F449830

General Info

Members Datasets Scaffolds Average Seq Length
467 402 197 246

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100866319|Ga0075428_1008663191
Length 285
Sequence VSSPHSPFKARGSSQHLHRLKDTSAGVTGSPYLNYNPPMTADSQKDIQALKAIGHICAETLRRMQDAVRAGMTTRELDEIGRAFLEAEGAHSAPQAMYKFPGATCISVSPVIAHGIPNEHVLREGELIHIDVSAELNGYYADTGASMVVSKGERHFEKLLEATKTALTKALRAAKAGNPLNAISRAVQTEASKRGYNVIYDLTGHGIGRKLHEEPGEILNYYNSSDRRMLNDGLVLAIEPFLTPGMGRTTQERDGWSLRTADRAIAAQFEHTIIVTKNEPIILTI

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
18 2516143018 Ensifer sp. BR816 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
29 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
35 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
36 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
37 2643221557 Ensifer sp. Root558 Isolate Unclassified
38 2643221607 Rhizobium sp. Root73 Isolate Unclassified
39 2643221610 Ensifer sp. Root74 Isolate Unclassified
40 2643221618 Ensifer sp. Root231 Isolate Unclassified
41 2643221626 Ensifer sp. Root31 Isolate Unclassified
42 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
43 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
44 2643221655 Ensifer sp. Root1252 Isolate Unclassified
45 2643221659 Ensifer sp. Root127 Isolate Unclassified
46 2643221668 Ensifer sp. Root423 Isolate Unclassified
47 2643221675 Ensifer sp. Root1298 Isolate Unclassified
48 2643221680 Ensifer sp. Root1312 Isolate Unclassified
49 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
50 2643221688 Rhizobium sp. Root482 Isolate Unclassified
51 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
52 2643221698 Ensifer sp. Root142 Isolate Unclassified
53 2643221712 Ensifer sp. Root258 Isolate Unclassified
54 2643221718 Rhizobium sp. Root268 Isolate Unclassified
55 2643221723 Ensifer sp. Root278 Isolate Unclassified
56 2643221726 Ensifer sp. Root954 Isolate Unclassified
57 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
58 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
59 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
60 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
61 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
62 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
63 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
64 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
65 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
66 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
67 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
68 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
69 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
70 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
71 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
72 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
73 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
74 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
75 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
76 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
77 2844163670 Ensifer sp. 1H6 Isolate Unclassified
78 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
79 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
80 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
81 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
82 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
83 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
84 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
85 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
86 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
87 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
88 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
89 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
90 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
91 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
92 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
93 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
94 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
95 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
96 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
97 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
98 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
99 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
100 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
101 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
102 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
103 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
104 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
105 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
106 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
107 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
108 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
109 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
110 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
111 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
112 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
113 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
114 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
115 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
116 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
117 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
118 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
119 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
120 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
121 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
122 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
123 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
124 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
125 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
126 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
127 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
128 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
129 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
130 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
131 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
132 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
133 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
134 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
135 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
136 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
137 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
138 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
139 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
140 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
141 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
142 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
143 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
