Bacteria 12423
267 Ga0495609_0009229 3300046538 Bacteria 4779
268 Ga0495609_0010787 3300046538 Bacteria 4370
269 Ga0495609_0028195 3300046538 Bacteria 2563
270 Ga0495609_0031899 3300046538 Bacteria 2394
271 Ga0495609_0045456 3300046538 Bacteria 1967
272 Ga0495609_0046233 3300046538 Bacteria 1949
273 Ga0495609_0063852 3300046538 Bacteria 1625
274 Ga0495597_0000348 3300046542 Bacteria 41331
275 Ga0495597_0001336 3300046542 Bacteria 17943
276 Ga0495597_0010005 3300046542 Bacteria 4657
277 Ga0495597_0016854 3300046542 Bacteria 3446
278 Ga0495597_0037849 3300046542 Bacteria 2164
279 Ga0495645_0064044 3300046543 Bacteria 2661
280 Ga0495633_0002729 3300046558 Bacteria 12238
281 Ga0495633_0008912 3300046558 Bacteria 5593
282 Ga0495633_0013804 3300046558 Bacteria 4242
283 Ga0495667_0028373 3300046559 Unclassified 3769
284 Ga0495668_0000962 3300046616 Bacteria 32005
285 Ga0495668_0001492 3300046616 Bacteria 22413
286 Ga0495668_0001879 3300046616 Bacteria 18822
287 Ga0495668_0004143 3300046616 Bacteria 10479
288 Ga0495668_0012875 3300046616 Bacteria 4952
289 Ga0495634_0019868 3300046642 Bacteria 4768
290 Ga0495611_0000271 3300046648 Bacteria 35492
291 Ga0495611_0013322 3300046648 Bacteria 3499
292 Ga0495611_0015525 3300046648 Bacteria 3255
293 Ga0495611_0026123 3300046648 Bacteria 2547
294 Ga0495625_0000428 3300046660 Bacteria 63353
295 Ga0495625_0023402 3300046660 Bacteria 4719
296 Ga0495625_0068150 3300046660 Bacteria 2502
297 Ga0495625_0107901 3300046660 Bacteria 1905
298 Ga0495635_0005841 3300046663 Bacteria 8576
299 Ga0495635_0024893 3300046663 Unclassified 4171
300 Ga0495661_0000549 3300046665 Bacteria 38859
301 Ga0495661_0000776 3300046665 Bacteria 30561
302 Ga0495661_0001219 3300046665 Bacteria 22320
303 Ga0495661_0002786 3300046665 Bacteria 13243
304 Ga0495661_0017352 3300046665 Bacteria 4755
305 Ga0495588_0004898 3300046674 Bacteria 5937
306 Ga0495588_0010935 3300046674 Bacteria 4244
307 Ga0495623_0004426 3300046679 Bacteria 9232
308 Ga0495623_0028737 3300046679 Bacteria 3577
309 Ga0495646_0150632 3300046680 Bacteria 1294
310 Ga0495669_0000073 3300046684 Bacteria 66387
311 Ga0495669_0004634 3300046684 Bacteria 5699
312 Ga0495669_0015135 3300046684 Bacteria 3300
313 Ga0495669_0054349 3300046684 Bacteria 1802
314 Ga0495613_0043544 3300046689 Bacteria 3321
315 Ga0495613_0302710 3300046689 Bacteria 1106
316 Ga0495624_0095323 3300046690 Bacteria 1834
317 Ga0495670_0002459 3300046691 Bacteria 9144
318 Ga0495670_0004392 3300046691 Bacteria 6915
319 Ga0495670_0066295 3300046691 Bacteria 1821
320 Ga0495671_0002956 3300046692 Bacteria 10572
321 Ga0495649_0000291 3300046694 Bacteria 44106
322 Ga0495649_0009889 3300046694 Bacteria 5643
323 Ga0495649_0058310 3300046694 Bacteria 2080
324 Ga0495649_0060986 3300046694 Bacteria 2028
325 Ga0495589_0000081 3300046794 Bacteria 88067
326 Ga0495589_0001934 3300046794 Bacteria 11734
327 Ga0495589_0002218 3300046794 Bacteria 10925
328 Ga0495589_0007240 3300046794 Bacteria 5812
