F449773

General Info

Members Datasets Scaffolds Average Seq Length
466 336 932 417

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935675223|2935680058
Length 463
Sequence RSRGRSPSILSTITRHTAKAGMPVGRRCRNHLEVCQMAQRANQNRQANHALDAANFFLADVRDGLGPYLAIYLLTEQKWDEARIGMVMSIAGLAGVVAQTPAGALIDTTKAKRLVMVTAALVVTLASLLLPMFPSFWAVAISQGAAHAAGVIFPPAIAAVSLGVVGHRAFTARIGRNETFNHAGNATAAAIAGLSAYLFGPTVVFYLLAMMSLASIVSVWAIPESAIDHDLARGLHDVGPGTAQVQDQPAGLNVLLTCRPLLIFAVCVTLFHLSNAAMLPLVGQKLALQDKNLGTSLMSACIIAAQIMMVPMAMLVGAKADDWGHRRLFLAALLILPIRGALYTLSDNPAWLVGVQLLDGVGAGIFGAIFPVIVADLMRNTGRFNVAQGAVITAQSIGAALSTSLSGLVVVGAGYSAAFLTLGAVAAIGAAICFLTLPETRNFSRRSRRWQRVAGSTTGVAAE

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
43 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
97 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
98 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
208 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
220 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
224 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
227 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
228 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
229 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
230 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
231 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
232 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
233 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
234 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
235 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
236 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
237 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
238 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
239 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
240 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
241 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
242 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
243 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
244 2643221594 Achromobacter sp. Root170 Isolate Unclassified
245 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
246 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
247 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
248 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
249 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
250 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
251 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
252 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
253 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
254 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
255 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
256 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
257 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
258 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
259 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
260 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
261 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
262 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
263 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
264 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
265 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
266 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
267 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
268 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
269 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
270 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
271 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
272 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
273 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
274 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
275 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
276 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
277 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
278 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
279 2904699407
280 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
281 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
282 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
283 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
284 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
285 2922368715
286 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
287 2922425934
288 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
289 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
290 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
291 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
292 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
293 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
294 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
295 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
296 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
297 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
298 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
299 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
300 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
301 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
302 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
303 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
304 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
305 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