144 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
145 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
146 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
147 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
148 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
149 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
150 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
151 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
152 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
153 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
154 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
155 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
156 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
157 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
158 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
159 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
160 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
161 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
162 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
163 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
164 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
165 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
166 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
167 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
168 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
169 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
170 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
171 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
172 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
173 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
174 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
175 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
176 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
177 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
178 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
179 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
180 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
181 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
182 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
183 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
184 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
185 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
186 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
187 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
188 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
189 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
190 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
191 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
192 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
193 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
194 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
195 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
196 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
197 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
198 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
199 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
200 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
201 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
202 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
203 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
204 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
205 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
206 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
207 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
208 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
209 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
210 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
211 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
212 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
213 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
214 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
215 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
216 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
217 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
218 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
219 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
220 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
221 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
222 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
223 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
224 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
225 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
226 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
227 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
228 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
229 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
230 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
231 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
232 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
233 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
234 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
235 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
236 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
237 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
238 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
239 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
240 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
241 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
242 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
243 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
244 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
245 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
246 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
247 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
248 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
249 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
250 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
251 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
252 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
253 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
254 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
255 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
256 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
257 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
258 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
259 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
260 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
261 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
262 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
263 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
264 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
265 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
266 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
267 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
268 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
269 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
270 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
271 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
272 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
273 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
274 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
275 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
276 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
277 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
278 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
279 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
280 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
281 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
282 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
283 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
284 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
285 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
286 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
287 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
288 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
289 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
290 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
291 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
292 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
293 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
294 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
295 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
296 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
297 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
298 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
299 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
300 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
301 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
302 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
303 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
304 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
305 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
306 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
307 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
308 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
309 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
310 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
311 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
312 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
313 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
314 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
315 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
316 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
317 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
318 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
319 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
320 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
327 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
333 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
336 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
337 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
338 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
339 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
340 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
341 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
342 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
343 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
344 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
345 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
346 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
347 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
348 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
349 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
350 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
351 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
352 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
353 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
354 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
355 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
356 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
357 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
358 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
359 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
360 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
361 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
362 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
363 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
364 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
397 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
398 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
399 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
400 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
401 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
402 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 42.18
Metatranscriptomes 0
Isolates 57.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.85
Nodule 48.39
Rhizoplane 0.43
Rhizosphere 32.55
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000969 3300002739 Bacteria 5281
2 JGI25159J45721_1000004 3300002987 Bacteria 215789
3 JGI25151J46595_10005175 3300003187 Bacteria 6768
4 JGI25151J46595_10015560 3300003187 Bacteria 3348
5 rootL2_10010281 3300003322 Bacteria 2269
6 JGI25160J50197_1000021 3300003354 Bacteria 215789
7 JGI25161J50226_1000458 3300003374 Bacteria 18817
8 Ga0055526_1001124 3300003771 Bacteria 19447
9 Ga0055524_1000572 3300003775 Bacteria 27327
10 Ga0055536_1004179 3300003781 Bacteria 7472
11 Ga0055540_1013631 3300003792 Bacteria 2472
12 Ga0055531_10038329 3300003794 Bacteria 1440
13 Ga0055543_1000102 3300004625 Bacteria 73861
14 Ga0065165_1000033 3300005262 Bacteria 215827
15 Ga0065704_10108290 3300005289 Bacteria 2033
16 Ga0065704_10159406 3300005289 Bacteria 1366
17 Ga0065707_10007572 3300005295 Bacteria 3349
18 Ga0070689_100311726 3300005340 Unclassified 1312
19 Ga0070687_100334524 3300005343 Bacteria 972
20 Ga0070701_10373804 3300005438 Unclassified 896
21 Ga0070705_100181698 3300005440 Bacteria 1425
22 Ga0070706_100012549 3300005467 Bacteria 7847
23 Ga0070706_100182243 3300005467 Bacteria 1961
24 Ga0070707_100116862 3300005468 Bacteria 2589
25 Ga0070698_100042927 3300005471 Bacteria 4637
26 Ga0070698_100044629 3300005471 Unclassified 4537
