metagRoot

F449838

General Info

Members	Datasets	Scaffolds	Average Seq Length
467	218	467	404

Family's Representative Sequence

Representative Sequence	3300009093\|Ga0105240_10277976\|Ga0105240_102779762
Length	436
Sequence	VKWADAAARRLPPPGHPEYRLAQRLDPVAEAPRMVNRSTVQAAIDAGSGVLRLEPAWVPRTFMLPGRRLKLHPDDLYALGAHRGGINERWFSSTTNADNGPGTPPDEGLSYVRLKNGNRLLLKEAVDAAGDLLIGSSVMQREGGWNLLCKFFDNMGPIPHHMHQNDADAARVGRRGKPEAYYFPPQYNQLDNDFPYTFMGLEPGTEKADVLRCLENWNKGDNGILFLSRAFRLQPGTGWQVNPGILHAPGSLVTYEPQVNSDVFAMFQSEVDGRIIDWSLLTKDVPPEHHRDLDYIVSMLDWDANVDPAFAKRNRVFPTPVRPVEETEAEGYRELWVCYGTPYYSAKELTVLPRRTVTVRDAAAYGLILTQGHGTFGPHHVSTPSMIRFGQMTEDELFVTDEAARAGVRIENASDSDPLVILKHFGPGNPDAPGRN

Samples

	Sample ID	Description	Type	Environment
1	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
4	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
5	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
27	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
28	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
54	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
55	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
56	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
57	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
58	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
59	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
60	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
61	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
62	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
64	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
69	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
70	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
71	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
72	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
75	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
76	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
78	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
79	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
84	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
85	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
86	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
87	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
88	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
89	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
142	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
146	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
147	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
148	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
149	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
150	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
151	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
152	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
153	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
154	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
155	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
156	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
157	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
158	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
159	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
160	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
161	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
162	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
163	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
164	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
165	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