306 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
307 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
308 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
309 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
310 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
311 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
312 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
313 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
314 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
315 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
316 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
317 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
318 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
319 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
320 2941479691
321 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
322 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
323 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
324 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
325 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
326 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
327 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
328 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
329 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
330 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
331 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
332 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
333 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
334 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
335 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
336 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.16
Metatranscriptomes 0
Isolates 24.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.96
Nodule 19.74
Rhizoplane 3
Rhizosphere 37.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001946 3300003215 Bacteria 12244
2 JGI25153J46596_10004061 3300003215 Bacteria 7971
3 JGI25160J50197_1002244 3300003354 Bacteria 9076
4 Ga0055543_1001918 3300004625 Bacteria 7460
5 Ga0065165_1001964 3300005262 Bacteria 19484
6 Ga0065165_1002049 3300005262 Bacteria 18679
7 Ga0065165_1008770 3300005262 Bacteria 4660
8 Ga0068869_100043227 3300005334 Bacteria 3235
9 Ga0068868_100218513 3300005338 Bacteria 1595
10 Ga0070660_100070845 3300005339 Bacteria 2721
11 Ga0070668_100076386 3300005347 Bacteria 2616
12 Ga0070667_100166424 3300005367 Bacteria 1945
13 Ga0070709_10002327 3300005434 Bacteria 10299
14 Ga0070709_10012136 3300005434 Bacteria 4816
15 Ga0070709_10030380 3300005434 Bacteria 3242
16 Ga0070714_100023123 3300005435 Bacteria 5102
17 Ga0070713_100011577 3300005436 Bacteria 6430
18 Ga0070713_100036595 3300005436 Bacteria 3962
19 Ga0070713_100128972 3300005436 Bacteria 2228
20 Ga0070710_10000243 3300005437 Bacteria 25537
21 Ga0070710_10005387 3300005437 Bacteria 6072
22 Ga0070710_10104723 3300005437 Bacteria 1690
23 Ga0070711_100005047 3300005439 Bacteria 7857
24 Ga0070711_100023909 3300005439 Bacteria 3980
25 Ga0070711_100163411 3300005439 Bacteria 1690
26 Ga0070663_100000924 3300005455 Bacteria 15940
27 Ga0070663_100048150 3300005455 Bacteria 3021
28 Ga0070678_100055060 3300005456 Bacteria 2902
29 Ga0070685_10085967 3300005466 Bacteria 1895
30 Ga0070706_100041015 3300005467 Bacteria 4274
31 Ga0070698_100085668 3300005471 Bacteria 3137
32 Ga0070679_100080633 3300005530 Bacteria 3244
33 Ga0070665_100021790 3300005548 Bacteria 6443
34 Ga0070665_100050431 3300005548 Bacteria 4176
35 Ga0070665_100078885 3300005548 Bacteria 3299
36 Ga0070665_100225017 3300005548 Bacteria 1876
37 Ga0068855_100154691 3300005563 Bacteria 2606
38 Ga0068857_100046311 3300005577 Bacteria 3859
39 Ga0068859_100099818 3300005617 Bacteria 2958
40 Ga0068863_100231685 3300005841 Bacteria 1782
41 Ga0068860_100071325 3300005843 Bacteria 3301
42 Ga0081540_1003760 3300005983 Bacteria 11893
43 Ga0070717_10002844 3300006028 Bacteria 12270
44 Ga0070717_10189197 3300006028 Bacteria 1798
45 Ga0075365_10003658 3300006038 Bacteria 7976
46 Ga0075365_10035290 3300006038 Bacteria 3234
47 Ga0075365_10070098 3300006038 Bacteria 2357
48 Ga0075368_10042462 3300006042 Bacteria 1789
49 Ga0075363_100017762 3300006048 Bacteria 3533
50 Ga0075364_10047562 3300006051 Bacteria 2795
51 Ga0070716_100004129 3300006173 Bacteria 6890
52 Ga0070712_100005787 3300006175 Bacteria 7642
53 Ga0070712_100012116 3300006175 Bacteria 5479
54 Ga0075367_10028585 3300006178 Bacteria 3182
55 Ga0075367_10038267 3300006178 Bacteria 2792
56 Ga0075367_10055497 3300006178 Bacteria 2351
57 Ga0075367_10079376 3300006178 Bacteria 1983
58 Ga0075369_10077669 3300006186 Bacteria 1469
59 Ga0075366_10078936 3300006195 Bacteria 1964
60 Ga0075366_10091838 3300006195 Bacteria 1819
61 Ga0075370_10017942 3300006353 Bacteria 3831
62 Ga0075370_10036147 3300006353 Bacteria 2774
63 Ga0075370_10075582 3300006353 Bacteria 1931
64 Ga0068871_100035845 3300006358 Bacteria 3945
65 Ga0075434_100041351 3300006871 Bacteria 4567
66 Ga0097620_100099818 3300006931 Bacteria 2958
67 Ga0099824_1011728 3300006942 Bacteria 9798
68 Ga0099824_1028675 3300006942 Bacteria 2487
69 Ga0099822_1003331 3300006943 Bacteria 20558
70 Ga0099794_10008353 3300007265 Bacteria 4297
71 Ga0105240_10033003 3300009093 Bacteria 6694
72 Ga0105240_10291183 3300009093 Bacteria 1872
73 Ga0105245_10103373 3300009098 Bacteria 2639
74 Ga0105241_10018648 3300009174 Bacteria 5108
75 Ga0105241_10019468 3300009174 Bacteria 5005
76 Ga0105248_10340878 3300009177 Bacteria 1687