27 Ga0070698_100091009 3300005471 Bacteria 3033
28 Ga0070698_100305927 3300005471 Unclassified 1520
29 Ga0070698_100605069 3300005471 Unclassified 1036
30 Ga0070699_100010501 3300005518 Bacteria 8011
31 Ga0070699_100620375 3300005518 Bacteria 986
32 Ga0070696_100099782 3300005546 Bacteria 2079
33 Ga0070696_100352476 3300005546 Unclassified 1140
34 Ga0070704_100096156 3300005549 Bacteria 2220
35 Ga0068857_100108614 3300005577 Bacteria 2493
36 Ga0068857_100162188 3300005577 Bacteria 2029
37 Ga0070702_100146084 3300005615 Unclassified 1512
38 Ga0068859_100048857 3300005617 Bacteria 4250
39 Ga0068859_100055662 3300005617 Bacteria 3979
40 Ga0068859_100628446 3300005617 Bacteria 1166
41 Ga0068860_100227212 3300005843 Bacteria 1813
42 Ga0068862_100021925 3300005844 Bacteria 5342
43 Ga0081539_10003612 3300005985 Bacteria 18689
44 Ga0081539_10013896 3300005985 Bacteria 6017
45 Ga0075370_10064579 3300006353 Bacteria 2088
46 Ga0075428_100255563 3300006844 Bacteria 1887
47 Ga0075428_100495868 3300006844 Unclassified 1307
48 Ga0075428_100623619 3300006844 Bacteria 1151
49 Ga0075428_100866319 3300006844 Unclassified 959
50 Ga0075433_10332121 3300006852 Unclassified 1344
51 Ga0075434_100485604 3300006871 Unclassified 1256
52 Ga0075429_100002607 3300006880 Bacteria 15195
53 Ga0075429_100056674 3300006880 Unclassified 3411
54 Ga0075429_100119508 3300006880 Bacteria 2303
55 Ga0097620_100048858 3300006931 Bacteria 4250
56 Ga0097620_100055661 3300006931 Bacteria 3979
57 Ga0097620_100628330 3300006931 Bacteria 1166
58 Ga0079104_1008483 3300006946 Bacteria 3590
59 Ga0099826_10127072 3300006948 Bacteria 1493
60 Ga0105240_10325740 3300009093 Bacteria 1750
61 Ga0111539_10131885 3300009094 Bacteria 2926
62 Ga0114129_10003395 3300009147 Bacteria 22370
63 Ga0114129_10086566 3300009147 Bacteria 4346
64 Ga0114129_10210256 3300009147 Unclassified 2630
65 Ga0114129_10950201 3300009147 Bacteria 1086
66 Ga0105243_10012433 3300009148 Bacteria 6435
67 Ga0105243_10448196 3300009148 Bacteria 1210
68 Ga0105242_10053101 3300009176 Unclassified 3308
69 Ga0171463_1007 3300013249 Bacteria 301198
70 Ga0182005_1093624 3300015265 Bacteria 837
71 Ga0183365_10162 3300015684 Bacteria 1802
72 Ga0183363_1098 3300015690 Bacteria 24674
73 Ga0214544_1000110 3300021320 Bacteria 113143
74 Ga0214542_1000268 3300021321 Bacteria 87082
75 Ga0214542_1017541 3300021321 Bacteria 6416
76 Ga0214543_1000022 3300021327 Bacteria 241930
77 Ga0214543_1000219 3300021327 Bacteria 87102
78 Ga0228711_1000911 3300022739 Bacteria 40698
79 Ga0228710_1001018 3300022740 Bacteria 40304
80 Ga0209436_104558 3300025208 Bacteria 3405
81 Ga0209565_1014547 3300025263 Bacteria 1802
82 Ga0209130_1000017 3300025284 Bacteria 388431
83 Ga0209676_1002445 3300025292 Bacteria 13179
84 Ga0209025_1000161 3300025294 Bacteria 166506
85 Ga0209025_1000171 3300025294 Bacteria 160478
86 Ga0209025_1045422 3300025294 Bacteria 1821
87 Ga0209564_1000013 3300025295 Bacteria 775755
88 Ga0209564_1025956 3300025295 Bacteria 1952
89 Ga0209758_1026552 3300025297 Bacteria 2502
90 Ga0209050_1003968 3300025298 Bacteria 10436
91 Ga0209256_1000153 3300025299 Bacteria 144736
92 Ga0209256_1001905 3300025299 Bacteria 19079
93 Ga0207426_1000006 3300025302 Bacteria 1025969
94 Ga0209051_1007585 3300025303 Bacteria 5908
95 Ga0207684_10030591 3300025910 Bacteria 4582
96 Ga0207684_10235535 3300025910 Bacteria 1579
97 Ga0207684_10555738 3300025910 Bacteria 982
98 Ga0207662_10362713 3300025918 Bacteria 975
99 Ga0207709_10439711 3300025935 Bacteria 1006
100 Ga0207674_10270709 3300026116 Unclassified 1646
101 Ga0209281_1000190 3300027111 Bacteria 140658
102 Ga0209281_1000314 3300027111 Bacteria 86424
103 Ga0209282_1000068 3300027666 Bacteria 85817
104 Ga0268265_10563745 3300028380 Unclassified 1083
105 Ga0265334_10015374 3300028573 Unclassified 3179
106 Ga0265318_10003541 3300028577 Bacteria 7825
107 Ga0307515_10000017 3300028794 Bacteria 550465
108 Ga0307515_10017812 3300028794 Bacteria 12912
109 Ga0265338_10001112 3300028800 Bacteria 44629
110 Ga0265338_10145050 3300028800 Bacteria 1853
111 Ga0265328_10054835 3300031239 Unclassified 1463
112 Ga0265320_10027084 3300031240 Unclassified 2993
113 Ga0265340_10008025 3300031247 Bacteria 5720
114 Ga0265331_10009347 3300031250 Bacteria 5508
115 Ga0265316_10070352 3300031344 Unclassified 2699
116 Ga0307513_10026026 3300031456 Bacteria 6756
117 Ga0307513_10102593 3300031456 Bacteria 2879
118 Ga0307408_100086047 3300031548 Bacteria 2362
119 Ga0307408_100171508 3300031548 Bacteria 1733
120 Ga0307413_10174082 3300031824 Bacteria 1527
121 Ga0315914_1000937 3300031967 Bacteria 41175
122 Ga0307416_100358059 3300032002 Unclassified 1480
123 Ga0307416_100604297 3300032002 Bacteria 1177
124 Ga0307414_10262298 3300032004 Bacteria 1442
125 Ga0307411_10414312 3300032005 Bacteria 1117
126 Ga0315913_1000094 3300033430 Bacteria 51134
127 Ga0315915_1000007 3300033464 Bacteria 319225
128 Ga0395905_0000884 3300037471 Bacteria 39079
129 Ga0439436_0008989 3300041404 Bacteria 3066
130 Ga0439438_024169 3300041405 Bacteria 1666
131 Ga0439465_0002280 3300041413 Bacteria 6303
132 Ga0439445_0063812 3300042004 Bacteria 1011
133 Ga0439449_0105813 3300042007 Bacteria 1041
134 Ga0439449_0108552 3300042007 Bacteria 1027
135 Ga0450920_007617 3300042122 Bacteria 1966
136 Ga0450918_004817 3300042531 Bacteria 2442
137 Ga0451577_0361335 3300042876 Bacteria 1317
138 Ga0453683_0103896 3300044673 Unclassified 1784
139 Ga0453684_0001027 3300044712 Bacteria 89253
140 Ga0453684_0002576 3300044712 Bacteria 43473
141 Ga0453684_0015868 3300044712 Bacteria 11842
142 Ga0453684_0016509 3300044712 Bacteria 11531
143 Ga0453684_0031733 3300044712 Bacteria 7412
144 Ga0453684_0095980 3300044712 Bacteria 3643
145 Ga0453684_0231565 3300044712 Bacteria 2133
146 Ga0453684_0267140 3300044712 Unclassified 1957
147 Ga0453684_0477816 3300044712 Bacteria 1383
148 Ga0453684_0649187 3300044712 Bacteria 1152
149 Ga0453684_0816190 3300044712 Unclassified 1005
150 Ga0451576_0008052 3300045051 Bacteria 12433
151 Ga0451576_0016740 3300045051 Bacteria 8085
152 Ga0451576_0054855 3300045051 Bacteria 4171
153 Ga0451576_0368343 3300045051 Bacteria 1505
154 Ga0451576_0746903 3300045051 Unclassified 1028
155 Ga0451576_0932411 3300045051 Bacteria 911
156 Ga0495625_0054729 3300046660 Bacteria 2849
157 Ga0495649_0211009 3300046694 Bacteria 1006
158 Ga0496117_0002241 3300048920 Bacteria 24957
159 Ga0496122_0000414 3300048925 Bacteria 90664
160 Ga0496123_0000147 3300048926 Bacteria 143834
161 Ga0496124_0000348 3300048927 Bacteria 84728
162 Ga0496125_0001465 3300048928 Bacteria 34178
163 Ga0496126_0000879 3300048929 Bacteria 52860
164 Ga0496126_0069879 3300048929 Bacteria 3130
165 Ga0501033_0001531 3300049570 Bacteria 20426
166 Ga0501034_0052562 3300049571 Bacteria 4104
167 Ga0501040_0272859 3300049576 Bacteria 1208
168 Ga0501048_0266663 3300049582 Bacteria 1217
169 Ga0501071_0237527 3300049587 Viruses 1374
170 Ga0501072_0494700 3300049588 Unclassified 967