166	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
167	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
168	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
169	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
170	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
171	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
172	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
173	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
174	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
175	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
176	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
177	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
178	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
179	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
180	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
181	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
182	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
183	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
184	3300049520	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought	Metagenome	Rhizosphere
185	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
186	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
188	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
191	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
192	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
193	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
194	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
195	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
196	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
197	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
198	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
199	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
200	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
201	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
202	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
203	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
204	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
205	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
206	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
207	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
208	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
209	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
210	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
211	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
212	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
213	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
214	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
215	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
216	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
217	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
218	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.78
Nodule	0
Rhizoplane	2.78
Rhizosphere	94
Stem	0
Stem Tuber	0
Unclassified	0.43

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24751J29686_10013630	3300002459	Unclassified	1677
2	JGI25406J46586_10004452	3300003203	Bacteria	6520
3	rootH2_10091272	3300003320	Bacteria	3369
4	Ga0065704_10097865	3300005289	Unclassified	2375
5	Ga0065712_10004085	3300005290	Bacteria	3643
6	Ga0065712_10069720	3300005290	Bacteria	6816
7	Ga0065712_10085241	3300005290	Bacteria	2709
8	Ga0065712_10119575	3300005290	Bacteria	1690
9	Ga0065715_10004954	3300005293	Bacteria	4972
10	Ga0065715_10006111	3300005293	Bacteria	5386
11	Ga0065715_10008144	3300005293	Bacteria	3063
