F449795

General Info

Members Datasets Scaffolds Average Seq Length
467 255 934 121

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100381470|Ga0070680_1003814702
Length 127
Sequence VSAATVTTALVWVGVVLIGGVGSVLRFVIDRTVARRVSRPFPFGTLAVNISGAALLGFLGGLALNKEVALLAGTAFVGAYTTFSTWMLETQRLGEERQLRAGFANIVVSITLGVAAAFIGQRIAELI

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
249 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
252 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
253 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
254 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
255 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0.21
Rhizoplane 12.21
Rhizosphere 74.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100381470 3300005336 Bacteria 1200
2 JGI24743J22301_10027103 3300001991 Bacteria 1117
3 Ga0070658_10858120 3300005327 Bacteria 789
4 Ga0070676_10033267 3300005328 Bacteria 2958
5 Ga0070683_101175577 3300005329 Bacteria 737
6 Ga0070690_100470793 3300005330 Bacteria 935
7 Ga0068869_100009416 3300005334 Bacteria 6338
8 Ga0068869_100020065 3300005334 Bacteria 4577
9 Ga0070666_10049377 3300005335 Bacteria 2828
10 Ga0070682_100077054 3300005337 Bacteria 2148
11 Ga0070682_100136037 3300005337 Bacteria 1669
12 Ga0070682_100256811 3300005337 Bacteria 1263
13 Ga0070682_100825472 3300005337 Bacteria 755
14 Ga0068868_100053639 3300005338 Bacteria 3176
15 Ga0068868_100296010 3300005338 Bacteria 1373
16 Ga0068868_100607933 3300005338 Bacteria 969
17 Ga0070660_100435607 3300005339 Bacteria 1086
18 Ga0070660_100940048 3300005339 Bacteria 730
19 Ga0070660_101672608 3300005339 Bacteria 542
20 Ga0070689_100097870 3300005340 Bacteria 2320
21 Ga0070691_10260409 3300005341 Bacteria 933
22 Ga0070687_100234556 3300005343 Bacteria 1131
23 Ga0070661_100345554 3300005344 Bacteria 1166
24 Ga0070692_10143410 3300005345 Bacteria 1354
25 Ga0070668_100016763 3300005347 Bacteria 5477
26 Ga0070668_100023563 3300005347 Bacteria 4657
27 Ga0070668_101522697 3300005347 Bacteria 612
28 Ga0070668_101782510 3300005347 Bacteria 566
29 Ga0070669_100079785 3300005353 Bacteria 2434
30 Ga0070669_101260291 3300005353 Bacteria 640
31 Ga0070671_100058096 3300005355 Bacteria 3220
32 Ga0070671_100106765 3300005355 Bacteria 2351
33 Ga0070671_100533899 3300005355 Bacteria 1011
34 Ga0070674_100008547 3300005356 Bacteria 6104
35 Ga0070674_100084417 3300005356 Bacteria 2277
36 Ga0070673_100316212 3300005364 Bacteria 1378
37 Ga0070659_100325836 3300005366 Bacteria 1285
38 Ga0070667_100000575 3300005367 Bacteria 36222
39 Ga0070667_100017058 3300005367 Bacteria 6013
40 Ga0070703_10077228 3300005406 Bacteria 1126
41 Ga0070709_10076185 3300005434 Bacteria 2178
42 Ga0070714_100109337 3300005435 Bacteria 2445
43 Ga0070714_100397548 3300005435 Bacteria 1302
44 Ga0070714_100782799 3300005435 Bacteria 923
45 Ga0070710_10000006 3300005437 Bacteria 217422
46 Ga0070710_10019276 3300005437 Bacteria 3522
47 Ga0070701_10003068 3300005438 Bacteria 6547
48 Ga0070701_10804982 3300005438 Bacteria 641
49 Ga0070711_100013993 3300005439 Bacteria 5047
50 Ga0070705_100016007 3300005440 Bacteria 3887
51 Ga0070700_100009961 3300005441 Bacteria 5231
52 Ga0070700_100081420 3300005441 Bacteria 2091
53 Ga0070694_100014253 3300005444 Bacteria 4975
54 Ga0070663_100022386 3300005455 Bacteria 4225
55 Ga0070663_100540327 3300005455 Bacteria 973
56 Ga0070678_100018013 3300005456 Bacteria 4566
57 Ga0070662_100007272 3300005457 Bacteria 7174
58 Ga0068867_100020053 3300005459 Bacteria 4764
59 Ga0070685_10045947 3300005466 Bacteria 2506
60 Ga0070685_10548388 3300005466 Bacteria 825
61 Ga0070684_100105969 3300005535 Bacteria 2516
62 Ga0068853_100013403 3300005539 Bacteria 6692
63 Ga0070672_100090621 3300005543 Bacteria 2466
64 Ga0070695_100087957 3300005545 Bacteria 2068
65 Ga0070696_100008478 3300005546 Bacteria 6880
66 Ga0070693_100007808 3300005547 Bacteria 5247
67 Ga0070665_100013490 3300005548 Bacteria 8222
68 Ga0070665_100022862 3300005548 Bacteria 6294
69 Ga0070665_100232284 3300005548 Bacteria 1844
70 Ga0070665_100954876 3300005548 Bacteria 870
71 Ga0070704_100010033 3300005549 Bacteria 5753
72 Ga0070704_100077254 3300005549 Bacteria 2438
73 Ga0068855_100246237 3300005563 Bacteria 1995
74 Ga0068855_100719529 3300005563 Bacteria 1067
75 Ga0068854_100014496 3300005578 Bacteria 5197
76 Ga0068854_100101811 3300005578 Bacteria 2154