171 Ga0501073_0106168 3300049589 Bacteria 1949
172 Ga0501074_0258020 3300049590 Unclassified 1239
173 Ga0501075_0001235 3300049591 Bacteria 16572
174 Ga0501076_0001021 3300049592 Bacteria 18376
175 Ga0501076_0099515 3300049592 Bacteria 2342
176 Ga0501076_0232001 3300049592 Bacteria 1509
177 Ga0501077_0379807 3300049593 Unclassified 903
178 Ga0501079_0029621 3300049741 Bacteria 4204
179 Ga0501081_0053545 3300049743 Bacteria 2786
180 Ga0501045_0398784 3300049824 Bacteria 1024
181 nmdc:mga07m45_24619_c1 3300050496 Bacteria 3299
182 nmdc:mga05p37_147736_c1 3300050507 Bacteria 2587
183 nmdc:mga05p37_27380_c1 3300050507 Bacteria 6940
184 nmdc:mga05p37_35689_c1 3300050507 Bacteria 6098
185 nmdc:mga05p37_945285_c1 3300050507 Bacteria 923
186 nmdc:mga09592_160705_c1 3300050508 Unclassified 1940
187 nmdc:mga09592_214039_c1 3300050508 Unclassified 1670
188 nmdc:mga09592_2140_c1 3300050508 Bacteria 15937
189 nmdc:mga06r32_150444_c1 3300050510 Unclassified 2306
190 nmdc:mga06r32_586333_c1 3300050510 Bacteria 1087
191 nmdc:mga0a205_58479_c1 3300050515 Bacteria 3723
192 nmdc:mga0sz30_29315_c1 3300050516 Bacteria 2268
193 Ga0500604_0080680 3300053151 Bacteria 1051
194 Ga0501084_0012134 3300054114 Bacteria 7132
195 Ga0501084_0293874 3300054114 Unclassified 1372
196 Ga0501084_0708347 3300054114 Bacteria 849
197 Ga0501082_0328598 3300060353 Unclassified 1332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042531 Ga0450918_004817 Ga0450918_004817_12_626 204
2 iso_pu_bacteria 2964670856 2964674142 218
3 3300015265 Ga0182005_1093624 Ga0182005_10936241 221
4 iso_pu_bacteria 2924214083 2924217327 227
5 3300045051 Ga0451576_0368343 Ga0451576_0368343_589_1332 240
6 3300009147 Ga0114129_10950201 Ga0114129_109502012 241
7 3300050507 nmdc:mga05p37_945285_c1 nmdc:mga05p37_945285_c1_145_888 241
8 iso_pu_bacteria 2510917027 2511180305 243
9 iso_pu_bacteria 2512564013 2512638733 243
10 iso_pu_bacteria 2857465823 2857472034 243
11 iso_pu_bacteria 2857591370 2857597629 243
12 iso_pu_bacteria 2915597211 2915597532 243
13 iso_pu_bacteria 2915606848 2915608439 243
14 iso_pu_bacteria 2929183550 2929189010 243
15 iso_pu_bacteria 2861691609 2861694627 244
16 iso_pu_bacteria 2508501122 2509108128 245
17 iso_pu_bacteria 2509276019 2509376697 245
18 iso_pu_bacteria 2510065057 2510302752 245
19 iso_pu_bacteria 2511231052 2511497808 245
20 iso_pu_bacteria 2512047086 2512528818 245
21 iso_pu_bacteria 2512875026 2512969560 245
22 iso_pu_bacteria 2513237086 2513584537 245
23 iso_pu_bacteria 2513237089 2513606216 245
24 iso_pu_bacteria 2513237091 2513616449 245
25 iso_pu_bacteria 2513237140 2513885309 245
26 iso_pu_bacteria 2513237143 2513901982 245
27 iso_pu_bacteria 2513237156 2513985075 245
28 iso_pu_bacteria 2513237159 2513997652 245
29 iso_pu_bacteria 2513237160 2514007931 245
30 iso_pu_bacteria 2515154107 2515612048 245
31 iso_pu_bacteria 2516143018 2516206169 245
32 iso_pu_bacteria 2516653046 2516896545 245
33 iso_pu_bacteria 2517487022 2517565562 245
34 iso_pu_bacteria 2524023207 2524452064 245
35 iso_pu_bacteria 2551306084 2551681399 245
36 iso_pu_bacteria 2551306085 2551686220 245
37 iso_pu_bacteria 2551306086 2551693969 245
38 iso_pu_bacteria 2551306087 2551704165 245
39 iso_pu_bacteria 2551306089 2551709576 245
40 iso_pu_bacteria 2551306090 2551715833 245
41 iso_pu_bacteria 2551306091 2551725052 245
42 iso_pu_bacteria 2551306093 2551745814 245
43 iso_pu_bacteria 2558860100 2558863940 245
44 iso_pu_bacteria 2582581283 2585167475 245
45 iso_pu_bacteria 2582581306 2585265696 245
46 iso_pu_bacteria 2582581865 2585388902 245
47 iso_pu_bacteria 2582581866 2585395399 245
48 iso_pu_bacteria 2599185156 2599332028 245
49 iso_pu_bacteria 2599185352 2600194874 245
50 iso_pu_bacteria 2643221557 2643804172 245
51 iso_pu_bacteria 2643221607 2644050204 245
52 iso_pu_bacteria 2643221610 2644065054 245
53 iso_pu_bacteria 2643221618 2644105235 245
54 iso_pu_bacteria 2643221626 2644145689 245
55 iso_pu_bacteria 2643221636 2644204735 245
56 iso_pu_bacteria 2643221637 2644208763 245
57 iso_pu_bacteria 2643221655 2644309648 245
58 iso_pu_bacteria 2643221659 2644331184 245
59 iso_pu_bacteria 2643221668 2644376537 245
60 iso_pu_bacteria 2643221675 2644416727 245
61 iso_pu_bacteria 2643221680 2644449767 245
62 iso_pu_bacteria 2643221686 2644483124 245
63 iso_pu_bacteria 2643221688 2644494283 245
64 iso_pu_bacteria 2643221689 2644497770 245
65 iso_pu_bacteria 2643221698 2644543377 245
66 iso_pu_bacteria 2643221712 2644616172 245
67 iso_pu_bacteria 2643221718 2644652293 245
68 iso_pu_bacteria 2643221723 2644675795 245
69 iso_pu_bacteria 2643221726 2644689899 245
70 iso_pu_bacteria 2657244999 2657681752 245
71 iso_pu_bacteria 2690316117 2692315262 245
72 iso_pu_bacteria 2751185821 2753462381 245
73 iso_pu_bacteria 2791355082 2792581465 245
74 iso_pu_bacteria 2791355091 2792620558 245
75 iso_pu_bacteria 2791355092 2792625917 245
76 iso_pu_bacteria 2791355094 2792638857 245
77 iso_pu_bacteria 2791355253 2793280087 245
78 iso_pu_bacteria 2802428858 2802715990 245
79 iso_pu_bacteria 2802428859 2802722986 245
80 iso_pu_bacteria 2802428860 2802728881 245
81 iso_pu_bacteria 2802428861 2802735248 245
82 iso_pu_bacteria 2802428862 2802742148 245
83 iso_pu_bacteria 2802428863 2802748595 245
84 iso_pu_bacteria 2802429268 2804752937 245
85 iso_pu_bacteria 2829745981 2829747708 245
86 iso_pu_bacteria 2838074704 2838079767 245
87 iso_pu_bacteria 2840878972 2840882248 245
88 iso_pu_bacteria 2842521101 2842522105 245
89 iso_pu_bacteria 2842922631 2842924364 245
90 iso_pu_bacteria 2844163670 2844163993 245
91 iso_pu_bacteria 2847417321 2847419680 245
92 iso_pu_bacteria 2848992105 2848994682 245
93 iso_pu_bacteria 2850079185 2850081698 245
94 iso_pu_bacteria 2855825444 2855828627 245
95 iso_pu_bacteria 2855839649 2855843748 245
96 iso_pu_bacteria 2855872281 2855877196 245
97 iso_pu_bacteria 2858800743 2858807007 245
98 iso_pu_bacteria 2891048133 2891051189 245
99 iso_pu_bacteria 2891373044 2891373612 245
100 iso_pu_bacteria 2896384573 2896391118 245
101 iso_pu_bacteria 2899275550 2899277776 245
102 iso_pu_bacteria 2913295892 2913296143 245
103 iso_pu_bacteria 2915980308 2915983655 245
104 iso_pu_bacteria 2915986958 2915988487 245
105 iso_pu_bacteria 2915993759 2915994236 245
106 iso_pu_bacteria 2916000859 2916006251 245
107 iso_pu_bacteria 2916014648 2916021524 245
108 iso_pu_bacteria 2916021584 2916028154 245
109 iso_pu_bacteria 2916028427 2916035070 245
110 iso_pu_bacteria 2916035215 2916038258 245
111 iso_pu_bacteria 2916041962 2916044970 245
112 iso_pu_bacteria 2916048683 2916054540 245
113 iso_pu_bacteria 2916055098 2916061155 245
114 iso_pu_bacteria 2916061851 2916065354 245
115 iso_pu_bacteria 2916068649 2916070770 245
116 iso_pu_bacteria 2916076590 2916082939 245
117 iso_pu_bacteria 2919679072 2919682123 245
118 iso_pu_bacteria 2920760137 2920761290 245
119 iso_pu_bacteria 2920822456 2920825513 245
120 iso_pu_bacteria 2921201388 2921203214 245