77 Ga0105237_10001286 3300009545 Bacteria 33400
78 Ga0105237_10162728 3300009545 Bacteria 2230
79 Ga0105238_10011696 3300009551 Bacteria 8846
80 Ga0105238_10205362 3300009551 Bacteria 1946
81 Ga0105239_10061496 3300010375 Bacteria 4122
82 Ga0105239_10062604 3300010375 Bacteria 4084
83 Ga0157369_10002440 3300013105 Bacteria 22333
84 Ga0157378_10320331 3300013297 Bacteria 1506
85 Ga0163162_10184305 3300013306 Bacteria 2214
86 Ga0163163_10082045 3300014325 Bacteria 3227
87 Ga0157379_10130981 3300014968 Bacteria 2258
88 Ga0213874_10013512 3300021377 Bacteria 2117
89 Ga0213876_10014284 3300021384 Bacteria 4209
90 Ga0213875_10004662 3300021388 Bacteria 7470
91 Ga0209677_100648 3300025253 Bacteria 18413
92 Ga0209233_1008305 3300025261 Bacteria 3223
93 Ga0209455_1016512 3300025272 Bacteria 1583
94 Ga0209676_1002272 3300025292 Bacteria 14115
95 Ga0209758_1000216 3300025297 Bacteria 125352
96 Ga0209758_1018214 3300025297 Bacteria 3455
97 Ga0209758_1027796 3300025297 Bacteria 2409
98 Ga0209050_1004144 3300025298 Bacteria 10048
99 Ga0209256_1003514 3300025299 Bacteria 10913
100 Ga0207426_1000611 3300025302 Bacteria 46127
101 Ga0207426_1001360 3300025302 Bacteria 20729
102 Ga0207426_1019852 3300025302 Bacteria 2343
103 Ga0209257_1001630 3300025304 Bacteria 25715
104 Ga0207692_10000577 3300025898 Bacteria 13067
105 Ga0207692_10006885 3300025898 Bacteria 4632
106 Ga0207688_10013193 3300025901 Bacteria 4491
107 Ga0207688_10070454 3300025901 Bacteria 1983
108 Ga0207680_10095946 3300025903 Bacteria 1896
109 Ga0207699_10000577 3300025906 Bacteria 18050
110 Ga0207699_10001804 3300025906 Bacteria 10060
111 Ga0207705_10185590 3300025909 Bacteria 1571
112 Ga0207654_10051067 3300025911 Bacteria 2378
113 Ga0207654_10076574 3300025911 Bacteria 2003
114 Ga0207695_10000342 3300025913 Bacteria 108393
115 Ga0207671_10048883 3300025914 Bacteria 3130
116 Ga0207693_10010254 3300025915 Bacteria 7606
117 Ga0207693_10019843 3300025915 Bacteria 5345
118 Ga0207663_10001790 3300025916 Bacteria 10133
119 Ga0207663_10010860 3300025916 Bacteria 4864
120 Ga0207663_10121875 3300025916 Bacteria 1787
121 Ga0207657_10094145 3300025919 Bacteria 2495
122 Ga0207652_10030606 3300025921 Bacteria 4509
123 Ga0207700_10027974 3300025928 Bacteria 3956
124 Ga0207700_10034010 3300025928 Bacteria 3654
125 Ga0207664_10002857 3300025929 Bacteria 11472
126 Ga0207664_10087477 3300025929 Bacteria 2547
127 Ga0207706_10201231 3300025933 Bacteria 1747
128 Ga0207709_10110278 3300025935 Bacteria 1838
129 Ga0207665_10018413 3300025939 Bacteria 4589
130 Ga0207665_10052813 3300025939 Bacteria 2738
131 Ga0207689_10098312 3300025942 Bacteria 2404
132 Ga0207677_10201054 3300026023 Bacteria 1584
133 Ga0207678_10000808 3300026067 Bacteria 28722
134 Ga0207678_10035964 3300026067 Bacteria 4311
135 Ga0207678_10044806 3300026067 Bacteria 3825
136 Ga0207708_10215450 3300026075 Bacteria 1536
137 Ga0207641_10145885 3300026088 Bacteria 2140
138 Ga0207676_10102217 3300026095 Bacteria 2379
139 Ga0207674_10057473 3300026116 Bacteria 3943
140 Ga0207675_100202567 3300026118 Bacteria 1906
141 Ga0207683_10110237 3300026121 Bacteria 2464
142 Ga0209389_1000196 3300027296 Bacteria 43831
143 Ga0209389_1000284 3300027296 Bacteria 31998
144 Ga0209589_1000003 3300027357 Bacteria 629130
145 Ga0209589_1001029 3300027357 Bacteria 43810
146 Ga0209489_100003 3300027361 Bacteria 663105
147 Ga0209489_101824 3300027361 Bacteria 43831
148 Ga0209700_100003 3300027363 Bacteria 663105
149 Ga0209700_103273 3300027363 Bacteria 31313
150 Ga0268266_10003236 3300028379 Bacteria 16447
151 Ga0268266_10039251 3300028379 Bacteria 4032
152 Ga0268266_10168214 3300028379 Bacteria 1988
153 Ga0265337_1001969 3300028556 Bacteria 9766
154 Ga0265334_10001941 3300028573 Bacteria 9811
155 Ga0265336_10000322 3300028666 Bacteria 32476
156 Ga0265338_10001338 3300028800 Bacteria 40180
157 Ga0265324_10006069 3300029957 Bacteria 5105
158 Ga0265340_10045050 3300031247 Bacteria 2156
159 Ga0307509_10001966 3300031507 Bacteria 33940
160 Ga0307408_100075483 3300031548 Bacteria 2505
161 Ga0315911_1000005 3300033442 Bacteria 426255
162 Ga0373926_0020886 3300035083 Bacteria 2264
163 Ga0373934_0039102 3300035086 Bacteria 1869
164 Ga0373923_0001456 3300035111 Bacteria 6795
165 Ga0373936_0008712 3300035113 Bacteria 3820
166 Ga0373956_0005465 3300035119 Bacteria 5090
167 Ga0373943_0018435 3300035170 Bacteria 3207
168 Ga0373946_0010700 3300035171 Bacteria 3405
169 Ga0373927_0101679 3300035695 Bacteria 1869
170 Ga0373925_0201036 3300037068 Bacteria 1584
171 Ga0395900_0031878 3300037418 Bacteria 5418
172 Ga0395898_0003145 3300037466 Bacteria 18639
173 Ga0395898_0032607 3300037466 Bacteria 5201
174 Ga0395905_0012493 3300037471 Bacteria 8173
175 Ga0436364_0293754 3300037853 Bacteria 44649
176 Ga0436364_0753756 3300037853 Bacteria 2025
177 Ga0395901_0335247 3300038443 Bacteria 1563
178 Ga0436365_0007077 3300039437 Bacteria 42426
179 Ga0436365_0110080 3300039437 Bacteria 8767
180 Ga0436365_1367297 3300039437 Bacteria 3904
181 Ga0436365_1382877 3300039437 Bacteria 4774
182 Ga0436365_1582582 3300039437 Bacteria 2062
183 Ga0436360_0156797 3300039438 Bacteria 1381
184 Ga0436360_0461655 3300039438 Bacteria 4164
185 Ga0436360_0504339 3300039438 Bacteria 2274
186 Ga0436361_0578065 3300039447 Bacteria 2832
187 Ga0436363_1111134 3300039450 Bacteria 7025
188 Ga0436362_1080124 3300039453 Bacteria 2600
189 Ga0466972_0000149 3300044658 Bacteria 56799
190 Ga0466972_0001784 3300044658 Bacteria 10536
191 Ga0466972_0003999 3300044658 Bacteria 7345
192 Ga0466961_0042155 3300044693 Bacteria 2926