12	Ga0065715_10126440	3300005293	Bacteria	2108
13	Ga0065715_10134347	3300005293	Bacteria	1956
14	Ga0065715_10170788	3300005293	Bacteria	1546
15	Ga0065707_10086701	3300005295	Bacteria	5345
16	Ga0065707_10102298	3300005295	Bacteria	2815
17	Ga0065707_10102434	3300005295	Bacteria	2806
18	Ga0065707_10105347	3300005295	Unclassified	2649
19	Ga0070676_10013585	3300005328	Bacteria	4464
20	Ga0070683_100049551	3300005329	Bacteria	3885
21	Ga0070683_100106636	3300005329	Bacteria	2642
22	Ga0070690_100004703	3300005330	Bacteria	7609
23	Ga0070690_100060356	3300005330	Bacteria	2440
24	Ga0070670_100001651	3300005331	Bacteria	18068
25	Ga0070670_100006651	3300005331	Bacteria	9797
26	Ga0070670_100020481	3300005331	Bacteria	5686
27	Ga0070670_100026832	3300005331	Bacteria	4955
28	Ga0070666_10037373	3300005335	Bacteria	3228
29	Ga0070680_100109080	3300005336	Bacteria	2303
30	Ga0068868_100002690	3300005338	Bacteria	12334
31	Ga0068868_100258399	3300005338	Bacteria	1468
32	Ga0070689_100038807	3300005340	Bacteria	3644
33	Ga0070689_100041158	3300005340	Bacteria	3546
34	Ga0070661_100012730	3300005344	Bacteria	5888
35	Ga0070669_100001018	3300005353	Bacteria	20415
36	Ga0070669_100088743	3300005353	Bacteria	2315
37	Ga0070675_100001252	3300005354	Bacteria	18549
38	Ga0070675_100013676	3300005354	Bacteria	6384
39	Ga0070671_100025047	3300005355	Bacteria	4891
40	Ga0070671_100050403	3300005355	Bacteria	3462
41	Ga0070674_100005200	3300005356	Bacteria	7482
42	Ga0070674_100027033	3300005356	Bacteria	3756
43	Ga0070673_100050738	3300005364	Bacteria	3245
44	Ga0070673_100067030	3300005364	Bacteria	2869
45	Ga0070688_100045010	3300005365	Bacteria	2725
46	Ga0070688_100069919	3300005365	Bacteria	2243
47	Ga0070659_100057109	3300005366	Bacteria	3077
48	Ga0070659_100267632	3300005366	Bacteria	1419
49	Ga0070667_100007773	3300005367	Bacteria	8888
50	Ga0070713_100102424	3300005436	Bacteria	2483
51	Ga0070710_10024341	3300005437	Bacteria	3193
52	Ga0070701_10001781	3300005438	Bacteria	8132
53	Ga0070701_10059699	3300005438	Bacteria	2006
54	Ga0070705_100023959	3300005440	Bacteria	3287
55	Ga0070705_100087346	3300005440	Bacteria	1933
56	Ga0070700_100018692	3300005441	Bacteria	3987
57	Ga0070700_100118570	3300005441	Bacteria	1770
58	Ga0070694_100015745	3300005444	Bacteria	4755
59	Ga0070694_100079916	3300005444	Bacteria	2271
60	Ga0070678_100117310	3300005456	Bacteria	2093
61	Ga0070662_100142625	3300005457	Bacteria	1858
62	Ga0070681_10132464	3300005458	Bacteria	2425
63	Ga0068867_100286111	3300005459	Bacteria	1353
64	Ga0070707_100058172	3300005468	Bacteria	3708
65	Ga0070707_100058667	3300005468	Bacteria	3691
66	Ga0070698_100078452	3300005471	Bacteria	3301
67	Ga0070699_100014189	3300005518	Bacteria	6855
68	Ga0070699_100024369	3300005518	Bacteria	5215
69	Ga0070699_100135782	3300005518	Bacteria	2170
70	Ga0070684_100001901	3300005535	Bacteria	15296
71	Ga0070684_100157843	3300005535	Bacteria	2057
72	Ga0070672_100036232	3300005543	Bacteria	3757
73	Ga0070686_100000920	3300005544	Bacteria	16994
74	Ga0070695_100002109	3300005545	Bacteria	11375
75	Ga0070695_100017200	3300005545	Bacteria	4384
76	Ga0070696_100031140	3300005546	Bacteria	3655
77	Ga0070693_100010279	3300005547	Bacteria	4685
78	Ga0070693_100015290	3300005547	Bacteria	3950
79	Ga0070693_100049004	3300005547	Bacteria	2408
80	Ga0070665_100003444	3300005548	Bacteria	16875
81	Ga0070665_100004736	3300005548	Bacteria	14161
82	Ga0070704_100002682	3300005549	Bacteria	10057
83	Ga0070704_100006254	3300005549	Bacteria	7005
84	Ga0068855_100021719	3300005563	Bacteria	7698
85	Ga0068855_100043268	3300005563	Bacteria	5335
86	Ga0070664_100038741	3300005564	Bacteria	4014