121 iso_pu_bacteria 2921208531 2921210110 245
122 iso_pu_bacteria 2921237296 2921240583 245
123 iso_pu_bacteria 2921244191 2921245786 245
124 iso_pu_bacteria 2921250672 2921256894 245
125 iso_pu_bacteria 2921257292 2921260098 245
126 iso_pu_bacteria 2921263974 2921269990 245
127 iso_pu_bacteria 2921282425 2921283072 245
128 iso_pu_bacteria 2921289301 2921296776 245
129 iso_pu_bacteria 2924144063 2924148504 245
130 iso_pu_bacteria 2924150972 2924154709 245
131 iso_pu_bacteria 2924158325 2924164385 245
132 iso_pu_bacteria 2924165586 2924168386 245
133 iso_pu_bacteria 2924172951 2924178765 245
134 iso_pu_bacteria 2924179722 2924182089 245
135 iso_pu_bacteria 2924186466 2924188964 245
136 iso_pu_bacteria 2924193448 2924195815 245
137 iso_pu_bacteria 2924200457 2924202914 245
138 iso_pu_bacteria 2924207177 2924209948 245
139 iso_pu_bacteria 2924221636 2924228289 245
140 iso_pu_bacteria 2924228884 2924235352 245
141 iso_pu_bacteria 2936996657 2937001520 245
142 iso_pu_bacteria 2937002841 2937005827 245
143 iso_pu_bacteria 2937009748 2937014336 245
144 iso_pu_bacteria 2937016420 2937021939 245
145 iso_pu_bacteria 2937023124 2937023995 245
146 iso_pu_bacteria 2937029754 2937035007 245
147 iso_pu_bacteria 2937036028 2937039238 245
148 iso_pu_bacteria 2937042894 2937049008 245
149 iso_pu_bacteria 2937049772 2937056426 245
150 iso_pu_bacteria 2937056579 2937056892 245
151 iso_pu_bacteria 2937063883 2937066047 245
152 iso_pu_bacteria 2937071275 2937075362 245
153 iso_pu_bacteria 2937078374 2937084349 245
154 iso_pu_bacteria 2937084907 2937087385 245
155 iso_pu_bacteria 2937091812 2937092605 245
156 iso_pu_bacteria 2937098957 2937100488 245
157 iso_pu_bacteria 2937106411 2937110487 245
158 iso_pu_bacteria 2937113482 2937118800 245
159 iso_pu_bacteria 2937119839 2937125855 245
160 iso_pu_bacteria 2937126314 2937131018 245
161 iso_pu_bacteria 2941499720 2941504705 245
162 iso_pu_bacteria 2957375807 2957379077 245
163 iso_pu_bacteria 2957382221 2957383041 245
164 iso_pu_bacteria 2957388812 2957391999 245
165 iso_pu_bacteria 2957395598 2957396226 245
166 iso_pu_bacteria 2957402308 2957402907 245
167 iso_pu_bacteria 2957408893 2957410679 245
168 iso_pu_bacteria 2957415311 2957416035 245
169 iso_pu_bacteria 2957422303 2957428796 245
170 iso_pu_bacteria 2957430029 2957430498 245
171 iso_pu_bacteria 2957437181 2957438841 245
172 iso_pu_bacteria 2957443900 2957445248 245
173 iso_pu_bacteria 2957450854 2957454936 245
174 iso_pu_bacteria 2957457609 2957461770 245
175 iso_pu_bacteria 2957464669 2957464801 245
176 iso_pu_bacteria 2957471148 2957477913 245
177 iso_pu_bacteria 2957478035 2957484352 245
178 iso_pu_bacteria 2957484790 2957489980 245
179 iso_pu_bacteria 2957491536 2957491665 245
180 iso_pu_bacteria 2957498199 2957501670 245
181 iso_pu_bacteria 2957505466 2957510292 245
182 iso_pu_bacteria 2960584000 2960585052 245
183 iso_pu_bacteria 2960591022 2960595286 245
184 iso_pu_bacteria 2960597568 2960598495 245
185 iso_pu_bacteria 2960603979 2960604561 245
186 iso_pu_bacteria 2960610863 2960614276 245
187 iso_pu_bacteria 2960617483 2960621859 245
188 iso_pu_bacteria 2960624210 2960630389 245
189 iso_pu_bacteria 2960631154 2960634375 245
190 iso_pu_bacteria 2960645483 2960645615 245
191 iso_pu_bacteria 2960652885 2960660087 245
192 iso_pu_bacteria 2960660292 2960661961 245
193 iso_pu_bacteria 2960667422 2960669799 245
194 iso_pu_bacteria 2960674078 2960677786 245
195 iso_pu_bacteria 2960680706 2960683397 245
196 iso_pu_bacteria 2960687367 2960692956 245
197 iso_pu_bacteria 2960693952 2960695248 245
198 iso_pu_bacteria 2964607997 2964610736 245
199 iso_pu_bacteria 2964615318 2964621681 245
200 iso_pu_bacteria 2964621998 2964624232 245
201 iso_pu_bacteria 2964628898 2964629900 245
202 iso_pu_bacteria 2964636051 2964639515 245
203 iso_pu_bacteria 2964643177 2964647934 245
204 iso_pu_bacteria 2964649959 2964655542 245
205 iso_pu_bacteria 2964656573 2964657979 245
206 iso_pu_bacteria 2964663802 2964664642 245
207 iso_pu_bacteria 2964678106 2964678425 245
208 iso_pu_bacteria 2964685014 2964689139 245
209 iso_pu_bacteria 2964691889 2964696082 245
210 iso_pu_bacteria 2964698721 2964704970 245
211 iso_pu_bacteria 2964705432 2964709617 245
212 iso_pu_bacteria 2964712639 2964717583 245
213 iso_pu_bacteria 2964719344 2964720977 245
214 iso_pu_bacteria 2967664464 2967665648 245
215 iso_pu_bacteria 2967671571 2967677112 245
216 iso_pu_bacteria 2967678726 2967685681 245
217 iso_pu_bacteria 2967686174 2967687970 245
218 iso_pu_bacteria 2967693043 2967697856 245
219 iso_pu_bacteria 2967699805 2967704429 245
220 iso_pu_bacteria 2967706974 2967714136 245
221 iso_pu_bacteria 2967714385 2967720917 245
222 iso_pu_bacteria 2967721400 2967725150 245
223 iso_pu_bacteria 2967728569 2967732686 245
224 iso_pu_bacteria 2967735183 2967741851 245
225 iso_pu_bacteria 2967742019 2967748919 245
226 iso_pu_bacteria 2967748971 2967750885 245
227 iso_pu_bacteria 2967755722 2967761714 245
228 iso_pu_bacteria 2967762386 2967765983 245
229 iso_pu_bacteria 2967769361 2967772250 245
230 iso_pu_bacteria 2967775926 2967781986 245
231 iso_pu_bacteria 2970019648 2970023585 245
232 iso_pu_bacteria 2970026789 2970028891 245
233 iso_pu_bacteria 2970033650 2970038287 245
234 iso_pu_bacteria 2970040964 2970042172 245
235 iso_pu_bacteria 2970047711 2970054851 245
236 iso_pu_bacteria 2970054988 2970061232 245
237 iso_pu_bacteria 2970061556 2970062946 245
238 iso_pu_bacteria 2970068827 2970071334 245
239 iso_pu_bacteria 2970076120 2970080284 245
240 iso_pu_bacteria 2970082768 2970085740 245
241 iso_pu_bacteria 2970088815 2970094714 245
242 iso_pu_bacteria 2970095765 2970097316 245
243 iso_pu_bacteria 2970102677 2970105873 245
244 iso_pu_bacteria 2970109326 2970116118 245
245 iso_pu_bacteria 2970116247 2970119647 245
246 iso_pu_bacteria 2970122695 2970126612 245
247 iso_pu_bacteria 2970129317 2970134898 245
248 iso_pu_bacteria 2970136068 2970140919 245
249 iso_pu_bacteria 2970143518 2970148429 245
250 iso_pu_bacteria 2970149975 2970153152 245
251 iso_pu_bacteria 2970156795 2970162986 245
252 iso_pu_bacteria 2970164137 2970164680 245
253 iso_pu_bacteria 2970170962 2970174346 245
254 iso_pu_bacteria 2970177841 2970182394 245
255 iso_pu_bacteria 2970184632 2970191266 245
256 iso_pu_bacteria 2970191845 2970194710 245
257 iso_pu_bacteria 2977516862 2977518763 245
258 iso_pu_bacteria 2977523885 2977526660 245
259 iso_pu_bacteria 2977530762 2977533895 245
260 iso_pu_bacteria 2977537788 2977541287 245
261 iso_pu_bacteria 2977544691 2977547983 245
262 iso_pu_bacteria 2977551784 2977557893 245
263 iso_pu_bacteria 2977558990 2977559535 245
264 iso_pu_bacteria 2977565890 2977569179 245
265 iso_pu_bacteria 2977572785 2977578689 245
266 iso_pu_bacteria 2977579622 2977585634 245
267 iso_pu_bacteria 2989349275 2989350091 245
268 iso_pu_bacteria 3003665799 3003671093 245
269 iso_pu_bacteria 648276728 648740961 245
270 iso_pu_bacteria 8003992118 8003996308 245