193 Ga0495629_0088117 3300046459 Bacteria 2165
194 Ga0495629_0101904 3300046459 Bacteria 2003
195 Ga0495638_0004117 3300046460 Bacteria 11125
196 Ga0495638_0005756 3300046460 Bacteria 9127
197 Ga0495638_0015848 3300046460 Bacteria 5050
198 Ga0495638_0016377 3300046460 Bacteria 4966
199 Ga0495638_0119798 3300046460 Bacteria 1556
200 Ga0495580_0012067 3300046472 Bacteria 6650
201 Ga0495662_0100887 3300046476 Bacteria 1412
202 Ga0495664_0015855 3300046477 Bacteria 4287
203 Ga0495596_0032780 3300046500 Bacteria 2070
204 Ga0495607_0020105 3300046501 Bacteria 4227
205 Ga0495608_0144207 3300046511 Bacteria 1519
206 Ga0495616_0062889 3300046513 Bacteria 1816
207 Ga0495618_0021343 3300046514 Bacteria 3992
208 Ga0495620_0027521 3300046515 Bacteria 2659
209 Ga0495630_0051706 3300046517 Bacteria 3075
210 Ga0495632_0050593 3300046519 Bacteria 2048
211 Ga0495643_0061691 3300046522 Bacteria 1987
212 Ga0495644_0042139 3300046523 Bacteria 1719
213 Ga0495648_0074874 3300046524 Bacteria 1949
214 Ga0495665_0016517 3300046531 Bacteria 3977
215 Ga0495640_0017387 3300046533 Bacteria 5362
216 Ga0495645_0088934 3300046543 Bacteria 2208
217 Ga0495625_0124350 3300046660 Bacteria 1752
218 Ga0495661_0019835 3300046665 Bacteria 4398
219 Ga0495588_0055737 3300046674 Bacteria 2040
220 Ga0495588_0080550 3300046674 Bacteria 1699
221 Ga0495599_0055384 3300046678 Bacteria 2484
222 Ga0495624_0065711 3300046690 Bacteria 2265
223 Ga0495581_0020687 3300047315 Bacteria 3816
224 Ga0495672_0000153 3300047320 Bacteria 100183
225 Ga0495673_0023779 3300047469 Bacteria 2973
226 Ga0495684_0010100 3300047471 Bacteria 7300
227 Ga0495686_0049612 3300047472 Bacteria 2640
228 Ga0496102_0234296 3300048905 Bacteria 1731
229 Ga0496103_0036389 3300048906 Bacteria 3015
230 Ga0496104_0007905 3300048907 Bacteria 9429
231 Ga0496105_0233249 3300048908 Bacteria 1495
232 Ga0496106_0141901 3300048909 Bacteria 1890
233 Ga0496108_0043667 3300048911 Bacteria 3744
234 Ga0496108_0089358 3300048911 Bacteria 2618
235 Ga0496109_0011738 3300048912 Bacteria 7538
236 Ga0496110_0127779 3300048913 Bacteria 2294
237 Ga0496112_0236650 3300048915 Bacteria 1780
238 Ga0496115_0033706 3300048918 Bacteria 4044
239 Ga0496115_0098752 3300048918 Bacteria 2392
240 Ga0496115_0189382 3300048918 Bacteria 1700
241 Ga0496116_0002393 3300048919 Bacteria 19774
242 Ga0496116_0016305 3300048919 Bacteria 5818
243 Ga0496116_0016496 3300048919 Bacteria 5775
244 Ga0496116_0020008 3300048919 Bacteria 5099
245 Ga0496116_0035626 3300048919 Bacteria 3492
246 Ga0496117_0045577 3300048920 Bacteria 3165
247 Ga0496117_0057053 3300048920 Bacteria 2715
248 Ga0496118_0011416 3300048921 Bacteria 8672
249 Ga0496118_0023940 3300048921 Bacteria 5286
250 Ga0496118_0051532 3300048921 Bacteria 3148
251 Ga0496118_0111024 3300048921 Bacteria 1819
252 Ga0496119_0018836 3300048922 Bacteria 5114
253 Ga0496119_0095173 3300048922 Bacteria 1683
254 Ga0496120_0042401 3300048923 Bacteria 2657
255 Ga0496120_0046208 3300048923 Bacteria 2517
256 Ga0496121_0000094 3300048924 Bacteria 212726
257 Ga0496121_0000214 3300048924 Bacteria 127349
258 Ga0496121_0002554 3300048924 Bacteria 27574
259 Ga0496121_0008280 3300048924 Bacteria 12300
260 Ga0496121_0016222 3300048924 Bacteria 7708
261 Ga0496121_0031776 3300048924 Bacteria 4815
262 Ga0496121_0042304 3300048924 Bacteria 3966
263 Ga0496121_0066096 3300048924 Bacteria 2938
264 Ga0496121_0069934 3300048924 Bacteria 2830
265 Ga0496122_0000077 3300048925 Bacteria 218099
266 Ga0496122_0015290 3300048925 Bacteria 7342
267 Ga0496122_0034894 3300048925 Bacteria 4106
268 Ga0496123_0000526 3300048926 Bacteria 65966
269 Ga0496123_0016472 3300048926 Bacteria 5999
270 Ga0496123_0025210 3300048926 Bacteria 4490
271 Ga0496123_0106139 3300048926 Bacteria 1619
272 Ga0496124_0070795 3300048927 Bacteria 2892
273 Ga0496124_0077903 3300048927 Bacteria 2733
274 Ga0496124_0083494 3300048927 Bacteria 2620
275 Ga0496125_0000259 3300048928 Bacteria 109184
276 Ga0496125_0000904 3300048928 Bacteria 46904
277 Ga0496125_0026703 3300048928 Bacteria 5250
278 Ga0496125_0077064 3300048928 Bacteria 2572
279 Ga0496126_0004022 3300048929 Bacteria 17912
280 Ga0496126_0005193 3300048929 Bacteria 15036
281 Ga0496126_0012423 3300048929 Bacteria 8726
282 Ga0496126_0017791 3300048929 Bacteria 7075
283 Ga0496126_0060551 3300048929 Bacteria 3404
284 Ga0496126_0151024 3300048929 Bacteria 1991
285 Ga0501070_0055735 3300049586 Bacteria 3276
286 Ga0501073_0071669 3300049589 Bacteria 2414
287 Ga0501074_0102014 3300049590 Bacteria 2054
288 nmdc:mga03n38_25837_c1 3300050490 Bacteria 2418
289 nmdc:mga00v17_16554_c1 3300050491 Bacteria 4155
290 nmdc:mga0yw44_57322_c1 3300050492 Bacteria 2376
291 nmdc:mga0yw44_80968_c1 3300050492 Bacteria 2035
292 nmdc:mga0yw44_8327_c1 3300050492 Bacteria 5156
293 nmdc:mga0k408_76410_c1 3300050493 Bacteria 1957
294 nmdc:mga06z11_58983_c1 3300050494 Bacteria 1993
295 nmdc:mga04h51_21991_c1 3300050495 Bacteria 1924
296 nmdc:mga07m45_1913_c3 3300050496 Bacteria 7218
297 nmdc:mga07m45_78149_c1 3300050496 Bacteria 1888
298 nmdc:mga0n895_42638_c1 3300050512 Bacteria 4415
299 nmdc:mga0rr50_46539_c1 3300050513 Bacteria 3194
300 nmdc:mga0sz30_70694_c1 3300050516 Bacteria 1502
301 Ga0495601_0142383 3300053077 Bacteria 1564
302 Ga0495612_0016968 3300053078 Bacteria 2917
303 Ga0500635_0000728 3300053080 Bacteria 8254
304 Ga0500635_0002189 3300053080 Bacteria 4805
305 Ga0500581_026256 3300053089 Bacteria 2966
306 Ga0500651_0048062 3300053093 Bacteria 2682
307 Ga0500651_0120092 3300053093 Bacteria 1596
308 Ga0500566_0000017 3300053094 Bacteria 93636