87	Ga0070664_100041340	3300005564	Bacteria	3890
88	Ga0070664_100107614	3300005564	Bacteria	2431
89	Ga0068857_100036724	3300005577	Bacteria	4341
90	Ga0068856_100124566	3300005614	Bacteria	2580
91	Ga0070702_100021973	3300005615	Bacteria	3366
92	Ga0068859_100000668	3300005617	Bacteria	34291
93	Ga0068859_100033269	3300005617	Bacteria	5177
94	Ga0068859_100108430	3300005617	Bacteria	2838
95	Ga0068859_100240928	3300005617	Bacteria	1898
96	Ga0068861_100010682	3300005719	Bacteria	6378
97	Ga0068861_100029713	3300005719	Bacteria	4000
98	Ga0068861_100194129	3300005719	Bacteria	1700
99	Ga0068863_100014096	3300005841	Bacteria	7700
100	Ga0068863_100268535	3300005841	Bacteria	1651
101	Ga0068858_100035150	3300005842	Bacteria	4648
102	Ga0068858_100252109	3300005842	Unclassified	1677
103	Ga0068862_100009293	3300005844	Bacteria	8137
104	Ga0068862_100023670	3300005844	Bacteria	5147
105	Ga0068862_100031911	3300005844	Bacteria	4450
106	Ga0068862_100047151	3300005844	Bacteria	3677
107	Ga0068862_100064361	3300005844	Bacteria	3156
108	Ga0081539_10004337	3300005985	Bacteria	15819
109	Ga0081539_10005197	3300005985	Bacteria	13506
110	Ga0081539_10007024	3300005985	Bacteria	10442
111	Ga0070717_10047863	3300006028	Bacteria	3505
112	Ga0075365_10028228	3300006038	Bacteria	3578
113	Ga0075365_10108666	3300006038	Bacteria	1904
114	Ga0075364_10004040	3300006051	Bacteria	8424
115	Ga0075362_10000899	3300006177	Bacteria	9022
116	Ga0075366_10041788	3300006195	Bacteria	2714
117	Ga0075366_10047755	3300006195	Bacteria	2538
118	Ga0097621_100000256	3300006237	Bacteria	35916
119	Ga0097621_100115296	3300006237	Bacteria	2274
120	Ga0075370_10004835	3300006353	Bacteria	6603
121	Ga0068871_100007588	3300006358	Bacteria	7755
122	Ga0068871_100085883	3300006358	Bacteria	2614
123	Ga0075428_100000769	3300006844	Bacteria	33377
124	Ga0075428_100018718	3300006844	Bacteria	7656
125	Ga0075428_100127659	3300006844	Bacteria	2767
126	Ga0075430_100003614	3300006846	Bacteria	12972
127	Ga0075430_100082008	3300006846	Bacteria	2702
128	Ga0075431_100013806	3300006847	Bacteria	8157
129	Ga0075431_100064795	3300006847	Bacteria	3773
130	Ga0075431_100124076	3300006847	Bacteria	2664
131	Ga0075433_10000693	3300006852	Bacteria	22964
132	Ga0075434_100000085	3300006871	Bacteria	50753
133	Ga0075434_100001816	3300006871	Bacteria	18436
134	Ga0075434_100002353	3300006871	Bacteria	16555
135	Ga0075434_100032983	3300006871	Bacteria	5108
136	Ga0075434_100057462	3300006871	Bacteria	3867
137	Ga0075434_100125005	3300006871	Bacteria	2590
138	Ga0075434_100132367	3300006871	Bacteria	2513
139	Ga0075429_100016903	3300006880	Bacteria	6313
140	Ga0075429_100158919	3300006880	Bacteria	1979
141	Ga0068865_100111240	3300006881	Bacteria	2021
142	Ga0075436_100000505	3300006914	Bacteria	25226
143	Ga0075436_100061947	3300006914	Bacteria	2585
144	Ga0097620_100000668	3300006931	Bacteria	34291
145	Ga0097620_100033269	3300006931	Bacteria	5177
146	Ga0097620_100108426	3300006931	Bacteria	2838
147	Ga0097620_100240930	3300006931	Bacteria	1898
148	Ga0075435_100000190	3300007076	Bacteria	36880
149	Ga0075435_100010951	3300007076	Bacteria	6647
150	Ga0075435_100020371	3300007076	Bacteria	5081
151	Ga0075435_100031731	3300007076	Bacteria	4166
152	Ga0075435_100150829	3300007076	Bacteria	1954
153	Ga0105240_10001297	3300009093	Bacteria	43202
154	Ga0105240_10077751	3300009093	Bacteria	4088
155	Ga0105240_10108665	3300009093	Bacteria	3360
156	Ga0105240_10110707	3300009093	Bacteria	3324
157	Ga0105240_10277976	3300009093	Bacteria	1925
158	Ga0105240_10293069	3300009093	Bacteria	1864
159	Ga0111539_10000002	3300009094	Bacteria	983359
160	Ga0111539_10000364	3300009094	Bacteria	55762