77 Ga0068856_100232684 3300005614 Bacteria 1858
78 Ga0068856_101331389 3300005614 Bacteria 733
79 Ga0070702_100008967 3300005615 Bacteria 4871
80 Ga0070702_100144013 3300005615 Bacteria 1521
81 Ga0068852_100142630 3300005616 Bacteria 2219
82 Ga0068852_101382447 3300005616 Bacteria 726
83 Ga0068852_101386141 3300005616 Bacteria 725
84 Ga0068859_100056548 3300005617 Bacteria 3949
85 Ga0068859_100714256 3300005617 Bacteria 1092
86 Ga0068859_102619478 3300005617 Bacteria 555
87 Ga0068864_100166701 3300005618 Bacteria 2006
88 Ga0068864_100206973 3300005618 Bacteria 1805
89 Ga0068864_100222939 3300005618 Bacteria 1740
90 Ga0068866_10002254 3300005718 Bacteria 7997
91 Ga0068861_100015153 3300005719 Bacteria 5426
92 Ga0068861_100113456 3300005719 Bacteria 2174
93 Ga0068863_100236845 3300005841 Bacteria 1762
94 Ga0068863_100908690 3300005841 Bacteria 881
95 Ga0068858_100022398 3300005842 Bacteria 5897
96 Ga0068858_100038340 3300005842 Bacteria 4445
97 Ga0068858_100350196 3300005842 Bacteria 1415
98 Ga0068858_100367182 3300005842 Bacteria 1380
99 Ga0068860_100002358 3300005843 Bacteria 19846
100 Ga0068860_100243511 3300005843 Bacteria 1749
101 Ga0068860_101220194 3300005843 Bacteria 772
102 Ga0068862_100101274 3300005844 Bacteria 2520
103 Ga0081455_10062573 3300005937 Bacteria 3127
104 Ga0081455_10267740 3300005937 Bacteria 1241
105 Ga0070717_10916049 3300006028 Bacteria 798
106 Ga0075365_10178525 3300006038 Bacteria 1484
107 Ga0075363_100007442 3300006048 Bacteria 5034
108 Ga0075363_100025630 3300006048 Bacteria 3009
109 Ga0075363_100043050 3300006048 Bacteria 2387
110 Ga0075364_10078752 3300006051 Bacteria 2177
111 Ga0075364_10105630 3300006051 Bacteria 1876
112 Ga0075364_10311027 3300006051 Bacteria 1073
113 Ga0070715_10024734 3300006163 Bacteria 2370
114 Ga0070715_10764253 3300006163 Bacteria 583
115 Ga0070712_100012405 3300006175 Bacteria 5416
116 Ga0075362_10130245 3300006177 Bacteria 1196
117 Ga0075369_10021031 3300006186 Bacteria 2677
118 Ga0075369_10237860 3300006186 Bacteria 844
119 Ga0075369_10249964 3300006186 Bacteria 823
120 Ga0075369_10390356 3300006186 Bacteria 655
121 Ga0075366_10578183 3300006195 Bacteria 696
122 Ga0097621_100299974 3300006237 Bacteria 1419
123 Ga0075370_10050140 3300006353 Bacteria 2368
124 Ga0068871_100049118 3300006358 Bacteria 3409
125 Ga0075430_100000964 3300006846 Bacteria 22702
126 Ga0068865_100012553 3300006881 Bacteria 5337
127 Ga0068865_101271006 3300006881 Bacteria 653
128 Ga0075436_100083089 3300006914 Bacteria 2222
129 Ga0097620_100056548 3300006931 Bacteria 3949
130 Ga0097620_100714271 3300006931 Bacteria 1092
131 Ga0097620_102619502 3300006931 Bacteria 555
132 Ga0105250_10370475 3300009092 Bacteria 630
133 Ga0105245_10024085 3300009098 Bacteria 5345
134 Ga0105245_10735790 3300009098 Bacteria 1021
135 Ga0105245_11746045 3300009098 Bacteria 675
136 Ga0105247_10001532 3300009101 Bacteria 16499
137 Ga0105243_10001339 3300009148 Bacteria 21944
138 Ga0105243_10243443 3300009148 Bacteria 1602
139 Ga0105241_10210002 3300009174 Bacteria 1631
140 Ga0105242_10001137 3300009176 Bacteria 20962
141 Ga0105248_10031352 3300009177 Bacteria 5942
142 Ga0105248_10202401 3300009177 Bacteria 2237
143 Ga0105237_10003521 3300009545 Bacteria 18559
144 Ga0105237_10130961 3300009545 Bacteria 2503
145 Ga0105237_10305466 3300009545 Bacteria 1594
146 Ga0105238_10334516 3300009551 Bacteria 1502
147 Ga0105238_10403515 3300009551 Bacteria 1360
148 Ga0105239_10002436 3300010375 Bacteria 23713
149 Ga0105239_10182902 3300010375 Bacteria 2345
150 Ga0105239_11159399 3300010375 Bacteria 890
151 Ga0157374_10108636 3300013296 Bacteria 2666
152 Ga0157378_10020735 3300013297 Bacteria 5781
153 Ga0157378_11070713 3300013297 Bacteria 842
154 Ga0163162_10007394 3300013306 Bacteria 10679
155 Ga0163162_10066606 3300013306 Bacteria 3650
156 Ga0163162_10856903 3300013306 Bacteria 1023
157 Ga0157372_10002210 3300013307 Bacteria 21129
158 Ga0157372_10381786 3300013307 Bacteria 1642
159 Ga0157375_10309208 3300013308 Bacteria 1745
160 Ga0163163_10113994 3300014325 Bacteria 2734
161 Ga0163163_10138458 3300014325 Bacteria 2476
162 Ga0163163_11064702 3300014325 Bacteria 872
163 Ga0163163_12349646 3300014325 Bacteria 592
164 Ga0157380_10000872 3300014326 Bacteria 18978
165 Ga0157380_11868020 3300014326 Bacteria 661
166 Ga0157379_10068539 3300014968 Bacteria 3171
167 Ga0163161_10040330 3300017792 Bacteria 3353