309 Ga0500566_0018903 3300053094 Bacteria 4045
310 Ga0500640_000030 3300053095 Bacteria 21521
311 Ga0500556_0000051 3300053104 Bacteria 119031
312 Ga0500557_000001 3300053105 Bacteria 241298
313 Ga0500562_007506 3300053108 Bacteria 2750
314 Ga0500569_020920 3300053109 Bacteria 1723
315 Ga0500572_000051 3300053111 Bacteria 35133
316 Ga0500572_000209 3300053111 Bacteria 20713
317 Ga0500592_001249 3300053116 Bacteria 4143
318 Ga0500595_002354 3300053119 Bacteria 9447
319 Ga0500608_027410 3300053122 Bacteria 2685
320 Ga0500614_000403 3300053123 Bacteria 11258
321 Ga0500642_0000077 3300053130 Bacteria 53422
322 Ga0500642_0000218 3300053130 Bacteria 22730
323 Ga0500652_007408 3300053131 Bacteria 3593
324 Ga0500559_0000217 3300053136 Bacteria 46155
325 Ga0500559_0000419 3300053136 Bacteria 30438
326 Ga0500559_0000767 3300053136 Bacteria 21035
327 Ga0500568_0002115 3300053139 Bacteria 11995
328 Ga0500586_025794 3300053145 Bacteria 1898
329 Ga0500590_032261 3300053148 Bacteria 2717
330 Ga0500603_000079 3300053150 Bacteria 22213
331 Ga0500603_000265 3300053150 Bacteria 13804
332 Ga0500604_0002537 3300053151 Bacteria 4983
333 Ga0500616_0000150 3300053153 Bacteria 117918
334 Ga0500622_0000277 3300053156 Bacteria 52401
335 Ga0500622_0002661 3300053156 Bacteria 12677
336 Ga0500630_000137 3300053159 Bacteria 25742
337 Ga0500639_000015 3300053163 Bacteria 119636
338 Ga0500636_0025308 3300053177 Bacteria 3506
339 Ga0500637_0005671 3300053178 Bacteria 6068
340 Ga0500637_0029224 3300053178 Bacteria 3056
341 Ga0500637_0094955 3300053178 Bacteria 1727
342 Ga0500570_080169 3300053724 Bacteria 1475
343 Ga0500625_000230 3300053729 Bacteria 12911
344 Ga0500645_008399 3300053730 Bacteria 3531
345 Ga0500596_000046 3300053735 Bacteria 16367
346 Ga0500596_000203 3300053735 Bacteria 9886
347 Ga0500601_001042 3300053737 Bacteria 3155
348 Ga0500601_002202 3300053737 Bacteria 2094
349 2935680058 2935675223 Bacteria 9928132
350 2509078329 2508501114 Bacteria 7082538
351 2509149122 2508501128 Bacteria 8613869
352 2513628298 2513237092 Bacteria 8341956
353 2513641917 2513237094 Bacteria 8789602
354 2513646280 2513237095 Bacteria 8976980
355 2513657587 2513237096 Bacteria 8722461
356 2513671892 2513237098 Bacteria 9902361
357 2513700304 2513237102 Bacteria 7703324
358 2513861637 2513237137 Bacteria 9558895
359 2513894401 2513237141 Bacteria 8496279
360 2513916840 2513237145 Bacteria 8979722
361 2517103639 2517093001 Bacteria 9002274
362 2524533085 2524023228 Bacteria 10118060
363 2528855525 2528768022 Bacteria 10457665
364 2603862321 2602042107 Bacteria 6226103
365 2643982535 2643221594 Bacteria 5811388
366 2793060375 2791355196 Bacteria 7323613
367 2793070268 2791355197 Bacteria 8420563
368 2809034645 2808606395 Bacteria 6020352
369 2824602227 2824600985 Bacteria 8488197
370 2824610215 2824609381 Bacteria 8672835
371 2824623570 2824617872 Bacteria 8814715
372 2824630932 2824626560 Bacteria 8813858
373 2824640044 2824635225 Bacteria 8785348
374 2824647808 2824644064 Bacteria 8743947
375 2824656198 2824653114 Bacteria 8493680
376 2824666959 2824661429 Bacteria 9877870
377 2824710058 2824704595 Bacteria 9667483
378 2824717663 2824714736 Bacteria 8717648
379 2824727830 2824723954 Bacteria 8758240
380 2824758139 2824753945 Bacteria 9787441
381 2824766605 2824763712 Bacteria 9792355
382 2824773914 2824773399 Bacteria 8360218
383 2841962360 2841957949 Bacteria 8652217
384 2842337328 2842333319 Bacteria 8899485
385 2844318133 2844315083 Bacteria 8138177
386 2847934942 2847930680 Bacteria 9342022
387 2847945523 2847939898 Bacteria 8606328
388 2849080288 2849076700 Bacteria 7039503
389 2857525792 2857524615 Bacteria 6615449
390 2874636531 2874628541 Bacteria 8630250
391 2876762550 2876761206 Bacteria 10111113
392 2879086333 2879083081 Bacteria 8587928
393 2879109445 2879099564 Bacteria 10442239
394 2881366339 2881364244 Bacteria 7710352
395 2881672966 2881665667 Bacteria 8175609
396 2888382942 2888378607 Bacteria 9652610
397 2888423407 2888419890 Bacteria 7857137
398 2893067917 2893066018 Bacteria 6158120
399 2897809845 2897803580 Bacteria 7000062
400 2904707491
401 2904716778 2904711408 Bacteria 9771557
402 2906649848 2906643746 Bacteria 8722424
403 2908746444 2908739725 Bacteria 8628932
404 2919074346 2919073203 Bacteria 6531949
405 2922367804 2922361189 Bacteria 7436256
406 2922373144
407 2922392292 2922386360 Bacteria 7017218
408 2922426593
409 2929615794 2929615660 Bacteria 9193770
410 2929630407 2929624759 Bacteria 9339455
411 2932792055 2932784394 Bacteria 9704911
412 2932814078 2932809354 Bacteria 9135765
413 2932819434 2932818245 Bacteria 9955613
414 2932833857 2932828146 Bacteria 9745859
415 2933578920 2933577622 Bacteria 9116884
416 2935618613 2935616580 Bacteria 9032984
417 2935644544 2935638405 Bacteria 10015038
418 2935673565 2935665750 Bacteria 9571747
419 2935678452 2935675223 Bacteria 9928132
420 2935688119 2935684952 Bacteria 9590419
421 2935693863 2935684952 Bacteria 9590419
422 2935700697 2935694250 Bacteria 9291695
423 2935715138 2935713505 Bacteria 9608509
424 2935721985 2935713505 Bacteria 9608509
425 2935726297 2935722832 Bacteria 9608746
426 2935731370 2935722832 Bacteria 9608746
427 2935733957 2935732158 Bacteria 9706831
428 2935741070 2935732158 Bacteria 9706831
429 2935743336 2935741537 Bacteria 9707219
430 2935750446 2935741537 Bacteria 9707219
431 2935754626 2935750917 Bacteria 9590372
432 2935759701 2935750917 Bacteria 9590372
433 2935765405 2935760218 Bacteria 9817913
434 2935776325 2935769743 Bacteria 7878163