329 Ga0495589_0013992 3300046794 Bacteria 4137
330 Ga0495589_0017042 3300046794 Bacteria 3730
331 Ga0495600_0056858 3300046809 Bacteria 2556
332 Ga0495660_0021954 3300046810 Bacteria 3648
333 Ga0495604_0011966 3300047317 Bacteria 6897
334 Ga0495604_0061195 3300047317 Bacteria 2880
335 Ga0495636_0043791 3300047318 Bacteria 1863
336 Ga0495672_0000135 3300047320 Bacteria 110114
337 Ga0495672_0000340 3300047320 Bacteria 59814
338 Ga0495672_0016966 3300047320 Bacteria 4880
339 Ga0495672_0101384 3300047320 Bacteria 1560
340 Ga0495676_0000221 3300047321 Bacteria 45708
341 Ga0495680_0032272 3300047322 Bacteria 4252
342 Ga0495680_0049292 3300047322 Bacteria 3299
343 Ga0495680_0054413 3300047322 Bacteria 3108
344 Ga0495683_0001222 3300047323 Bacteria 17501
345 Ga0495683_0007113 3300047323 Bacteria 6072
346 Ga0495683_0031965 3300047323 Bacteria 2681
347 Ga0495687_000030 3300047443 Bacteria 279992
348 Ga0495687_000120 3300047443 Bacteria 120987
349 Ga0495687_000374 3300047443 Bacteria 55800
350 Ga0495687_002025 3300047443 Bacteria 17139
351 Ga0495675_0011591 3300047444 Bacteria 5534
352 Ga0495675_0070279 3300047444 Bacteria 2210
353 Ga0495677_0000045 3300047445 Bacteria 73995
354 Ga0495677_0000387 3300047445 Bacteria 18876
355 Ga0495677_0001504 3300047445 Bacteria 9372
356 Ga0495677_0003277 3300047445 Bacteria 6310
357 Ga0495677_0003624 3300047445 Bacteria 5986
358 Ga0495677_0011757 3300047445 Bacteria 3199
359 Ga0495677_0028312 3300047445 Bacteria 2034
360 Ga0495679_015610 3300047446 Bacteria 2773
361 Ga0495681_0000978 3300047470 Bacteria 21839
362 Ga0495681_0001523 3300047470 Bacteria 17287
363 Ga0495681_0002791 3300047470 Bacteria 12364
364 Ga0495681_0011838 3300047470 Bacteria 5163
365 Ga0495681_0043463 3300047470 Bacteria 2166
366 Ga0495686_0000793 3300047472 Bacteria 41237
367 Ga0495686_0000802 3300047472 Bacteria 40756
368 Ga0495686_0004415 3300047472 Bacteria 11587
369 Ga0495686_0017592 3300047472 Bacteria 4810
370 Ga0495602_0019975 3300048088 Bacteria 6632
371 Ga0495614_0005047 3300048089 Bacteria 5956
372 Ga0495626_0000105 3300048091 Bacteria 109725
373 Ga0495626_0001251 3300048091 Bacteria 20847
374 Ga0495626_0003522 3300048091 Bacteria 10022
375 Ga0495626_0005746 3300048091 Bacteria 7163
376 Ga0495626_0009393 3300048091 Bacteria 5287
377 Ga0495626_0010538 3300048091 Bacteria 4923
378 Ga0495626_0014390 3300048091 Bacteria 4083
379 Ga0495626_0020582 3300048091 Bacteria 3285
380 Ga0495626_0037534 3300048091 Bacteria 2301
381 Ga0495626_0075393 3300048091 Bacteria 1508
382 Ga0496102_0002351 3300048905 Bacteria 16129
383 Ga0496105_0287472 3300048908 Bacteria 1324
384 Ga0496108_0223643 3300048911 Bacteria 1636
385 Ga0496108_0411806 3300048911 Bacteria 1181
386 Ga0496109_0125405 3300048912 Unclassified 2394
387 Ga0496110_0000462 3300048913 Bacteria 27650
388 Ga0496110_0038136 3300048913 Bacteria 4179
389 Ga0496111_0072628 3300048914 Bacteria 2504
390 Ga0496111_0263133 3300048914 Bacteria 1280
391 Ga0496113_0269723 3300048916 Unclassified 1360