168 Ga0163161_10078644 3300017792 Bacteria 2424
169 Ga0163161_10116169 3300017792 Bacteria 2006
170 Ga0213876_10002160 3300021384 Bacteria 11623
171 Ga0213876_10029767 3300021384 Bacteria 2877
172 Ga0213875_10014627 3300021388 Bacteria 3827
173 Ga0213875_10183906 3300021388 Bacteria 982
174 Ga0209051_1000011 3300025303 Bacteria 610828
175 Ga0207692_10000001 3300025898 Bacteria 558345
176 Ga0207692_10006171 3300025898 Bacteria 4853
177 Ga0207642_10063431 3300025899 Bacteria 1728
178 Ga0207710_10006688 3300025900 Bacteria 4912
179 Ga0207710_10180275 3300025900 Bacteria 1036
180 Ga0207688_10002449 3300025901 Bacteria 9984
181 Ga0207688_10011076 3300025901 Bacteria 4907
182 Ga0207680_10168104 3300025903 Bacteria 1475
183 Ga0207647_10450372 3300025904 Bacteria 721
184 Ga0207685_10065838 3300025905 Bacteria 1452
185 Ga0207699_10037765 3300025906 Bacteria 2763
186 Ga0207645_10065175 3300025907 Bacteria 2328
187 Ga0207654_10046715 3300025911 Bacteria 2470
188 Ga0207671_10003916 3300025914 Bacteria 14515
189 Ga0207671_10070012 3300025914 Bacteria 2614
190 Ga0207671_10092672 3300025914 Bacteria 2278
191 Ga0207693_10001549 3300025915 Bacteria 20293
192 Ga0207663_10146908 3300025916 Bacteria 1649
193 Ga0207662_10027386 3300025918 Bacteria 3289
194 Ga0207657_10160163 3300025919 Bacteria 1828
195 Ga0207657_10166933 3300025919 Bacteria 1785
196 Ga0207649_10162306 3300025920 Bacteria 1549
197 Ga0207681_10186617 3300025923 Bacteria 1583
198 Ga0207694_10495250 3300025924 Bacteria 1023
199 Ga0207659_11188640 3300025926 Bacteria 656
200 Ga0207687_10049507 3300025927 Bacteria 2922
201 Ga0207687_10556773 3300025927 Bacteria 963
202 Ga0207664_10720414 3300025929 Bacteria 897
203 Ga0207644_10094984 3300025931 Bacteria 2229
204 Ga0207644_10369891 3300025931 Bacteria 1167
205 Ga0207690_10047730 3300025932 Bacteria 2843
206 Ga0207690_10072433 3300025932 Bacteria 2379
207 Ga0207706_10011686 3300025933 Bacteria 8006
208 Ga0207686_10011133 3300025934 Bacteria 4917
209 Ga0207709_10214847 3300025935 Bacteria 1383
210 Ga0207709_10567450 3300025935 Bacteria 895
211 Ga0207670_10110960 3300025936 Bacteria 1976
212 Ga0207669_10006074 3300025937 Bacteria 5481
213 Ga0207704_10049898 3300025938 Bacteria 2521
214 Ga0207665_10029016 3300025939 Bacteria 3658
215 Ga0207691_10078655 3300025940 Bacteria 2968
216 Ga0207691_10153743 3300025940 Bacteria 2022
217 Ga0207689_10081304 3300025942 Bacteria 2663
218 Ga0207689_10529024 3300025942 Bacteria 989
219 Ga0207661_10900783 3300025944 Bacteria 815
220 Ga0207667_10264810 3300025949 Bacteria 1758
221 Ga0207667_10319156 3300025949 Bacteria 1587
222 Ga0207712_10029176 3300025961 Bacteria 3698
223 Ga0207668_10010485 3300025972 Bacteria 5600
224 Ga0207668_10083815 3300025972 Bacteria 2321
225 Ga0207668_10264062 3300025972 Bacteria 1404
226 Ga0207640_10088097 3300025981 Bacteria 2142
227 Ga0207640_10439457 3300025981 Bacteria 1072
228 Ga0207658_10000502 3300025986 Bacteria 35835
229 Ga0207658_10005441 3300025986 Bacteria 8731
230 Ga0207658_10022924 3300025986 Bacteria 4351
231 Ga0207658_10880503 3300025986 Bacteria 815
232 Ga0207677_10563127 3300026023 Bacteria 995
233 Ga0207703_10033427 3300026035 Bacteria 4077
234 Ga0207703_10501669 3300026035 Bacteria 1139
235 Ga0207639_10035174 3300026041 Bacteria 3706
236 Ga0207639_10092211 3300026041 Bacteria 2427
237 Ga0207639_10401443 3300026041 Bacteria 1235
238 Ga0207678_10014268 3300026067 Bacteria 6986
239 Ga0207678_10025578 3300026067 Bacteria 5152
240 Ga0207678_10724158 3300026067 Bacteria 876
241 Ga0207708_10002852 3300026075 Bacteria 12716
242 Ga0207708_10025987 3300026075 Bacteria 4429
243 Ga0207702_10183454 3300026078 Bacteria 1929
244 Ga0207702_10295142 3300026078 Bacteria 1537
245 Ga0207702_10369359 3300026078 Bacteria 1377
246 Ga0207641_10050338 3300026088 Bacteria 3524
247 Ga0207641_11338147 3300026088 Bacteria 717
248 Ga0207648_10007000 3300026089 Bacteria 11150
249 Ga0207648_10045017 3300026089 Bacteria 3872
250 Ga0207676_10277931 3300026095 Bacteria 1519
251 Ga0207676_10588823 3300026095 Bacteria 1067
252 Ga0207675_100027425 3300026118 Bacteria 5305
253 Ga0207675_100030175 3300026118 Bacteria 5050
254 Ga0207683_10023585 3300026121 Bacteria 5293
255 Ga0207698_10623556 3300026142 Bacteria 1065
256 Ga0268266_10018695 3300028379 Bacteria 5904
257 Ga0268266_10035140 3300028379 Bacteria 4263
258 Ga0268266_10041000 3300028379 Bacteria 3948