435 2935790314 2935785616 Bacteria 7962367
436 2935798897 2935793552 Bacteria 8012592
437 2935805356 2935801545 Bacteria 9301974
438 2935816654 2935810662 Bacteria 9401221
439 2935833707 2935827899 Bacteria 10038562
440 2935839607 2935837841 Bacteria 9454360
441 2935856978 2935855204 Bacteria 9035059
442 2935871194 2935864058 Bacteria 9784707
443 2935876303 2935873716 Bacteria 9632195
444 2935997734 2935992306 Bacteria 9802711
445 2936007246 2936002035 Bacteria 9362176
446 2936043084 2936037263 Bacteria 9446081
447 2940559997 2940556831 Bacteria 9590747
448 2940565606 2940556831 Bacteria 9590747
449 2941484432
450 2941540296 2941538514 Bacteria 9402094
451 3005507834 3005506211 Bacteria 6943378
452 3005721369 3005718088 Bacteria 8283608
453 8006937246 8006933436 Bacteria 10410654
454 8006977257 8006973647 Bacteria 10679141
455 8016514576 8016511872 Bacteria 9921665
456 8016591400 8016583857 Bacteria 10421953
457 8016592308 8016583857 Bacteria 10421953
458 8017061854 8017057580 Bacteria 10023680
459 8019571483 8019565922 Bacteria 9639779
460 8019589011 8019586578 Bacteria 10212056
461 8019602223 8019597564 Bacteria 10041141
462 8019616339 8019608314 Bacteria 10042931
463 8019657137 8019648815 Bacteria 10014479
464 8055747441 8055742211 Bacteria 9226248
465 8056694171 8056689827 Bacteria 6712655
466 8056972485 8056967851 Bacteria 9038162
467 JGI25153J46596_10001946
468 JGI25153J46596_10004061
469 JGI25160J50197_1002244
470 Ga0055543_1001918
471 Ga0065165_1001964
472 Ga0065165_1002049
473 Ga0065165_1008770
474 Ga0068869_100043227
475 Ga0068868_100218513
476 Ga0070660_100070845
477 Ga0070668_100076386
478 Ga0070667_100166424
479 Ga0070709_10002327
480 Ga0070709_10012136
481 Ga0070709_10030380
482 Ga0070714_100023123
483 Ga0070713_100011577
484 Ga0070713_100036595
485 Ga0070713_100128972
486 Ga0070710_10000243
487 Ga0070710_10005387
488 Ga0070710_10104723
489 Ga0070711_100005047
490 Ga0070711_100023909
491 Ga0070711_100163411
492 Ga0070663_100000924
493 Ga0070663_100048150
494 Ga0070678_100055060
495 Ga0070685_10085967
496 Ga0070706_100041015
497 Ga0070698_100085668
498 Ga0070679_100080633
499 Ga0070665_100021790
500 Ga0070665_100050431
501 Ga0070665_100078885
502 Ga0070665_100225017
503 Ga0068855_100154691
504 Ga0068857_100046311
505 Ga0068859_100099818
506 Ga0068863_100231685
507 Ga0068860_100071325
508 Ga0081540_1003760
509 Ga0070717_10002844
510 Ga0070717_10189197
511 Ga0075365_10003658
512 Ga0075365_10035290
513 Ga0075365_10070098
514 Ga0075368_10042462
515 Ga0075363_100017762
516 Ga0075364_10047562
517 Ga0070716_100004129
518 Ga0070712_100005787
519 Ga0070712_100012116
520 Ga0075367_10028585
521 Ga0075367_10038267
522 Ga0075367_10055497
523 Ga0075367_10079376
524 Ga0075369_10077669
525 Ga0075366_10078936
526 Ga0075366_10091838
527 Ga0075370_10017942
528 Ga0075370_10036147
529 Ga0075370_10075582
530 Ga0068871_100035845
531 Ga0075434_100041351
532 Ga0097620_100099818
533 Ga0099824_1011728
534 Ga0099824_1028675
535 Ga0099822_1003331
536 Ga0099794_10008353
537 Ga0105240_10033003
538 Ga0105240_10291183
539 Ga0105245_10103373
540 Ga0105241_10018648
541 Ga0105241_10019468
542 Ga0105248_10340878
543 Ga0105237_10001286
544 Ga0105237_10162728
545 Ga0105238_10011696
546 Ga0105238_10205362
547 Ga0105239_10061496
548 Ga0105239_10062604
549 Ga0157369_10002440
550 Ga0157378_10320331
551 Ga0163162_10184305
552 Ga0163163_10082045
553 Ga0157379_10130981
554 Ga0213874_10013512
555 Ga0213876_10014284
556 Ga0213875_10004662
557 Ga0209677_100648
558 Ga0209233_1008305
559 Ga0209455_1016512
560 Ga0209676_1002272
561 Ga0209758_1000216
562 Ga0209758_1018214
563 Ga0209758_1027796
564 Ga0209050_1004144
565 Ga0209256_1003514
566 Ga0207426_1000611
567 Ga0207426_1001360
568 Ga0207426_1019852
569 Ga0209257_1001630
570 Ga0207692_10000577
571 Ga0207692_10006885
572 Ga0207688_10013193
573 Ga0207688_10070454
574 Ga0207680_10095946
575 Ga0207699_10000577
576 Ga0207699_10001804
577 Ga0207705_10185590
578 Ga0207654_10051067
579 Ga0207654_10076574
580 Ga0207695_10000342
581 Ga0207671_10048883
582 Ga0207693_10010254
583 Ga0207693_10019843
584 Ga0207663_10001790
585 Ga0207663_10010860
586 Ga0207663_10121875
587 Ga0207657_10094145
588 Ga0207652_10030606
589 Ga0207700_10027974
590 Ga0207700_10034010
591 Ga0207664_10002857
592 Ga0207664_10087477
593 Ga0207706_10201231
594 Ga0207709_10110278
595 Ga0207665_10018413
596 Ga0207665_10052813
597 Ga0207689_10098312
598 Ga0207677_10201054
599 Ga0207678_10000808
600 Ga0207678_10035964
601 Ga0207678_10044806
602 Ga0207708_10215450
603 Ga0207641_10145885
604 Ga0207676_10102217
605 Ga0207674_10057473
606 Ga0207675_100202567
607 Ga0207683_10110237
608 Ga0209389_1000196
609 Ga0209389_1000284
610 Ga0209589_1000003
611 Ga0209589_1001029
612 Ga0209489_100003
613 Ga0209489_101824
614 Ga0209700_100003
615 Ga0209700_103273
616 Ga0268266_10003236
617 Ga0268266_10039251
618 Ga0268266_10168214
619 Ga0265337_1001969
620 Ga0265334_10001941
621 Ga0265336_10000322
622 Ga0265338_10001338
623 Ga0265324_10006069
624 Ga0265340_10045050
625 Ga0307509_10001966
626 Ga0307408_100075483
627 Ga0315911_1000005
628 Ga0373926_0020886
629 Ga0373934_0039102
630 Ga0373923_0001456
631 Ga0373936_0008712
632 Ga0373956_0005465
633 Ga0373943_0018435
634 Ga0373946_0010700
635 Ga0373927_0101679
636 Ga0373925_0201036
637 Ga0395900_0031878
638 Ga0395898_0003145
639 Ga0395898_0032607
640 Ga0395905_0012493
641 Ga0436364_0293754
642 Ga0436364_0753756
643 Ga0395901_0335247
644 Ga0436365_0007077
645 Ga0436365_0110080
646 Ga0436365_1367297
647 Ga0436365_1382877
648 Ga0436365_1582582