161	Ga0111539_10000638	3300009094	Bacteria	45252
162	Ga0111539_10000927	3300009094	Bacteria	38364
163	Ga0111539_10047023	3300009094	Bacteria	5159
164	Ga0111539_10047897	3300009094	Bacteria	5107
165	Ga0111539_10049980	3300009094	Bacteria	4983
166	Ga0111539_10061206	3300009094	Bacteria	4460
167	Ga0111539_10134317	3300009094	Bacteria	2897
168	Ga0111539_10231104	3300009094	Bacteria	2153
169	Ga0111539_10335793	3300009094	Bacteria	1759
170	Ga0105245_10000814	3300009098	Bacteria	28399
171	Ga0105245_10002725	3300009098	Bacteria	15906
172	Ga0105247_10006677	3300009101	Bacteria	7123
173	Ga0114129_10000241	3300009147	Bacteria	61333
174	Ga0114129_10005288	3300009147	Bacteria	18214
175	Ga0114129_10005633	3300009147	Bacteria	17719
176	Ga0114129_10006362	3300009147	Bacteria	16743
177	Ga0114129_10008040	3300009147	Bacteria	15029
178	Ga0114129_10014132	3300009147	Bacteria	11373
179	Ga0114129_10023247	3300009147	Bacteria	8793
180	Ga0114129_10031666	3300009147	Bacteria	7476
181	Ga0114129_10055987	3300009147	Bacteria	5526
182	Ga0114129_10071176	3300009147	Bacteria	4849
183	Ga0114129_10081265	3300009147	Bacteria	4505
184	Ga0114129_10095330	3300009147	Bacteria	4121
185	Ga0114129_10126945	3300009147	Bacteria	3507
186	Ga0114129_10163297	3300009147	Bacteria	3041
187	Ga0114129_10372354	3300009147	Bacteria	1887
188	Ga0114129_10434931	3300009147	Bacteria	1723
189	Ga0105241_10275317	3300009174	Bacteria	1435
190	Ga0105242_10003495	3300009176	Bacteria	12210
191	Ga0105248_10009425	3300009177	Bacteria	10749
192	Ga0105248_10061804	3300009177	Bacteria	4206
193	Ga0105248_10075816	3300009177	Bacteria	3780
194	Ga0105248_10116919	3300009177	Bacteria	3007
195	Ga0105248_10225591	3300009177	Bacteria	2109
196	Ga0105237_10033225	3300009545	Bacteria	5226
197	Ga0105237_10064133	3300009545	Bacteria	3671
198	Ga0105237_10120210	3300009545	Bacteria	2621
199	Ga0105238_10094097	3300009551	Bacteria	2984
200	Ga0105249_10009175	3300009553	Bacteria	8648
201	Ga0105249_10042040	3300009553	Bacteria	4156
202	Ga0105249_10065051	3300009553	Bacteria	3354
203	Ga0105249_10082464	3300009553	Bacteria	2992
204	Ga0105239_10083133	3300010375	Bacteria	3525
205	Ga0105239_10282693	3300010375	Bacteria	1868
206	Ga0157373_10047990	3300013100	Bacteria	3045
207	Ga0157373_10092758	3300013100	Bacteria	2127
208	Ga0157370_10057817	3300013104	Bacteria	3686
209	Ga0157370_10112489	3300013104	Bacteria	2545
210	Ga0157369_10013033	3300013105	Bacteria	9418
211	Ga0157374_10010950	3300013296	Bacteria	7830
212	Ga0157374_10015392	3300013296	Bacteria	6708
213	Ga0157374_10044864	3300013296	Bacteria	4088
214	Ga0157374_10233213	3300013296	Bacteria	1808
215	Ga0157378_10000409	3300013297	Bacteria	42352
216	Ga0157378_10079421	3300013297	Bacteria	2962
217	Ga0157378_10421272	3300013297	Bacteria	1320
218	Ga0163162_10037614	3300013306	Bacteria	4830
219	Ga0163162_10225551	3300013306	Bacteria	2003
220	Ga0157375_10086949	3300013308	Bacteria	3178
221	Ga0157375_10286812	3300013308	Bacteria	1809
222	Ga0157375_10438189	3300013308	Bacteria	1472
223	Ga0163163_10011918	3300014325	Bacteria	7909
224	Ga0163163_10016058	3300014325	Bacteria	6943
225	Ga0163163_10044254	3300014325	Bacteria	4367
226	Ga0163163_10045847	3300014325	Bacteria	4293
227	Ga0163163_10211755	3300014325	Bacteria	1987
228	Ga0157380_10077158	3300014326	Bacteria	2714
229	Ga0157380_10292876	3300014326	Unclassified	1495
230	Ga0157377_10027618	3300014745	Bacteria	3049
231	Ga0157379_10073623	3300014968	Bacteria	3058
232	Ga0157376_10004347	3300014969	Bacteria	9852
233	Ga0209233_1006643	3300025261	Bacteria	3710
234	Ga0207697_10034118	3300025315	Bacteria	2083