259 Ga0268266_11186567 3300028379 Bacteria 738
260 Ga0268264_10015366 3300028381 Bacteria 6278
261 Ga0265327_10004178 3300031251 Bacteria 13020
262 Ga0265327_10116176 3300031251 Bacteria 1273
263 Ga0307405_10445095 3300031731 Bacteria 1026
264 Ga0307406_10157530 3300031901 Bacteria 1628
265 Ga0307406_10644599 3300031901 Bacteria 878
266 Ga0307409_102083321 3300031995 Bacteria 597
267 Ga0373928_0086032 3300035084 Bacteria 800
268 Ga0373949_0065654 3300035090 Bacteria 942
269 Ga0373939_0140991 3300035114 Bacteria 869
270 Ga0373943_0253535 3300035170 Bacteria 989
271 Ga0373946_0015962 3300035171 Bacteria 2856
272 Ga0373931_0193947 3300035691 Bacteria 1210
273 Ga0436364_0288923 3300037853 Bacteria 7333
274 Ga0436364_1154307 3300037853 Bacteria 1045
275 Ga0395901_2084143 3300038443 Bacteria 512
276 Ga0436365_0178124 3300039437 Bacteria 860
277 Ga0436365_0307061 3300039437 Bacteria 6040
278 Ga0436365_1376337 3300039437 Bacteria 20253
279 Ga0436365_1909980 3300039437 Bacteria 15850
280 Ga0436360_1064439 3300039438 Bacteria 601
281 Ga0436361_0753093 3300039447 Bacteria 965
282 Ga0439461_0010152 3300041410 Bacteria 1723
283 Ga0439466_0007603 3300041411 Bacteria 4093
284 Ga0439465_0365165 3300041413 Bacteria 546
285 Ga0451802_1256245 3300041460 Bacteria 991
286 Ga0451853_2731377 3300041512 Bacteria 1372
287 Ga0439431_0007653 3300041997 Bacteria 2412
288 Ga0439434_0131017 3300042435 Bacteria 822
289 Ga0439459_0026672 3300042438 Bacteria 1149
290 Ga0466972_0092997 3300044658 Bacteria 1429
291 Ga0466965_0012931 3300044683 Bacteria 3931
292 Ga0466965_0014166 3300044683 Bacteria 3773
293 Ga0466965_0034794 3300044683 Bacteria 2466
294 Ga0466966_0011171 3300044684 Bacteria 5956
295 Ga0466966_0039190 3300044684 Bacteria 3052
296 Ga0466966_0068359 3300044684 Bacteria 2230
297 Ga0466966_0927083 3300044684 Bacteria 525
298 Ga0466961_0018993 3300044693 Bacteria 4422
299 Ga0466961_0565349 3300044693 Bacteria 684
300 Ga0466963_0157420 3300044694 Bacteria 1580
301 Ga0466963_0199855 3300044694 Bacteria 1398
302 Ga0466963_0212472 3300044694 Bacteria 1354
303 Ga0466964_0293504 3300044706 Bacteria 817
304 Ga0466964_0525551 3300044706 Bacteria 639
305 Ga0466964_0674467 3300044706 Bacteria 574
306 Ga0466971_0039549 3300044719 Bacteria 2116
307 Ga0466971_0100659 3300044719 Bacteria 1328
308 Ga0466968_0003968 3300044735 Bacteria 5494
309 Ga0466968_0092057 3300044735 Bacteria 1345
310 Ga0466968_0124083 3300044735 Bacteria 1170
311 Ga0466970_0020656 3300044765 Bacteria 3423
312 Ga0466957_0006220 3300044842 Bacteria 6739
313 Ga0466957_0006518 3300044842 Bacteria 6592
314 Ga0466957_0020545 3300044842 Bacteria 3886
315 Ga0466957_0132479 3300044842 Bacteria 1598
316 Ga0466960_0000760 3300044901 Bacteria 11347
317 Ga0466960_0010837 3300044901 Bacteria 3795
318 Ga0466960_0020341 3300044901 Bacteria 2939
319 Ga0466960_0094756 3300044901 Bacteria 1527
320 Ga0466959_0003950 3300045049 Bacteria 9850
321 Ga0466959_0011761 3300045049 Bacteria 6300
322 Ga0466959_0027140 3300045049 Bacteria 4247
323 Ga0466959_0399854 3300045049 Bacteria 934
324 Ga0466958_0037989 3300045836 Bacteria 2887
325 Ga0466958_0242184 3300045836 Bacteria 1152
326 Ga0466958_0253826 3300045836 Bacteria 1125
327 Ga0466958_0474409 3300045836 Bacteria 811
328 Ga0466967_0029748 3300045976 Bacteria 4576
329 Ga0466967_0052607 3300045976 Bacteria 3575
330 Ga0466967_0119962 3300045976 Bacteria 2428
331 Ga0466967_1045381 3300045976 Bacteria 813
332 Ga0495603_0129947 3300046455 Bacteria 1467
333 Ga0495594_0266232 3300046499 Bacteria 976
334 Ga0495583_0118648 3300046506 Bacteria 1115
335 Ga0495648_0031589 3300046524 Bacteria 3484
336 Ga0495654_0149874 3300046530 Bacteria 1032
337 Ga0495668_0053941 3300046616 Bacteria 2222
338 Ga0495611_0138319 3300046648 Bacteria 1137
339 Ga0495624_0212034 3300046690 Bacteria 1175
340 Ga0495649_0258037 3300046694 Bacteria 894
341 Ga0495673_0000444 3300047469 Bacteria 45563
342 Ga0496100_0000327 3300048903 Bacteria 23421
343 Ga0496100_0358049 3300048903 Bacteria 1103
344 Ga0496100_0982142 3300048903 Bacteria 664
345 Ga0496101_0000549 3300048904 Bacteria 22984
346 Ga0496102_0016753 3300048905 Bacteria 6408
347 Ga0496102_0028569 3300048905 Bacteria 4982
348 Ga0496102_0029642 3300048905 Bacteria 4897
349 Ga0496102_0068195 3300048905 Bacteria 3264
350 Ga0496102_0171237 3300048905 Bacteria 2044
351 Ga0496102_0208489 3300048905 Bacteria 1842