271 iso_pu_bacteria 8003999396 8004004039 245
272 iso_pu_bacteria 8049293176 8049295546 245
273 iso_pu_bacteria 8054558443 8054559155 245
274 iso_pu_bacteria 8054563764 8054567008 245
275 3300028800 Ga0265338_10145050 Ga0265338_101450502 246
276 3300044712 Ga0453684_0231565 Ga0453684_0231565_309_1049 246
277 3300045051 Ga0451576_0054855 Ga0451576_0054855_1732_2472 246
278 3300049576 Ga0501040_0272859 Ga0501040_0272859_343_1083 246
279 3300005289 Ga0065704_10108290 Ga0065704_101082901 247
280 3300005295 Ga0065707_10007572 Ga0065707_100075721 247
281 3300005340 Ga0070689_100311726 Ga0070689_1003117262 247
282 3300005343 Ga0070687_100334524 Ga0070687_1003345242 247
283 3300005438 Ga0070701_10373804 Ga0070701_103738041 247
284 3300005440 Ga0070705_100181698 Ga0070705_1001816981 247
285 3300005467 Ga0070706_100012549 Ga0070706_1000125496 247
286 3300005467 Ga0070706_100182243 Ga0070706_1001822432 247
287 3300005468 Ga0070707_100116862 Ga0070707_1001168622 247
288 3300005471 Ga0070698_100042927 Ga0070698_1000429273 247
289 3300005471 Ga0070698_100044629 Ga0070698_1000446296 247
290 3300005471 Ga0070698_100091009 Ga0070698_1000910095 247
291 3300005471 Ga0070698_100305927 Ga0070698_1003059272 247
292 3300005518 Ga0070699_100010501 Ga0070699_10001050110 247
293 3300005518 Ga0070699_100620375 Ga0070699_1006203751 247
294 3300005546 Ga0070696_100099782 Ga0070696_1000997823 247
295 3300005546 Ga0070696_100352476 Ga0070696_1003524761 247
296 3300005549 Ga0070704_100096156 Ga0070704_1000961563 247
297 3300005577 Ga0068857_100108614 Ga0068857_1001086143 247
298 3300005577 Ga0068857_100162188 Ga0068857_1001621883 247
299 3300005615 Ga0070702_100146084 Ga0070702_1001460842 247
300 3300005617 Ga0068859_100048857 Ga0068859_1000488574 247
301 3300005617 Ga0068859_100055662 Ga0068859_1000556626 247
302 3300005843 Ga0068860_100227212 Ga0068860_1002272122 247
303 3300005844 Ga0068862_100021925 Ga0068862_1000219253 247
304 3300005985 Ga0081539_10003612 Ga0081539_100036126 247
305 3300005985 Ga0081539_10013896 Ga0081539_100138965 247
306 3300006844 Ga0075428_100255563 Ga0075428_1002555632 247
307 3300006844 Ga0075428_100495868 Ga0075428_1004958682 247
308 3300006844 Ga0075428_100623619 Ga0075428_1006236192 247
309 3300006844 Ga0075428_100866319 Ga0075428_1008663191 247
310 3300006852 Ga0075433_10332121 Ga0075433_103321212 247
311 3300006871 Ga0075434_100485604 Ga0075434_1004856042 247
312 3300006880 Ga0075429_100002607 Ga0075429_1000026076 247
313 3300006880 Ga0075429_100056674 Ga0075429_1000566742 247
314 3300006880 Ga0075429_100119508 Ga0075429_1001195082 247
315 3300006931 Ga0097620_100048858 Ga0097620_1000488584 247
316 3300006931 Ga0097620_100055661 Ga0097620_1000556616 247
317 3300009093 Ga0105240_10325740 Ga0105240_103257402 247
318 3300009094 Ga0111539_10131885 Ga0111539_101318854 247
319 3300009147 Ga0114129_10003395 Ga0114129_1000339510 247
320 3300009147 Ga0114129_10086566 Ga0114129_100865665 247
321 3300009147 Ga0114129_10210256 Ga0114129_102102564 247
322 3300009148 Ga0105243_10012433 Ga0105243_100124337 247
323 3300009148 Ga0105243_10448196 Ga0105243_104481961 247
324 3300009176 Ga0105242_10053101 Ga0105242_100531013 247
325 3300025910 Ga0207684_10030591 Ga0207684_100305916 247
326 3300025910 Ga0207684_10235535 Ga0207684_102355351 247
327 3300025910 Ga0207684_10555738 Ga0207684_105557381 247
328 3300025918 Ga0207662_10362713 Ga0207662_103627131 247
329 3300025935 Ga0207709_10439711 Ga0207709_104397112 247
330 3300026116 Ga0207674_10270709 Ga0207674_102707092 247
331 3300028380 Ga0268265_10563745 Ga0268265_105637451 247
332 3300028573 Ga0265334_10015374 Ga0265334_100153743 247
333 3300028577 Ga0265318_10003541 Ga0265318_100035417 247
334 3300031239 Ga0265328_10054835 Ga0265328_100548352 247
335 3300031240 Ga0265320_10027084 Ga0265320_100270841 247
336 3300031247 Ga0265340_10008025 Ga0265340_100080256 247
337 3300031250 Ga0265331_10009347 Ga0265331_100093473 247
338 3300031344 Ga0265316_10070352 Ga0265316_100703521 247
339 3300031548 Ga0307408_100171508 Ga0307408_1001715081 247
340 3300032002 Ga0307416_100358059 Ga0307416_1003580592 247
341 3300042876 Ga0451577_0361335 Ga0451577_0361335_507_1286 247
342 3300044673 Ga0453683_0103896 Ga0453683_0103896_848_1591 247
343 3300044712 Ga0453684_0001027 Ga0453684_0001027_6406_7185 247
344 3300044712 Ga0453684_0015868 Ga0453684_0015868_8018_8761 247
345 3300044712 Ga0453684_0016509 Ga0453684_0016509_3164_3907 247
346 3300044712 Ga0453684_0031733 Ga0453684_0031733_2501_3244 247
347 3300044712 Ga0453684_0267140 Ga0453684_0267140_148_891 247
348 3300044712 Ga0453684_0477816 Ga0453684_0477816_596_1339 247
349 3300044712 Ga0453684_0816190 Ga0453684_0816190_221_964 247
350 3300045051 Ga0451576_0008052 Ga0451576_0008052_10071_10814 247
351 3300045051 Ga0451576_0016740 Ga0451576_0016740_5175_5918 247
352 3300045051 Ga0451576_0746903 Ga0451576_0746903_73_816 247
353 3300049571 Ga0501034_0052562 Ga0501034_0052562_565_1308 247
354 3300049582 Ga0501048_0266663 Ga0501048_0266663_371_1114 247
355 3300049587 Ga0501071_0237527 Ga0501071_0237527_571_1314 247
356 3300049588 Ga0501072_0494700 Ga0501072_0494700_100_843 247
357 3300049592 Ga0501076_0099515 Ga0501076_0099515_1456_2199 247
358 3300049592 Ga0501076_0232001 Ga0501076_0232001_680_1423 247
359 3300049824 Ga0501045_0398784 Ga0501045_0398784_24_767 247
360 3300050507 nmdc:mga05p37_147736_c1 nmdc:mga05p37_147736_c1_515_1258 247
361 3300050507 nmdc:mga05p37_27380_c1 nmdc:mga05p37_27380_c1_1062_1805 247
362 3300050507 nmdc:mga05p37_35689_c1 nmdc:mga05p37_35689_c1_1369_2112 247
363 3300050508 nmdc:mga09592_160705_c1 nmdc:mga09592_160705_c1_857_1600 247
364 3300050508 nmdc:mga09592_214039_c1 nmdc:mga09592_214039_c1_560_1303 247
365 3300050508 nmdc:mga09592_2140_c1 nmdc:mga09592_2140_c1_11704_12447 247
366 3300050510 nmdc:mga06r32_150444_c1 nmdc:mga06r32_150444_c1_1244_2023 247
367 3300050510 nmdc:mga06r32_586333_c1 nmdc:mga06r32_586333_c1_117_860 247
368 3300050515 nmdc:mga0a205_58479_c1 nmdc:mga0a205_58479_c1_847_1590 247
369 3300054114 Ga0501084_0293874 Ga0501084_0293874_521_1264 247
370 3300054114 Ga0501084_0708347 Ga0501084_0708347_75_818 247
371 3300005289 Ga0065704_10159406 Ga0065704_101594061 248
372 3300044712 Ga0453684_0002576 Ga0453684_0002576_20766_21512 248
373 3300044712 Ga0453684_0095980 Ga0453684_0095980_2670_3416 248
374 3300044712 Ga0453684_0649187 Ga0453684_0649187_124_870 248
375 3300046694 Ga0495649_0211009 Ga0495649_0211009_147_893 248
376 3300002739 JGI25158J39367_1000969 JGI25158J39367_10009692 249
377 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000436 249
378 3300003187 JGI25151J46595_10005175 JGI25151J46595_100051751 249
379 3300003187 JGI25151J46595_10015560 JGI25151J46595_100155603 249
380 3300003322 rootL2_10010281 rootL2_100102811 249
381 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021173 249
382 3300003374 JGI25161J50226_1000458 JGI25161J50226_100045813 249
383 3300003771 Ga0055526_1001124 Ga0055526_10011242 249