235	Ga0207692_10046128	3300025898	Bacteria	2184
236	Ga0207680_10018462	3300025903	Bacteria	3708
237	Ga0207680_10023911	3300025903	Bacteria	3345
238	Ga0207647_10028116	3300025904	Bacteria	3657
239	Ga0207699_10119945	3300025906	Bacteria	1699
240	Ga0207645_10006359	3300025907	Bacteria	8486
241	Ga0207695_10061918	3300025913	Bacteria	3866
242	Ga0207695_10212233	3300025913	Bacteria	1846
243	Ga0207663_10116718	3300025916	Unclassified	1820
244	Ga0207662_10081339	3300025918	Bacteria	1977
245	Ga0207649_10007602	3300025920	Bacteria	5893
246	Ga0207649_10045006	3300025920	Bacteria	2704
247	Ga0207646_10044549	3300025922	Bacteria	3982
248	Ga0207646_10116843	3300025922	Bacteria	2396
249	Ga0207646_10160944	3300025922	Bacteria	2026
250	Ga0207681_10029086	3300025923	Bacteria	3584
251	Ga0207681_10120338	3300025923	Unclassified	1924
252	Ga0207694_10261671	3300025924	Bacteria	1417
253	Ga0207650_10009349	3300025925	Bacteria	6699
254	Ga0207650_10020838	3300025925	Bacteria	4629
255	Ga0207650_10075238	3300025925	Bacteria	2548
256	Ga0207650_10157174	3300025925	Bacteria	1799
257	Ga0207659_10001387	3300025926	Bacteria	14459
258	Ga0207659_10014613	3300025926	Bacteria	5068
259	Ga0207659_10020360	3300025926	Bacteria	4384
260	Ga0207659_10224326	3300025926	Bacteria	1513
261	Ga0207700_10055014	3300025928	Bacteria	2990
262	Ga0207700_10081580	3300025928	Bacteria	2526
263	Ga0207644_10056618	3300025931	Bacteria	2829
264	Ga0207690_10052198	3300025932	Bacteria	2738
265	Ga0207706_10126431	3300025933	Bacteria	2248
266	Ga0207706_10200842	3300025933	Bacteria	1748
267	Ga0207670_10027657	3300025936	Bacteria	3589
268	Ga0207670_10040258	3300025936	Bacteria	3067
269	Ga0207670_10139760	3300025936	Bacteria	1785
270	Ga0207669_10133701	3300025937	Unclassified	1709
271	Ga0207691_10011664	3300025940	Bacteria	8438
272	Ga0207691_10030423	3300025940	Bacteria	5044
273	Ga0207691_10051520	3300025940	Bacteria	3763
274	Ga0207711_10119202	3300025941	Bacteria	2354
275	Ga0207711_10146651	3300025941	Bacteria	2127
276	Ga0207711_10227196	3300025941	Bacteria	1709
277	Ga0207689_10055623	3300025942	Bacteria	3257
278	Ga0207689_10073775	3300025942	Bacteria	2804
279	Ga0207661_10139616	3300025944	Bacteria	2084
280	Ga0207679_10026258	3300025945	Bacteria	4014
281	Ga0207667_10018897	3300025949	Bacteria	7709
282	Ga0207667_10052549	3300025949	Bacteria	4291
283	Ga0207651_10017080	3300025960	Bacteria	4275
284	Ga0207712_10292559	3300025961	Bacteria	1333
285	Ga0207658_10246265	3300025986	Bacteria	1517
286	Ga0207677_10075427	3300026023	Bacteria	2397
287	Ga0207703_10086317	3300026035	Bacteria	2628
288	Ga0207678_10001280	3300026067	Bacteria	23216
289	Ga0207708_10023605	3300026075	Bacteria	4650
290	Ga0207708_10034763	3300026075	Bacteria	3834
291	Ga0207702_10209626	3300026078	Bacteria	1811
292	Ga0207641_10013659	3300026088	Bacteria	6662
293	Ga0207641_10050072	3300026088	Bacteria	3533
294	Ga0207648_10005314	3300026089	Bacteria	12990
295	Ga0207648_10075042	3300026089	Bacteria	2948
296	Ga0207676_10211336	3300026095	Bacteria	1721
297	Ga0207674_10396217	3300026116	Unclassified	1334
298	Ga0207675_100001571	3300026118	Bacteria	22840
299	Ga0207675_100028823	3300026118	Bacteria	5172
300	Ga0207675_100120699	3300026118	Bacteria	2480
301	Ga0207675_100127810	3300026118	Bacteria	2408
302	Ga0207675_100287273	3300026118	Bacteria	1599
303	Ga0207683_10139644	3300026121	Bacteria	2183
304	Ga0207428_10000026	3300027907	Bacteria	255539
305	Ga0207428_10000719	3300027907	Bacteria	38178
306	Ga0207428_10005738	3300027907	Bacteria	11528
307	Ga0207428_10016890	3300027907	Bacteria	6272
308	Ga0207428_10022492	3300027907	Bacteria	5319
309	Ga0268266_10016827	3300028379	Bacteria	6249