352 Ga0496102_0266732 3300048905 Bacteria 1614
353 Ga0496102_0405671 3300048905 Bacteria 1281
354 Ga0496103_0000946 3300048906 Bacteria 20800
355 Ga0496103_0027965 3300048906 Bacteria 3420
356 Ga0496103_0129328 3300048906 Bacteria 1612
357 Ga0496103_0244493 3300048906 Bacteria 1154
358 Ga0496104_0036803 3300048907 Bacteria 4576
359 Ga0496104_0046516 3300048907 Bacteria 4087
360 Ga0496104_0823323 3300048907 Bacteria 834
361 Ga0496104_0826806 3300048907 Bacteria 832
362 Ga0496106_0002484 3300048909 Bacteria 13747
363 Ga0496106_0015537 3300048909 Bacteria 5631
364 Ga0496106_0510148 3300048909 Bacteria 966
365 Ga0496106_1220193 3300048909 Bacteria 586
366 Ga0496107_0000464 3300048910 Bacteria 22198
367 Ga0496107_0019519 3300048910 Bacteria 4782
368 Ga0496108_0004778 3300048911 Bacteria 10925
369 Ga0496108_0008786 3300048911 Bacteria 8191
370 Ga0496108_0076787 3300048911 Bacteria 2824
371 Ga0496108_0076965 3300048911 Bacteria 2821
372 Ga0496108_0272923 3300048911 Bacteria 1472
373 Ga0496108_0450754 3300048911 Bacteria 1124
374 Ga0496109_0000706 3300048912 Bacteria 27759
375 Ga0496109_0007281 3300048912 Bacteria 9354
376 Ga0496109_0073093 3300048912 Bacteria 3151
377 Ga0496109_0096999 3300048912 Bacteria 2732
378 Ga0496109_0412045 3300048912 Bacteria 1277
379 Ga0496110_0001610 3300048913 Bacteria 16525
380 Ga0496110_0107539 3300048913 Bacteria 2504
381 Ga0496110_0294816 3300048913 Bacteria 1477
382 Ga0496110_0805374 3300048913 Bacteria 844
383 Ga0496111_0007247 3300048914 Bacteria 7256
384 Ga0496111_0397558 3300048914 Bacteria 1018
385 Ga0496111_1044832 3300048914 Bacteria 584
386 Ga0496112_0307867 3300048915 Bacteria 1529
387 Ga0496112_0509662 3300048915 Bacteria 1138
388 Ga0496113_0143190 3300048916 Bacteria 1882
389 Ga0496113_0255197 3300048916 Bacteria 1400
390 Ga0496114_0000774 3300048917 Bacteria 23896
391 Ga0496114_0098795 3300048917 Bacteria 2489
392 Ga0496114_0108019 3300048917 Bacteria 2382
393 Ga0496114_0888857 3300048917 Bacteria 772
394 Ga0496114_1038437 3300048917 Bacteria 703
395 Ga0496114_1104748 3300048917 Bacteria 678
396 Ga0496115_0007319 3300048918 Bacteria 8118
397 Ga0496115_0352603 3300048918 Bacteria 1200
398 Ga0496116_0003582 3300048919 Bacteria 15273
399 Ga0496117_0016974 3300048920 Bacteria 6099
400 Ga0496117_0061525 3300048920 Bacteria 2580
401 Ga0496118_0000595 3300048921 Bacteria 59802
402 Ga0496118_0017436 3300048921 Bacteria 6536
403 Ga0496118_0351824 3300048921 Bacteria 785
404 Ga0496119_0003009 3300048922 Bacteria 17854
405 Ga0496120_0045432 3300048923 Bacteria 2544
406 Ga0496121_0000016 3300048924 Bacteria 562911
407 Ga0496122_0002739 3300048925 Bacteria 24368
408 Ga0496124_0000015 3300048927 Bacteria 460700
409 Ga0496125_0000021 3300048928 Bacteria 460688
410 Ga0496126_0000015 3300048929 Bacteria 663212
411 Ga0496126_0001911 3300048929 Bacteria 29891
412 Ga0501031_0203889 3300049568 Bacteria 1290
413 Ga0501031_0659521 3300049568 Bacteria 672
414 Ga0501032_0037168 3300049569 Bacteria 3321
415 Ga0501032_0175602 3300049569 Bacteria 1403
416 Ga0501032_0387522 3300049569 Bacteria 898
417 Ga0501033_0017450 3300049570 Bacteria 5423
418 Ga0501033_0116714 3300049570 Bacteria 1939
419 Ga0501034_0007092 3300049571 Bacteria 11955
420 Ga0501034_0087568 3300049571 Bacteria 3114
421 Ga0501036_0145140 3300049572 Bacteria 2002
422 Ga0501037_0044362 3300049573 Bacteria 3265
423 Ga0501043_0038751 3300049579 Bacteria 3748
424 Ga0501043_0064253 3300049579 Bacteria 2882
425 Ga0501046_0002772 3300049580 Bacteria 16302
426 Ga0501046_0313473 3300049580 Bacteria 1144
427 Ga0501047_0002519 3300049581 Bacteria 17469
428 Ga0501047_0739395 3300049581 Bacteria 800
429 Ga0501048_0017886 3300049582 Bacteria 5215
430 Ga0501048_0663669 3300049582 Bacteria 749
431 Ga0501069_0020640 3300049585 Bacteria 3570
432 Ga0501070_0000997 3300049586 Bacteria 25451
433 Ga0501070_0184988 3300049586 Bacteria 1714
434 Ga0501071_0384348 3300049587 Bacteria 1071
435 Ga0501080_0075773 3300049742 Bacteria 3129
436 Ga0501083_0452767 3300049744 Bacteria 835
437 Ga0501035_0001107 3300049822 Bacteria 28241
438 Ga0501035_0003647 3300049822 Bacteria 14685
439 Ga0501035_0189832 3300049822 Bacteria 1767
440 Ga0501044_0002461 3300049823 Bacteria 21119
441 Ga0501044_0007204 3300049823 Bacteria 12234
442 nmdc:mga03683_198595_c1 3300050489 Bacteria 920
443 nmdc:mga03n38_104369_c1 3300050490 Bacteria 1371