384 3300003775 Ga0055524_1000572 Ga0055524_100057228 249
385 3300003781 Ga0055536_1004179 Ga0055536_10041794 249
386 3300003792 Ga0055540_1013631 Ga0055540_10136312 249
387 3300003794 Ga0055531_10038329 Ga0055531_100383292 249
388 3300004625 Ga0055543_1000102 Ga0055543_100010236 249
389 3300005262 Ga0065165_1000033 Ga0065165_1000033173 249
390 3300005471 Ga0070698_100605069 Ga0070698_1006050692 249
391 3300005617 Ga0068859_100628446 Ga0068859_1006284462 249
392 3300006353 Ga0075370_10064579 Ga0075370_100645792 249
393 3300006931 Ga0097620_100628330 Ga0097620_1006283301 249
394 3300006946 Ga0079104_1008483 Ga0079104_10084833 249
395 3300006948 Ga0099826_10127072 Ga0099826_101270722 249
396 3300013249 Ga0171463_1007 Ga0171463_100771 249
397 3300015684 Ga0183365_10162 Ga0183365_101622 249
398 3300015690 Ga0183363_1098 Ga0183363_10989 249
399 3300021320 Ga0214544_1000110 Ga0214544_100011054 249
400 3300021321 Ga0214542_1000268 Ga0214542_100026828 249
401 3300021321 Ga0214542_1017541 Ga0214542_10175417 249
402 3300021327 Ga0214543_1000022 Ga0214543_1000022121 249
403 3300021327 Ga0214543_1000219 Ga0214543_100021929 249
404 3300022739 Ga0228711_1000911 Ga0228711_10009119 249
405 3300022740 Ga0228710_1001018 Ga0228710_10010189 249
406 3300025208 Ga0209436_104558 Ga0209436_1045583 249
407 3300025263 Ga0209565_1014547 Ga0209565_10145472 249
408 3300025284 Ga0209130_1000017 Ga0209130_1000017210 249
409 3300025292 Ga0209676_1002445 Ga0209676_10024457 249
410 3300025294 Ga0209025_1000161 Ga0209025_100016136 249
411 3300025294 Ga0209025_1000171 Ga0209025_100017113 249
412 3300025294 Ga0209025_1045422 Ga0209025_10454222 249
413 3300025295 Ga0209564_1000013 Ga0209564_1000013658 249
414 3300025295 Ga0209564_1025956 Ga0209564_10259562 249
415 3300025297 Ga0209758_1026552 Ga0209758_10265523 249
416 3300025298 Ga0209050_1003968 Ga0209050_10039684 249
417 3300025299 Ga0209256_1000153 Ga0209256_1000153105 249
418 3300025299 Ga0209256_1001905 Ga0209256_10019055 249
419 3300025302 Ga0207426_1000006 Ga0207426_1000006209 249
420 3300025303 Ga0209051_1007585 Ga0209051_10075852 249
421 3300027111 Ga0209281_1000190 Ga0209281_100019098 249
422 3300027111 Ga0209281_1000314 Ga0209281_100031432 249
423 3300027666 Ga0209282_1000068 Ga0209282_100006832 249
424 3300028794 Ga0307515_10000017 Ga0307515_10000017119 249
425 3300028794 Ga0307515_10017812 Ga0307515_100178127 249
426 3300028800 Ga0265338_10001112 Ga0265338_1000111243 249
427 3300031456 Ga0307513_10026026 Ga0307513_1002602610 249
428 3300031456 Ga0307513_10102593 Ga0307513_101025932 249
429 3300031548 Ga0307408_100086047 Ga0307408_1000860472 249
430 3300031824 Ga0307413_10174082 Ga0307413_101740822 249
431 3300031967 Ga0315914_1000937 Ga0315914_10009379 249
432 3300032002 Ga0307416_100604297 Ga0307416_1006042971 249
433 3300032004 Ga0307414_10262298 Ga0307414_102622982 249
434 3300032005 Ga0307411_10414312 Ga0307411_104143122 249
435 3300033430 Ga0315913_1000094 Ga0315913_100009430 249
436 3300033464 Ga0315915_1000007 Ga0315915_1000007273 249
437 3300037471 Ga0395905_0000884 Ga0395905_0000884_25056_25805 249
438 3300041404 Ga0439436_0008989 Ga0439436_0008989_1809_2558 249
439 3300041405 Ga0439438_024169 Ga0439438_024169_531_1280 249
440 3300041413 Ga0439465_0002280 Ga0439465_0002280_254_1003 249
441 3300042004 Ga0439445_0063812 Ga0439445_0063812_233_982 249
442 3300042007 Ga0439449_0105813 Ga0439449_0105813_210_959 249
443 3300042007 Ga0439449_0108552 Ga0439449_0108552_153_902 249
444 3300042122 Ga0450920_007617 Ga0450920_007617_916_1665 249
445 3300045051 Ga0451576_0932411 Ga0451576_0932411_85_843 249
446 3300046660 Ga0495625_0054729 Ga0495625_0054729_1217_1966 249
447 3300048920 Ga0496117_0002241 Ga0496117_0002241_21322_22074 249
448 3300048925 Ga0496122_0000414 Ga0496122_0000414_37290_38042 249
449 3300048926 Ga0496123_0000147 Ga0496123_0000147_113560_114312 249
450 3300048927 Ga0496124_0000348 Ga0496124_0000348_43709_44461 249
451 3300048928 Ga0496125_0001465 Ga0496125_0001465_16184_16936 249
452 3300048929 Ga0496126_0000879 Ga0496126_0000879_23065_23817 249
453 3300048929 Ga0496126_0069879 Ga0496126_0069879_1155_1907 249
454 3300049570 Ga0501033_0001531 Ga0501033_0001531_6619_7371 249
455 3300049589 Ga0501073_0106168 Ga0501073_0106168_113_865 249
456 3300049590 Ga0501074_0258020 Ga0501074_0258020_220_969 249
457 3300049591 Ga0501075_0001235 Ga0501075_0001235_6930_7679 249
458 3300049592 Ga0501076_0001021 Ga0501076_0001021_648_1397 249
459 3300049593 Ga0501077_0379807 Ga0501077_0379807_125_874 249
460 3300049741 Ga0501079_0029621 Ga0501079_0029621_2551_3300 249
461 3300049743 Ga0501081_0053545 Ga0501081_0053545_905_1654 249
462 3300050496 nmdc:mga07m45_24619_c1 nmdc:mga07m45_24619_c1_1137_1886 249
463 3300050516 nmdc:mga0sz30_29315_c1 nmdc:mga0sz30_29315_c1_1373_2122 249
464 3300053151 Ga0500604_0080680 Ga0500604_0080680_177_926 249
465 3300054114 Ga0501084_0012134 Ga0501084_0012134_1959_2708 249
466 3300060353 Ga0501082_0328598 Ga0501082_0328598_86_835 249
467 iso_pu_bacteria 643692032 643826575 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

48

277

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qxz-assembly1.cif.gz_A crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle inhibitor 119 0.9815 1 244
1qxz-assembly1.cif.gz_A crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle inhibitor 119 0.9697 1 244
5yr6-assembly1.cif.gz_A human methionine aminopeptidase type 1b (f309l mutant) in complex with tnp470 0.962 1 244
4fuk-assembly1.cif.gz_B aminopeptidase from trypanosoma brucei 0.9608 8 243
2b3k-assembly1.cif.gz_A crystal structure of human methionine aminopeptidase type i in the holo form 0.9606 1 244
ID Description Score Start End Superfamily
1qxyA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9808 1 244 3.90.230.10
1qxyA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9691 1 244 3.90.230.10
af_Q8I3J2_42_327_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.963 3 243 3.90.230.10
af_Q4D257_64_370_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9614 1 243 3.90.230.10
4fukB01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9608 8 243 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A559IZV5-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.989 1 244 GO:0004239
GO:0006508
GO:0046872
GO:0070006
AF-O34484-F1-model_v4 Methionine aminopeptidase 2 (MAP 2) (MetAP 2) (EC 3.4.11.18) 0.9883 1 244 GO:0004239
GO:0005737
GO:0006508
GO:0046872
GO:0070006
AF-A0A350WSC8-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9861 1 244 GO:0004239
GO:0006508
GO:0046872
GO:0070006
AF-A0A351X0T7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9854 1 244 GO:0004239
GO:0006508
GO:0046872
GO:0070006
AF-A0A6N6VW21-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.984 1 246 GO:0004239
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
97.23 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map