310	Ga0268266_10055790	3300028379	Bacteria	3397
311	Ga0268265_10132124	3300028380	Bacteria	2076
312	Ga0268264_10284079	3300028381	Unclassified	1551
313	Ga0268264_10353820	3300028381	Bacteria	1399
314	Ga0307408_100032661	3300031548	Bacteria	3630
315	Ga0265313_10004346	3300031595	Bacteria	10960
316	Ga0307413_10027377	3300031824	Bacteria	3158
317	Ga0307412_10126549	3300031911	Unclassified	1849
318	Ga0307416_100024029	3300032002	Bacteria	4438
319	Ga0307416_100063056	3300032002	Bacteria	3033
320	Ga0373930_0001743	3300034816	Bacteria	3297
321	Ga0373950_0003131	3300034818	Bacteria	2339
322	Ga0373958_0001989	3300034819	Bacteria	2815
323	Ga0373959_0001934	3300034820	Bacteria	3304
324	Ga0373929_0000638	3300035085	Bacteria	6766
325	Ga0373940_0000771	3300035088	Bacteria	5247
326	Ga0373951_0006075	3300035091	Bacteria	2775
327	Ga0373932_0000187	3300035112	Bacteria	17867
328	Ga0373939_0001435	3300035114	Bacteria	5773
329	Ga0373941_0000856	3300035115	Bacteria	6270
330	Ga0373957_0054269	3300035120	Bacteria	1539
331	Ga0373942_0001787	3300035207	Bacteria	5454
332	Ga0373961_0000779	3300035241	Bacteria	10942
333	Ga0373931_0008273	3300035691	Bacteria	4927
334	Ga0373935_0072627	3300035692	Bacteria	2222
335	Ga0373927_0012049	3300035695	Bacteria	5753
336	Ga0439445_0040620	3300042004	Bacteria	1235
337	Ga0439435_0009482	3300042436	Bacteria	2285
338	Ga0453684_0052487	3300044712	Bacteria	5330
339	Ga0453684_0288606	3300044712	Bacteria	1869
340	Ga0453684_0289428	3300044712	Bacteria	1866
341	Ga0451576_0010777	3300045051	Bacteria	10464
342	Ga0451576_0220555	3300045051	Bacteria	1980
343	Ga0495580_0055941	3300046472	Bacteria	2779
344	Ga0495628_0306006	3300046516	Unclassified	1176
345	Ga0495649_0047400	3300046694	Bacteria	2337
346	Ga0495674_0018600	3300047319	Bacteria	6467
347	Ga0495687_027082	3300047443	Bacteria	2687
348	Ga0495602_0167303	3300048088	Unclassified	1710
349	Ga0496101_0190671	3300048904	Bacteria	1582
350	Ga0496102_0013174	3300048905	Bacteria	7155
351	Ga0496102_0075201	3300048905	Bacteria	3105
352	Ga0496106_0042195	3300048909	Bacteria	3421
353	Ga0496106_0075205	3300048909	Bacteria	2587
354	Ga0496110_0001983	3300048913	Bacteria	15224
355	Ga0496112_0004686	3300048915	Bacteria	11637
356	Ga0496112_0046474	3300048915	Bacteria	4258
357	Ga0496112_0198407	3300048915	Bacteria	1967
358	Ga0496112_0232145	3300048915	Bacteria	1799
359	Ga0496114_0015764	3300048917	Bacteria	6082
360	Ga0496115_0043285	3300048918	Bacteria	3590
361	Ga0496115_0123373	3300048918	Bacteria	2132
362	Ga0496126_0000029	3300048929	Bacteria	389370
363	Ga0501297_004027	3300049520	Bacteria	1486
364	Ga0501033_0081152	3300049570	Bacteria	2379
365	Ga0501034_0057283	3300049571	Bacteria	3918
366	Ga0501034_0132443	3300049571	Unclassified	2476
367	Ga0501036_0128342	3300049572	Bacteria	2141
368	Ga0501038_0210242	3300049574	Bacteria	1557
369	Ga0501042_0020248	3300049578	Bacteria	4629
370	Ga0501047_0063442	3300049581	Bacteria	3564
371	Ga0501047_0145390	3300049581	Bacteria	2248
372	Ga0501070_0049908	3300049586	Bacteria	3474
373	Ga0501070_0090986	3300049586	Bacteria	2525
374	Ga0501071_0003748	3300049587	Bacteria	9541
375	Ga0501071_0016605	3300049587	Bacteria	5065
376	Ga0501071_0107587	3300049587	Bacteria	2059
377	Ga0501072_0006958	3300049588	Bacteria	8585
378	Ga0501072_0095380	3300049588	Bacteria	2364
379	Ga0501074_0070236	3300049590	Bacteria	2518
380	Ga0501075_0001896	3300049591	Bacteria	13800
381	Ga0501075_0014221	3300049591	Bacteria	5702
382	Ga0501075_0039050	3300049591	Bacteria	3552
383	Ga0501076_0002357	3300049592	Bacteria	12930
384	Ga0501076_0326740	3300049592	Bacteria	1258