392 Ga0496115_0019484 3300048918 Bacteria 5221
393 Ga0496115_0077783 3300048918 Bacteria 2698
394 Ga0496116_0003824 3300048919 Bacteria 14712
395 Ga0496122_0000570 3300048925 Bacteria 75506
396 Ga0496122_0004067 3300048925 Bacteria 18560
397 Ga0496123_0000438 3300048926 Bacteria 74878
398 Ga0496123_0001939 3300048926 Bacteria 26936
399 Ga0496123_0006950 3300048926 Bacteria 10810
400 Ga0496124_0024256 3300048927 Bacteria 5521
401 Ga0496124_0044307 3300048927 Bacteria 3818
402 Ga0496124_0112084 3300048927 Bacteria 2194
403 Ga0496124_0241723 3300048927 Bacteria 1342
404 Ga0496125_0000701 3300048928 Bacteria 55423
405 Ga0496125_0005434 3300048928 Bacteria 14167
406 Ga0496125_0084626 3300048928 Bacteria 2407
407 Ga0496125_0112664 3300048928 Bacteria 1965
408 Ga0495678_000190 3300049459 Bacteria 71878
409 Ga0495678_000831 3300049459 Bacteria 27649
410 Ga0495678_001754 3300049459 Bacteria 16090
411 Ga0495678_002868 3300049459 Bacteria 11136
412 Ga0495678_004860 3300049459 Bacteria 7612
413 Ga0495682_0000714 3300049460 Bacteria 21687
414 Ga0495682_0007243 3300049460 Bacteria 4428
415 Ga0495682_0033712 3300049460 Bacteria 1889
416 Ga0501034_0000759 3300049571 Bacteria 48520
417 Ga0501034_0011664 3300049571 Bacteria 9096
418 Ga0501047_0106100 3300049581 Bacteria 2690
419 Ga0501072_0078783 3300049588 Bacteria 2609
420 Ga0501074_0299398 3300049590 Bacteria 1142
421 Ga0501075_0214193 3300049591 Bacteria 1469
422 Ga0501075_0240967 3300049591 Bacteria 1379
423 Ga0501076_0124213 3300049592 Bacteria 2091
424 Ga0501076_0151378 3300049592 Bacteria 1887
425 Ga0501077_0084455 3300049593 Bacteria 2013
426 Ga0501081_0228669 3300049743 Bacteria 1354
427 nmdc:mga05p37_6480_c1 3300050507 Bacteria 13809
428 nmdc:mga06r32_93509_c1 3300050510 Bacteria 2941
429 nmdc:mga0n895_114610_c1 3300050512 Bacteria 2713
430 Ga0495619_0039692 3300053085 Unclassified 3074
431 Ga0500643_013769 3300053087 Bacteria 2840
432 Ga0500556_0000455 3300053104 Bacteria 28996
433 Ga0500618_000364 3300053125 Bacteria 31481
434 Ga0500642_0076069 3300053130 Bacteria 1535
435 Ga0500624_000329 3300053157 Bacteria 16004
436 Ga0500636_0068734 3300053177 Bacteria 2056
437 Ga0501084_0065690 3300054114 Bacteria 3036
438 Ga0501082_0024762 3300060353 Bacteria 5174
439 Ga0501082_0435401 3300060353 Bacteria 1145
440 Ga0501082_0452124 3300060353 Bacteria 1122
441 Ga0530510_0107526 3300061734 Bacteria 2041
442 2511248563 2511231003 Bacteria 5606035
443 2521559905 2521172590 Bacteria 5047645
444 2550694927 2548876994 Bacteria 4904866
445 2553006960 2551306416 Bacteria 6152985
446 2687578412 2687453129 Bacteria 4387428
447 2739611456 2739367655 Bacteria 4051151
448 2765571142 2765235838 Bacteria 5445269
449 2808982682 2808606386 Bacteria 4471946
450 2809130183 2808606415 Bacteria 4576710
451 2809145786 2808606418 Bacteria 6724496
452 2809150340 2808606419 Bacteria 4576925
453 2819594004 2818991445 Bacteria 4955017
454 2819618206 2818991449 Bacteria 5518009
455 2846040054 2846037992 Bacteria 4526407