444 nmdc:mga03n38_384195_c1 3300050490 Bacteria 770
445 nmdc:mga03n38_54731_c1 3300050490 Bacteria 1795
446 nmdc:mga03n38_918066_c1 3300050490 Bacteria 515
447 nmdc:mga00v17_3047_c1 3300050491 Bacteria 8615
448 nmdc:mga00v17_52858_c1 3300050491 Bacteria 2474
449 nmdc:mga00v17_53524_c1 3300050491 Bacteria 2460
450 nmdc:mga0yw44_289735_c1 3300050492 Bacteria 1095
451 nmdc:mga0qj67_3373_c1 3300050509 Bacteria 11523
452 nmdc:mga08x19_44563_c2 3300050514 Bacteria 1545
453 nmdc:mga0sz30_180086_c1 3300050516 Bacteria 938
454 nmdc:mga0sz30_25009_c1 3300050516 Bacteria 2441
455 nmdc:mga0sz30_262411_c1 3300050516 Bacteria 769
456 nmdc:mga0sz30_71226_c1 3300050516 Bacteria 1497
457 Ga0495655_0070605 3300053083 Bacteria 975
458 Ga0500641_0062484 3300053096 Bacteria 1553
459 Ga0500628_102184 3300053129 Bacteria 760
460 Ga0500564_067843 3300053138 Bacteria 1612
461 Ga0466962_0037035 3300061719 Bacteria 2335
462 Ga0466962_0225257 3300061719 Bacteria 919
463 2644636086 2643221715 Bacteria 6671032
464 2738667033 2738541264 Bacteria 5935393
465 2739145877 2738541356 Bacteria 5935017
466 2842138727 2842134933 Bacteria 5847019
467 2902815610 2902810491 Bacteria 6794147
468 Ga0070680_100381470
469 JGI24743J22301_10027103
470 Ga0070658_10858120
471 Ga0070676_10033267
472 Ga0070683_101175577
473 Ga0070690_100470793
474 Ga0068869_100009416
475 Ga0068869_100020065
476 Ga0070666_10049377
477 Ga0070682_100077054
478 Ga0070682_100136037
479 Ga0070682_100256811
480 Ga0070682_100825472
481 Ga0068868_100053639
482 Ga0068868_100296010
483 Ga0068868_100607933
484 Ga0070660_100435607
485 Ga0070660_100940048
486 Ga0070660_101672608
487 Ga0070689_100097870
488 Ga0070691_10260409
489 Ga0070687_100234556
490 Ga0070661_100345554
491 Ga0070692_10143410
492 Ga0070668_100016763
493 Ga0070668_100023563
494 Ga0070668_101522697
495 Ga0070668_101782510
496 Ga0070669_100079785
497 Ga0070669_101260291
498 Ga0070671_100058096
499 Ga0070671_100106765
500 Ga0070671_100533899
501 Ga0070674_100008547
502 Ga0070674_100084417
503 Ga0070673_100316212
504 Ga0070659_100325836
505 Ga0070667_100000575
506 Ga0070667_100017058
507 Ga0070703_10077228
508 Ga0070709_10076185
509 Ga0070714_100109337
510 Ga0070714_100397548
511 Ga0070714_100782799
512 Ga0070710_10000006
513 Ga0070710_10019276
514 Ga0070701_10003068
515 Ga0070701_10804982
516 Ga0070711_100013993
517 Ga0070705_100016007
518 Ga0070700_100009961
519 Ga0070700_100081420
520 Ga0070694_100014253
521 Ga0070663_100022386
522 Ga0070663_100540327
523 Ga0070678_100018013
524 Ga0070662_100007272
525 Ga0068867_100020053
526 Ga0070685_10045947
527 Ga0070685_10548388
528 Ga0070684_100105969
529 Ga0068853_100013403
530 Ga0070672_100090621
531 Ga0070695_100087957
532 Ga0070696_100008478
533 Ga0070693_100007808
534 Ga0070665_100013490
535 Ga0070665_100022862
536 Ga0070665_100232284
537 Ga0070665_100954876
538 Ga0070704_100010033
539 Ga0070704_100077254
540 Ga0068855_100246237
541 Ga0068855_100719529
542 Ga0068854_100014496
543 Ga0068854_100101811
544 Ga0068856_100232684
545 Ga0068856_101331389
546 Ga0070702_100008967
547 Ga0070702_100144013
548 Ga0068852_100142630
549 Ga0068852_101382447
550 Ga0068852_101386141
551 Ga0068859_100056548
552 Ga0068859_100714256
553 Ga0068859_102619478
554 Ga0068864_100166701
555 Ga0068864_100206973
556 Ga0068864_100222939
557 Ga0068866_10002254
558 Ga0068861_100015153
559 Ga0068861_100113456
560 Ga0068863_100236845
561 Ga0068863_100908690
562 Ga0068858_100022398
563 Ga0068858_100038340
564 Ga0068858_100350196
565 Ga0068858_100367182
566 Ga0068860_100002358
567 Ga0068860_100243511
568 Ga0068860_101220194
569 Ga0068862_100101274
570 Ga0081455_10062573
571 Ga0081455_10267740
572 Ga0070717_10916049
573 Ga0075365_10178525
574 Ga0075363_100007442
575 Ga0075363_100025630
576 Ga0075363_100043050
577 Ga0075364_10078752
578 Ga0075364_10105630
579 Ga0075364_10311027
580 Ga0070715_10024734
581 Ga0070715_10764253
582 Ga0070712_100012405
583 Ga0075362_10130245
584 Ga0075369_10021031
585 Ga0075369_10237860
586 Ga0075369_10249964
587 Ga0075369_10390356
588 Ga0075366_10578183
589 Ga0097621_100299974
590 Ga0075370_10050140
591 Ga0068871_100049118
592 Ga0075430_100000964
593 Ga0068865_100012553
594 Ga0068865_101271006
595 Ga0075436_100083089
596 Ga0097620_100056548
597 Ga0097620_100714271
598 Ga0097620_102619502
599 Ga0105250_10370475
600 Ga0105245_10024085
601 Ga0105245_10735790