649 Ga0436360_0156797
650 Ga0436360_0461655
651 Ga0436360_0504339
652 Ga0436361_0578065
653 Ga0436363_1111134
654 Ga0436362_1080124
655 Ga0466972_0000149
656 Ga0466972_0001784
657 Ga0466972_0003999
658 Ga0466961_0042155
659 Ga0495629_0088117
660 Ga0495629_0101904
661 Ga0495638_0004117
662 Ga0495638_0005756
663 Ga0495638_0015848
664 Ga0495638_0016377
665 Ga0495638_0119798
666 Ga0495580_0012067
667 Ga0495662_0100887
668 Ga0495664_0015855
669 Ga0495596_0032780
670 Ga0495607_0020105
671 Ga0495608_0144207
672 Ga0495616_0062889
673 Ga0495618_0021343
674 Ga0495620_0027521
675 Ga0495630_0051706
676 Ga0495632_0050593
677 Ga0495643_0061691
678 Ga0495644_0042139
679 Ga0495648_0074874
680 Ga0495665_0016517
681 Ga0495640_0017387
682 Ga0495645_0088934
683 Ga0495625_0124350
684 Ga0495661_0019835
685 Ga0495588_0055737
686 Ga0495588_0080550
687 Ga0495599_0055384
688 Ga0495624_0065711
689 Ga0495581_0020687
690 Ga0495672_0000153
691 Ga0495673_0023779
692 Ga0495684_0010100
693 Ga0495686_0049612
694 Ga0496102_0234296
695 Ga0496103_0036389
696 Ga0496104_0007905
697 Ga0496105_0233249
698 Ga0496106_0141901
699 Ga0496108_0043667
700 Ga0496108_0089358
701 Ga0496109_0011738
702 Ga0496110_0127779
703 Ga0496112_0236650
704 Ga0496115_0033706
705 Ga0496115_0098752
706 Ga0496115_0189382
707 Ga0496116_0002393
708 Ga0496116_0016305
709 Ga0496116_0016496
710 Ga0496116_0020008
711 Ga0496116_0035626
712 Ga0496117_0045577
713 Ga0496117_0057053
714 Ga0496118_0011416
715 Ga0496118_0023940
716 Ga0496118_0051532
717 Ga0496118_0111024
718 Ga0496119_0018836
719 Ga0496119_0095173
720 Ga0496120_0042401
721 Ga0496120_0046208
722 Ga0496121_0000094
723 Ga0496121_0000214
724 Ga0496121_0002554
725 Ga0496121_0008280
726 Ga0496121_0016222
727 Ga0496121_0031776
728 Ga0496121_0042304
729 Ga0496121_0066096
730 Ga0496121_0069934
731 Ga0496122_0000077
732 Ga0496122_0015290
733 Ga0496122_0034894
734 Ga0496123_0000526
735 Ga0496123_0016472
736 Ga0496123_0025210
737 Ga0496123_0106139
738 Ga0496124_0070795
739 Ga0496124_0077903
740 Ga0496124_0083494
741 Ga0496125_0000259
742 Ga0496125_0000904
743 Ga0496125_0026703
744 Ga0496125_0077064
745 Ga0496126_0004022
746 Ga0496126_0005193
747 Ga0496126_0012423
748 Ga0496126_0017791
749 Ga0496126_0060551
750 Ga0496126_0151024
751 Ga0501070_0055735
752 Ga0501073_0071669
753 Ga0501074_0102014
754 nmdc:mga03n38_25837_c1
755 nmdc:mga00v17_16554_c1
756 nmdc:mga0yw44_57322_c1
757 nmdc:mga0yw44_80968_c1
758 nmdc:mga0yw44_8327_c1
759 nmdc:mga0k408_76410_c1
760 nmdc:mga06z11_58983_c1
761 nmdc:mga04h51_21991_c1
762 nmdc:mga07m45_1913_c3
763 nmdc:mga07m45_78149_c1
764 nmdc:mga0n895_42638_c1
765 nmdc:mga0rr50_46539_c1
766 nmdc:mga0sz30_70694_c1
767 Ga0495601_0142383
768 Ga0495612_0016968
769 Ga0500635_0000728
770 Ga0500635_0002189
771 Ga0500581_026256
772 Ga0500651_0048062
773 Ga0500651_0120092
774 Ga0500566_0000017
775 Ga0500566_0018903
776 Ga0500640_000030
777 Ga0500556_0000051
778 Ga0500557_000001
779 Ga0500562_007506
780 Ga0500569_020920
781 Ga0500572_000051
782 Ga0500572_000209
783 Ga0500592_001249
784 Ga0500595_002354
785 Ga0500608_027410
786 Ga0500614_000403
787 Ga0500642_0000077
788 Ga0500642_0000218
789 Ga0500652_007408
790 Ga0500559_0000217
791 Ga0500559_0000419
792 Ga0500559_0000767
793 Ga0500568_0002115
794 Ga0500586_025794
795 Ga0500590_032261
796 Ga0500603_000079
797 Ga0500603_000265
798 Ga0500604_0002537
799 Ga0500616_0000150
800 Ga0500622_0000277
801 Ga0500622_0002661
802 Ga0500630_000137
803 Ga0500639_000015
804 Ga0500636_0025308
805 Ga0500637_0005671
806 Ga0500637_0029224
807 Ga0500637_0094955
808 Ga0500570_080169
809 Ga0500625_000230
810 Ga0500645_008399
811 Ga0500596_000046
812 Ga0500596_000203
813 Ga0500601_001042
814 Ga0500601_002202
815 2935680058
816 2509078329
817 2509149122
818 2513628298
819 2513641917
820 2513646280
821 2513657587
822 2513671892
823 2513700304
824 2513861637
825 2513894401
826 2513916840
827 2517103639
828 2524533085
829 2528855525
830 2603862321
831 2643982535
832 2793060375
833 2793070268
834 2809034645
835 2824602227
836 2824610215
837 2824623570
838 2824630932
839 2824640044
840 2824647808
841 2824656198
842 2824666959
843 2824710058
844 2824717663
845 2824727830
846 2824758139
847 2824766605
848 2824773914
849 2841962360
850 2842337328
851 2844318133
852 2847934942
853 2847945523
854 2849080288
855 2857525792
856 2874636531
857 2876762550
858 2879086333
859 2879109445
860 2881366339
861 2881672966
862 2888382942
863 2888423407
864 2893067917
865 2897809845
866 2904707491
867 2904716778
868 2906649848
869 2908746444
870 2919074346
871 2922367804
872 2922373144
873 2922392292
874 2922426593
875 2929615794
876 2929630407
877 2932792055
878 2932814078
879 2932819434
880 2932833857
881 2933578920
882 2935618613
883 2935644544
884 2935673565
885 2935678452
886 2935688119
887 2935693863
888 2935700697
889 2935715138
890 2935721985
891 2935726297
892 2935731370
893 2935733957
894 2935741070
895 2935743336
896 2935750446
897 2935754626
898 2935759701
899 2935765405
900 2935776325
901 2935790314
902 2935798897
903 2935805356
904 2935816654
905 2935833707
906 2935839607
907 2935856978
908 2935871194
909 2935876303
910 2935997734
911 2936007246
912 2936043084
913 2940559997
914 2940565606
915 2941484432
916 2941540296
917 3005507834
918 3005721369
919 8006937246
920 8006977257
921 8016514576
922 8016591400
923 8016592308
924 8017061854
925 8019571483
926 8019589011
927 8019602223
928 8019616339
929 8019657137
930 8055747441
931 8056694171
932 8056972485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