456 2852621437 2852618963 Bacteria 4577824
457 2884811841 2884811622 Bacteria 5552861
458 2884839832 2884836552 Bacteria 5219991
459 2884856357 2884852848 Bacteria 5221161
460 2887376839 2887375801 Bacteria 5334027
461 2896113056 2896109856 Bacteria 7140722
462 2896158722 2896154374 Bacteria 5221518
463 2923513679 2923510766 Bacteria 5926163
464 2939610120 2939607340 Bacteria 4719256
465 2989393400 2989392574 Bacteria 4554005
466 8002395693 8002392321 Bacteria 4159911
467 Ga0495686_0038936
468 SwRhRL2b_contig_81665
469 JGI25155J39150_1000125
470 JGI25156J39149_1000077
471 JGI25156J39149_1005076
472 JGI25154J39366_1000103
473 JGI25154J39366_1000178
474 JGI25157J39369_1000259
475 rootH2_10008170
476 Ga0055538_1000062
477 Ga0055539_1000093
478 Ga0055533_1000105
479 Ga0055532_1000034
480 Ga0055525_1000137
481 Ga0055541_1000063
482 Ga0058692_1000847
483 Ga0065704_10095130
484 Ga0065704_10097852
485 Ga0070676_10032034
486 Ga0068869_100221212
487 Ga0070692_10039590
488 Ga0070692_10048759
489 Ga0070669_100089793
490 Ga0070688_100006040
491 Ga0070694_100000391
492 Ga0070694_100032084
493 Ga0070708_100000627
494 Ga0070662_100113641
495 Ga0070685_10017908
496 Ga0070706_100131011
497 Ga0070698_100206759
498 Ga0070697_100000090
499 Ga0070697_100263566
500 Ga0068853_100105400
501 Ga0070665_100019235
502 Ga0070704_100016824
503 Ga0068855_100034892
504 Ga0068856_100174553
505 Ga0068852_100011378
506 Ga0068864_100054224
507 Ga0075428_100063790
508 Ga0079104_1001382
509 Ga0105240_10000799
510 Ga0114129_10003091
511 Ga0114129_10149040
512 Ga0105243_10007754
513 Ga0105241_10045159
514 Ga0105241_10078566
515 Ga0105248_10556035
516 Ga0105238_10136221
517 Ga0105238_10189307
518 Ga0105246_10160366
519 Ga0157369_10165378
520 Ga0163162_10136302
521 Ga0163163_10001469
522 Ga0163163_10514378
523 Ga0182008_10038749
524 Ga0213872_10003077
525 Ga0213875_10000028
526 Ga0213871_10013381
527 Ga0209435_100007
528 Ga0209435_100444
529 Ga0209784_100021
530 Ga0209566_100119
531 Ga0209674_100036
532 Ga0209147_100017
533 Ga0209563_100040
534 Ga0209258_100115
535 Ga0209646_1000044
536 Ga0209646_1000107
537 Ga0209026_1000063
538 Ga0209026_1002436
539 Ga0209677_100023
540 Ga0209759_1000048
541 Ga0209759_1000198
542 Ga0209455_1007850
543 Ga0207705_10001882
544 Ga0207654_10008227
545 Ga0207707_10208615
546 Ga0207695_10001014
547 Ga0207649_10029056
548 Ga0207694_10163767
549 Ga0207694_10165564
550 Ga0207687_10014439
551 Ga0207706_10095462
552 Ga0207706_10163959
553 Ga0207686_10090618
554 Ga0207709_10008958
555 Ga0207691_10248230
556 Ga0207711_10413701
557 Ga0207679_10188862
558 Ga0207667_10049646
559 Ga0207641_10077953
560 Ga0207648_10080697
561 Ga0207674_10047425
562 Ga0207674_10259855
563 Ga0207698_10002135
564 Ga0209588_1047034
565 Ga0265338_10001154
566 Ga0265332_10002576
567 Ga0265332_10082299
568 Ga0265320_10020014
569 Ga0265340_10100155
570 Ga0265339_10109064
571 Ga0265316_10026352
572 Ga0265313_10004356
573 Ga0316575_10001267
574 Ga0316579_10075569
575 Ga0265314_10008084