602 Ga0105245_11746045
603 Ga0105247_10001532
604 Ga0105243_10001339
605 Ga0105243_10243443
606 Ga0105241_10210002
607 Ga0105242_10001137
608 Ga0105248_10031352
609 Ga0105248_10202401
610 Ga0105237_10003521
611 Ga0105237_10130961
612 Ga0105237_10305466
613 Ga0105238_10334516
614 Ga0105238_10403515
615 Ga0105239_10002436
616 Ga0105239_10182902
617 Ga0105239_11159399
618 Ga0157374_10108636
619 Ga0157378_10020735
620 Ga0157378_11070713
621 Ga0163162_10007394
622 Ga0163162_10066606
623 Ga0163162_10856903
624 Ga0157372_10002210
625 Ga0157372_10381786
626 Ga0157375_10309208
627 Ga0163163_10113994
628 Ga0163163_10138458
629 Ga0163163_11064702
630 Ga0163163_12349646
631 Ga0157380_10000872
632 Ga0157380_11868020
633 Ga0157379_10068539
634 Ga0163161_10040330
635 Ga0163161_10078644
636 Ga0163161_10116169
637 Ga0213876_10002160
638 Ga0213876_10029767
639 Ga0213875_10014627
640 Ga0213875_10183906
641 Ga0209051_1000011
642 Ga0207692_10000001
643 Ga0207692_10006171
644 Ga0207642_10063431
645 Ga0207710_10006688
646 Ga0207710_10180275
647 Ga0207688_10002449
648 Ga0207688_10011076
649 Ga0207680_10168104
650 Ga0207647_10450372
651 Ga0207685_10065838
652 Ga0207699_10037765
653 Ga0207645_10065175
654 Ga0207654_10046715
655 Ga0207671_10003916
656 Ga0207671_10070012
657 Ga0207671_10092672
658 Ga0207693_10001549
659 Ga0207663_10146908
660 Ga0207662_10027386
661 Ga0207657_10160163
662 Ga0207657_10166933
663 Ga0207649_10162306
664 Ga0207681_10186617
665 Ga0207694_10495250
666 Ga0207659_11188640
667 Ga0207687_10049507
668 Ga0207687_10556773
669 Ga0207664_10720414
670 Ga0207644_10094984
671 Ga0207644_10369891
672 Ga0207690_10047730
673 Ga0207690_10072433
674 Ga0207706_10011686
675 Ga0207686_10011133
676 Ga0207709_10214847
677 Ga0207709_10567450
678 Ga0207670_10110960
679 Ga0207669_10006074
680 Ga0207704_10049898
681 Ga0207665_10029016
682 Ga0207691_10078655
683 Ga0207691_10153743
684 Ga0207689_10081304
685 Ga0207689_10529024
686 Ga0207661_10900783
687 Ga0207667_10264810
688 Ga0207667_10319156
689 Ga0207712_10029176
690 Ga0207668_10010485
691 Ga0207668_10083815
692 Ga0207668_10264062
693 Ga0207640_10088097
694 Ga0207640_10439457
695 Ga0207658_10000502
696 Ga0207658_10005441
697 Ga0207658_10022924
698 Ga0207658_10880503
699 Ga0207677_10563127
700 Ga0207703_10033427
701 Ga0207703_10501669
702 Ga0207639_10035174
703 Ga0207639_10092211
704 Ga0207639_10401443
705 Ga0207678_10014268
706 Ga0207678_10025578
707 Ga0207678_10724158
708 Ga0207708_10002852
709 Ga0207708_10025987
710 Ga0207702_10183454
711 Ga0207702_10295142
712 Ga0207702_10369359
713 Ga0207641_10050338
714 Ga0207641_11338147
715 Ga0207648_10007000
716 Ga0207648_10045017
717 Ga0207676_10277931
718 Ga0207676_10588823
719 Ga0207675_100027425
720 Ga0207675_100030175
721 Ga0207683_10023585
722 Ga0207698_10623556
723 Ga0268266_10018695
724 Ga0268266_10035140
725 Ga0268266_10041000
726 Ga0268266_11186567
727 Ga0268264_10015366
728 Ga0265327_10004178
729 Ga0265327_10116176
730 Ga0307405_10445095
731 Ga0307406_10157530
732 Ga0307406_10644599
733 Ga0307409_102083321
734 Ga0373928_0086032
735 Ga0373949_0065654
736 Ga0373939_0140991
737 Ga0373943_0253535
738 Ga0373946_0015962
739 Ga0373931_0193947
740 Ga0436364_0288923
741 Ga0436364_1154307
742 Ga0395901_2084143
743 Ga0436365_0178124
744 Ga0436365_0307061
745 Ga0436365_1376337
746 Ga0436365_1909980
747 Ga0436360_1064439
748 Ga0436361_0753093
749 Ga0439461_0010152
750 Ga0439466_0007603
751 Ga0439465_0365165
752 Ga0451802_1256245
753 Ga0451853_2731377
754 Ga0439431_0007653
755 Ga0439434_0131017
756 Ga0439459_0026672
757 Ga0466972_0092997
758 Ga0466965_0012931
759 Ga0466965_0014166
760 Ga0466965_0034794
761 Ga0466966_0011171
762 Ga0466966_0039190
763 Ga0466966_0068359
764 Ga0466966_0927083
765 Ga0466961_0018993
766 Ga0466961_0565349
767 Ga0466963_0157420
768 Ga0466963_0199855
769 Ga0466963_0212472
770 Ga0466964_0293504
771 Ga0466964_0525551
772 Ga0466964_0674467
773 Ga0466971_0039549
774 Ga0466971_0100659
775 Ga0466968_0003968
776 Ga0466968_0092057
777 Ga0466968_0124083
778 Ga0466970_0020656
779 Ga0466957_0006220
780 Ga0466957_0006518
781 Ga0466957_0020545
782 Ga0466957_0132479
783 Ga0466960_0000760
784 Ga0466960_0010837
785 Ga0466960_0020341
786 Ga0466960_0094756
787 Ga0466959_0003950
788 Ga0466959_0011761
789 Ga0466959_0027140
790 Ga0466959_0399854
791 Ga0466958_0037989
792 Ga0466958_0242184
793 Ga0466958_0253826
794 Ga0466958_0474409