264

459

0.89

PF07690

MFS_1

Major Facilitator Superfamily

51

336

0.86

PF12832

MFS_1_like

MFS_1 like family

50

421

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.844 10 398
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.8338 10 398
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8227 10 398
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8205 6 399
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.819 6 395
ID Description Score Start End Superfamily
af_P9WJX1_217_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9908 219 404 1.20.1250.20
af_P9WJX1_16_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9876 15 192 1.20.1250.20
af_P9WJX1_16_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9767 15 192 1.20.1250.20
af_P9WJX1_217_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.965 219 404 1.20.1250.20
af_Q5NC32_214_410_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8948 9 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0S9CJH1-F1-model_v4 MFS transporter 0.9847 8 403 GO:0016020
GO:0022857
AF-A0A127F5R8-F1-model_v4 Major facilitator superfamily transporter 0.9783 1 404 GO:0016020
GO:0022857
AF-A0A098LFD5-F1-model_v4 Major facilitator transporter 0.9777 9 401 GO:0016020
GO:0016747
GO:0022857
AF-H0T719-F1-model_v4 Major Facilitator Superfamily (MFS) transporter 0.9772 1 411 GO:0016020
GO:0022857
AF-A0A2N7X8N4-F1-model_v4 MFS transporter 0.977 9 400 GO:0016020
GO:0022857

Map