576 Ga0265314_10014186
577 Ga0265342_10025984
578 Ga0316576_10001504
579 Ga0316576_10025852
580 Ga0316576_10111487
581 Ga0316576_10162513
582 Ga0316578_10037857
583 Ga0307405_10176965
584 Ga0316577_10074412
585 Ga0307413_10262172
586 Ga0307410_10120942
587 Ga0316583_10035925
588 Ga0316585_10005495
589 Ga0373929_0000004
590 Ga0373955_0277338
591 Ga0316574_0078553
592 Ga0316574_0109081
593 Ga0316582_0008189
594 Ga0316582_0045829
595 Ga0316584_0108477
596 Ga0395899_0031221
597 Ga0395899_0039535
598 Ga0395900_0002597
599 Ga0395900_0070626
600 Ga0395898_0037552
601 Ga0395898_0144000
602 Ga0395898_0162354
603 Ga0395898_0187657
604 Ga0395905_0000200
605 Ga0395905_0102524
606 Ga0436364_0302973
607 Ga0395901_0001076
608 Ga0395901_0095841
609 Ga0395901_0173565
610 Ga0395901_0211257
611 Ga0436360_0119357
612 Ga0436361_0951855
613 Ga0439438_019758
614 Ga0439431_0002553
615 Ga0439448_0003545
616 Ga0439450_011105
617 Ga0451577_0240267
618 Ga0466966_0022675
619 Ga0466964_0008040
620 Ga0453684_0006851
621 Ga0453684_0188339
622 Ga0466959_0032834
623 Ga0451576_0016111
624 Ga0451576_0407886
625 Ga0466958_0080704
626 Ga0466967_0011831
627 Ga0466967_0025158
628 Ga0495617_000027
629 Ga0495627_000277
630 Ga0495590_0000053
631 Ga0495590_0002275
632 Ga0495590_0079368
633 Ga0495591_000500
634 Ga0495591_010151
635 Ga0495638_0037507
636 Ga0495653_0052356
637 Ga0495650_0000431
638 Ga0495650_0000582
639 Ga0495650_0011511
640 Ga0495580_0058717
641 Ga0495580_0065881
642 Ga0495582_0003170
643 Ga0495605_0000135
644 Ga0495605_0012191
645 Ga0495605_0015501
646 Ga0495605_0020640
647 Ga0495605_0026339
648 Ga0495605_0035842
649 Ga0495605_0049840
650 Ga0495639_0103322
651 Ga0495584_0000713
652 Ga0495584_0001504
653 Ga0495584_0002767
654 Ga0495584_0004737
655 Ga0495584_0087823
656 Ga0495585_0000466
657 Ga0495585_0008237
658 Ga0495585_0012462
659 Ga0495585_0042221
660 Ga0495585_0072659
661 Ga0495596_0007284
662 Ga0495596_0007978
663 Ga0495596_0015867
664 Ga0495596_0025519
665 Ga0495607_0000264
666 Ga0495607_0002410
667 Ga0495607_0004458
668 Ga0495607_0006913
669 Ga0495607_0013419
670 Ga0495607_0036021
671 Ga0495583_0002349
672 Ga0495583_0003787
673 Ga0495583_0010812
674 Ga0495583_0013027
675 Ga0495583_0051393
676 Ga0495583_0055998
677 Ga0495583_0062646
678 Ga0495606_0001657
679 Ga0495606_0004035
680 Ga0495606_0006559
681 Ga0495606_0104391
682 Ga0495606_0123590
683 Ga0495606_0137678
684 Ga0495610_0007656
685 Ga0495610_0060696
686 Ga0495616_0000333
687 Ga0495616_0003764
688 Ga0495616_0015793
689 Ga0495616_0018132
690 Ga0495616_0030355
691 Ga0495616_0044418
692 Ga0495616_0131892
693 Ga0495630_0051331
694 Ga0495630_0527075
695 Ga0495631_0001600
696 Ga0495631_0002985
697 Ga0495631_0004324
698 Ga0495631_0010049
699 Ga0495632_0000069
700 Ga0495632_0000177
701 Ga0495632_0001178
702 Ga0495632_0001980
703 Ga0495632_0003331
704 Ga0495632_0012042
705 Ga0495632_0024295
706 Ga0495632_0094643
707 Ga0495637_0000053
708 Ga0495637_0006479
709 Ga0495643_0003928
710 Ga0495643_0005232