795 Ga0466967_0029748
796 Ga0466967_0052607
797 Ga0466967_0119962
798 Ga0466967_1045381
799 Ga0495603_0129947
800 Ga0495594_0266232
801 Ga0495583_0118648
802 Ga0495648_0031589
803 Ga0495654_0149874
804 Ga0495668_0053941
805 Ga0495611_0138319
806 Ga0495624_0212034
807 Ga0495649_0258037
808 Ga0495673_0000444
809 Ga0496100_0000327
810 Ga0496100_0358049
811 Ga0496100_0982142
812 Ga0496101_0000549
813 Ga0496102_0016753
814 Ga0496102_0028569
815 Ga0496102_0029642
816 Ga0496102_0068195
817 Ga0496102_0171237
818 Ga0496102_0208489
819 Ga0496102_0266732
820 Ga0496102_0405671
821 Ga0496103_0000946
822 Ga0496103_0027965
823 Ga0496103_0129328
824 Ga0496103_0244493
825 Ga0496104_0036803
826 Ga0496104_0046516
827 Ga0496104_0823323
828 Ga0496104_0826806
829 Ga0496106_0002484
830 Ga0496106_0015537
831 Ga0496106_0510148
832 Ga0496106_1220193
833 Ga0496107_0000464
834 Ga0496107_0019519
835 Ga0496108_0004778
836 Ga0496108_0008786
837 Ga0496108_0076787
838 Ga0496108_0076965
839 Ga0496108_0272923
840 Ga0496108_0450754
841 Ga0496109_0000706
842 Ga0496109_0007281
843 Ga0496109_0073093
844 Ga0496109_0096999
845 Ga0496109_0412045
846 Ga0496110_0001610
847 Ga0496110_0107539
848 Ga0496110_0294816
849 Ga0496110_0805374
850 Ga0496111_0007247
851 Ga0496111_0397558
852 Ga0496111_1044832
853 Ga0496112_0307867
854 Ga0496112_0509662
855 Ga0496113_0143190
856 Ga0496113_0255197
857 Ga0496114_0000774
858 Ga0496114_0098795
859 Ga0496114_0108019
860 Ga0496114_0888857
861 Ga0496114_1038437
862 Ga0496114_1104748
863 Ga0496115_0007319
864 Ga0496115_0352603
865 Ga0496116_0003582
866 Ga0496117_0016974
867 Ga0496117_0061525
868 Ga0496118_0000595
869 Ga0496118_0017436
870 Ga0496118_0351824
871 Ga0496119_0003009
872 Ga0496120_0045432
873 Ga0496121_0000016
874 Ga0496122_0002739
875 Ga0496124_0000015
876 Ga0496125_0000021
877 Ga0496126_0000015
878 Ga0496126_0001911
879 Ga0501031_0203889
880 Ga0501031_0659521
881 Ga0501032_0037168
882 Ga0501032_0175602
883 Ga0501032_0387522
884 Ga0501033_0017450
885 Ga0501033_0116714
886 Ga0501034_0007092
887 Ga0501034_0087568
888 Ga0501036_0145140
889 Ga0501037_0044362
890 Ga0501043_0038751
891 Ga0501043_0064253
892 Ga0501046_0002772
893 Ga0501046_0313473
894 Ga0501047_0002519
895 Ga0501047_0739395
896 Ga0501048_0017886
897 Ga0501048_0663669
898 Ga0501069_0020640
899 Ga0501070_0000997
900 Ga0501070_0184988
901 Ga0501071_0384348
902 Ga0501080_0075773
903 Ga0501083_0452767
904 Ga0501035_0001107
905 Ga0501035_0003647
906 Ga0501035_0189832
907 Ga0501044_0002461
908 Ga0501044_0007204
909 nmdc:mga03683_198595_c1
910 nmdc:mga03n38_104369_c1
911 nmdc:mga03n38_384195_c1
912 nmdc:mga03n38_54731_c1
913 nmdc:mga03n38_918066_c1
914 nmdc:mga00v17_3047_c1
915 nmdc:mga00v17_52858_c1
916 nmdc:mga00v17_53524_c1
917 nmdc:mga0yw44_289735_c1
918 nmdc:mga0qj67_3373_c1
919 nmdc:mga08x19_44563_c2
920 nmdc:mga0sz30_180086_c1
921 nmdc:mga0sz30_25009_c1
922 nmdc:mga0sz30_262411_c1
923 nmdc:mga0sz30_71226_c1
924 Ga0495655_0070605
925 Ga0500641_0062484
926 Ga0500628_102184
927 Ga0500564_067843
928 Ga0466962_0037035
929 Ga0466962_0225257
930 2644636086
931 2738667033
932 2739145877
933 2842138727
934 2902815610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

13

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.7891 2 120
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.789 2 120
7kk9-assembly1.cif.gz_A fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.7869 8 120
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.783 2 117
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.7809 2 120
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8342 8 114 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8138 8 114 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8084 13 116 1.10.287.70
af_Q4D2Y9_236_346_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8033 11 114 1.10.287.70
af_A4I767_271_383_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7943 8 114 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6B9B6Y5-F1-model_v4 deleted 0.969 43 121
AF-W2E1V3-F1-model_v4 deleted 0.9689 35 116
AF-A0A0R1KYM9-F1-model_v4 Fluoride-specific ion channel FluC 0.9606 35 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A9WPV4-F1-model_v4 Fluoride-specific ion channel 0.9571 35 119 GO:0005886
GO:0034220
AF-A0A1L8D3N1-F1-model_v4 Fluoride-specific ion channel 0.9557 39 119 GO:0005886
GO:0034220

Map