711 Ga0495643_0012850
712 Ga0495644_0001533
713 Ga0495644_0025951
714 Ga0495648_0005653
715 Ga0495648_0012325
716 Ga0495648_0022662
717 Ga0495648_0027822
718 Ga0495666_0000177
719 Ga0495642_0000137
720 Ga0495642_0000441
721 Ga0495642_0004645
722 Ga0495642_0014293
723 Ga0495642_0061333
724 Ga0495642_0082240
725 Ga0495652_0005568
726 Ga0495654_0049964
727 Ga0495665_0005443
728 Ga0495640_0049509
729 Ga0495587_0084837
730 Ga0495609_0000007
731 Ga0495609_0001446
732 Ga0495609_0002140
733 Ga0495609_0009229
734 Ga0495609_0010787
735 Ga0495609_0028195
736 Ga0495609_0031899
737 Ga0495609_0045456
738 Ga0495609_0046233
739 Ga0495609_0063852
740 Ga0495597_0000348
741 Ga0495597_0001336
742 Ga0495597_0010005
743 Ga0495597_0016854
744 Ga0495597_0037849
745 Ga0495645_0064044
746 Ga0495633_0002729
747 Ga0495633_0008912
748 Ga0495633_0013804
749 Ga0495667_0028373
750 Ga0495668_0000962
751 Ga0495668_0001492
752 Ga0495668_0001879
753 Ga0495668_0004143
754 Ga0495668_0012875
755 Ga0495634_0019868
756 Ga0495611_0000271
757 Ga0495611_0013322
758 Ga0495611_0015525
759 Ga0495611_0026123
760 Ga0495625_0000428
761 Ga0495625_0023402
762 Ga0495625_0068150
763 Ga0495625_0107901
764 Ga0495635_0005841
765 Ga0495635_0024893
766 Ga0495661_0000549
767 Ga0495661_0000776
768 Ga0495661_0001219
769 Ga0495661_0002786
770 Ga0495661_0017352
771 Ga0495588_0004898
772 Ga0495588_0010935
773 Ga0495623_0004426
774 Ga0495623_0028737
775 Ga0495646_0150632
776 Ga0495669_0000073
777 Ga0495669_0004634
778 Ga0495669_0015135
779 Ga0495669_0054349
780 Ga0495613_0043544
781 Ga0495613_0302710
782 Ga0495624_0095323
783 Ga0495670_0002459
784 Ga0495670_0004392
785 Ga0495670_0066295
786 Ga0495671_0002956
787 Ga0495649_0000291
788 Ga0495649_0009889
789 Ga0495649_0058310
790 Ga0495649_0060986
791 Ga0495589_0000081
792 Ga0495589_0001934
793 Ga0495589_0002218
794 Ga0495589_0007240
795 Ga0495589_0013992
796 Ga0495589_0017042
797 Ga0495600_0056858
798 Ga0495660_0021954
799 Ga0495604_0011966
800 Ga0495604_0061195
801 Ga0495636_0043791
802 Ga0495672_0000135
803 Ga0495672_0000340
804 Ga0495672_0016966
805 Ga0495672_0101384
806 Ga0495676_0000221
807 Ga0495680_0032272
808 Ga0495680_0049292
809 Ga0495680_0054413
810 Ga0495683_0001222
811 Ga0495683_0007113
812 Ga0495683_0031965
813 Ga0495687_000030
814 Ga0495687_000120
815 Ga0495687_000374
816 Ga0495687_002025
817 Ga0495675_0011591
818 Ga0495675_0070279
819 Ga0495677_0000045
820 Ga0495677_0000387
821 Ga0495677_0001504
822 Ga0495677_0003277
823 Ga0495677_0003624
824 Ga0495677_0011757
825 Ga0495677_0028312
826 Ga0495679_015610
827 Ga0495681_0000978
828 Ga0495681_0001523
829 Ga0495681_0002791
830 Ga0495681_0011838
831 Ga0495681_0043463
832 Ga0495686_0000793
833 Ga0495686_0000802
834 Ga0495686_0004415
835 Ga0495686_0017592
836 Ga0495602_0019975
837 Ga0495614_0005047
838 Ga0495626_0000105
839 Ga0495626_0001251
840 Ga0495626_0003522
841 Ga0495626_0005746
842 Ga0495626_0009393
843 Ga0495626_0010538
844 Ga0495626_0014390
845 Ga0495626_0020582
846 Ga0495626_0037534
847 Ga0495626_0075393
848 Ga0496102_0002351
849 Ga0496105_0287472
850 Ga0496108_0223643
851 Ga0496108_0411806
852 Ga0496109_0125405
853 Ga0496110_0000462
854 Ga0496110_0038136
855 Ga0496111_0072628
856 Ga0496111_0263133
857 Ga0496113_0269723
858 Ga0496115_0019484
859 Ga0496115_0077783
860 Ga0496116_0003824
861 Ga0496122_0000570
862 Ga0496122_0004067
863 Ga0496123_0000438
864 Ga0496123_0001939
865 Ga0496123_0006950
866 Ga0496124_0024256
867 Ga0496124_0044307
868 Ga0496124_0112084
869 Ga0496124_0241723
870 Ga0496125_0000701
871 Ga0496125_0005434
872 Ga0496125_0084626
873 Ga0496125_0112664
874 Ga0495678_000190
875 Ga0495678_000831
876 Ga0495678_001754
877 Ga0495678_002868
878 Ga0495678_004860
879 Ga0495682_0000714
880 Ga0495682_0007243
881 Ga0495682_0033712
882 Ga0501034_0000759
883 Ga0501034_0011664
884 Ga0501047_0106100
885 Ga0501072_0078783
886 Ga0501074_0299398
887 Ga0501075_0214193
888 Ga0501075_0240967
889 Ga0501076_0124213
890 Ga0501076_0151378
891 Ga0501077_0084455
892 Ga0501081_0228669
893 nmdc:mga05p37_6480_c1
894 nmdc:mga06r32_93509_c1
895 nmdc:mga0n895_114610_c1
896 Ga0495619_0039692
897 Ga0500643_013769
898 Ga0500556_0000455
899 Ga0500618_000364
900 Ga0500642_0076069
901 Ga0500624_000329
902 Ga0500636_0068734
903 Ga0501084_0065690
904 Ga0501082_0024762
905 Ga0501082_0435401
906 Ga0501082_0452124
907 Ga0530510_0107526
908 2511248563
909 2521559905
910 2550694927
911 2553006960
912 2687578412
913 2739611456
914 2765571142
915 2808982682
916 2809130183
917 2809145786
918 2809150340
919 2819594004
920 2819618206
921 2846040054
922 2852621437
923 2884811841
924 2884839832
925 2884856357
926 2887376839
927 2896113056
928 2896158722
929 2923513679
930 2939610120
931 2989393400
932 8002395693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

98

230

0.98

PF00571

CBS

CBS domain

326

382

0.93

PF00571

CBS

CBS domain

259

317

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9846 6 178
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9735 6 178
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.9718 1 190
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9685 2 189
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9635 2 189
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9909 7 195 3.40.50.10490
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9777 198 322 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9756 7 195 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9694 2 189 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9644 2 189 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A7C1G239-F1-model_v4 SIS domain-containing protein 0.9948 8 110 GO:0097367
GO:1901135
AF-A0A656SJ60-F1-model_v4 deleted 0.9915 40 121
AF-A0A5C9ADZ1-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9913 3 191 GO:0005975
GO:0016853
GO:0097367
GO:1901135
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9856 18 163 GO:0097367
GO:1901135
AF-A0A7G3ELT6-F1-model_v4 deleted 0.984 3 189

Map