385	Ga0501081_0109097	3300049743	Bacteria	1963
386	Ga0501035_0033732	3300049822	Bacteria	4653
387	Ga0501035_0143568	3300049822	Unclassified	2074
388	Ga0501044_0001343	3300049823	Bacteria	28914
389	Ga0501044_0002453	3300049823	Bacteria	21140
390	Ga0501044_0099061	3300049823	Unclassified	2934
391	Ga0501045_0110242	3300049824	Unclassified	2041
392	Ga0501045_0135552	3300049824	Unclassified	1830
393	nmdc:mga03683_3406_c1	3300050489	Bacteria	5125
394	nmdc:mga00v17_17869_c1	3300050491	Bacteria	4022
395	nmdc:mga0k408_45030_c1	3300050493	Bacteria	2546
396	nmdc:mga0k408_4848_c1	3300050493	Bacteria	7138
397	nmdc:mga06z11_33070_c1	3300050494	Bacteria	2527
398	nmdc:mga05p37_11698_c1	3300050507	Bacteria	10457
399	nmdc:mga05p37_17111_c1	3300050507	Bacteria	8747
400	nmdc:mga05p37_17625_c1	3300050507	Bacteria	8619
401	nmdc:mga05p37_18987_c1	3300050507	Bacteria	8313
402	nmdc:mga05p37_191168_c1	3300050507	Bacteria	2485
403	nmdc:mga05p37_28194_c1	3300050507	Bacteria	6846
404	nmdc:mga05p37_3269_c1	3300050507	Bacteria	17504
405	nmdc:mga05p37_3817_c1	3300050507	Bacteria	17624
406	nmdc:mga05p37_4431_c1	3300050507	Bacteria	16408
407	nmdc:mga05p37_46710_c1	3300050507	Bacteria	5323
408	nmdc:mga05p37_49905_c1	3300050507	Bacteria	5147
409	nmdc:mga05p37_533_c2	3300050507	Bacteria	23842
410	nmdc:mga05p37_55832_c1	3300050507	Bacteria	4862
411	nmdc:mga05p37_59376_c1	3300050507	Bacteria	4710
412	nmdc:mga09592_166169_c1	3300050508	Bacteria	1907
413	nmdc:mga09592_3715_c1	3300050508	Bacteria	12300
414	nmdc:mga09592_68022_c1	3300050508	Bacteria	3021
415	nmdc:mga09592_87179_c1	3300050508	Bacteria	2664
416	nmdc:mga0qj67_21380_c1	3300050509	Bacteria	4964
417	nmdc:mga0qj67_73208_c1	3300050509	Bacteria	2736
418	nmdc:mga0qj67_78094_c1	3300050509	Bacteria	2649
419	nmdc:mga06r32_153744_c1	3300050510	Bacteria	2280
420	nmdc:mga06r32_186594_c1	3300050510	Bacteria	2061
421	nmdc:mga06r32_188273_c1	3300050510	Bacteria	2051
422	nmdc:mga06r32_258536_c1	3300050510	Bacteria	1729
423	nmdc:mga06r32_394454_c1	3300050510	Bacteria	1366
424	nmdc:mga08y16_104970_c1	3300050511	Bacteria	2942
425	nmdc:mga08y16_212535_c1	3300050511	Unclassified	2003
426	nmdc:mga08y16_2_c1	3300050511	Bacteria	983367
427	nmdc:mga08y16_32913_c1	3300050511	Bacteria	5449
428	nmdc:mga08y16_331249_c1	3300050511	Bacteria	1566
429	nmdc:mga08y16_33217_c1	3300050511	Bacteria	5420
430	nmdc:mga08y16_5963_c1	3300050511	Bacteria	12779
431	nmdc:mga08y16_63907_c1	3300050511	Bacteria	3844
432	nmdc:mga08y16_72562_c1	3300050511	Bacteria	3587
433	nmdc:mga08y16_9538_c1	3300050511	Bacteria	10187
434	nmdc:mga0n895_113562_c1	3300050512	Bacteria	2726
435	nmdc:mga0n895_131307_c1	3300050512	Bacteria	2530
436	nmdc:mga0n895_142653_c1	3300050512	Bacteria	2424
437	nmdc:mga0n895_160571_c1	3300050512	Bacteria	2279
438	nmdc:mga0n895_203909_c1	3300050512	Bacteria	2008
439	nmdc:mga0n895_495_c1	3300050512	Bacteria	26696
440	nmdc:mga0n895_49_c1	3300050512	Bacteria	73512
441	nmdc:mga0n895_51659_c1	3300050512	Bacteria	4033
442	nmdc:mga0rr50_11455_c1	3300050513	Bacteria	5679
443	nmdc:mga0rr50_133787_c1	3300050513	Bacteria	1988
444	nmdc:mga0rr50_138645_c1	3300050513	Bacteria	1955
445	nmdc:mga0rr50_154205_c1	3300050513	Bacteria	1859
446	nmdc:mga0rr50_16_c1	3300050513	Bacteria	175739
447	nmdc:mga0rr50_5104_c1	3300050513	Bacteria	7791
448	nmdc:mga0rr50_63524_c1	3300050513	Bacteria	2789
449	nmdc:mga0rr50_74478_c1	3300050513	Bacteria	2599
450	nmdc:mga08x19_166917_c1	3300050514	Bacteria	1497
451	nmdc:mga08x19_20683_c1	3300050514	Bacteria	4054
452	nmdc:mga08x19_4241_c1	3300050514	Bacteria	8493
453	nmdc:mga08x19_435_c1	3300050514	Bacteria	28614
454	nmdc:mga08x19_7924_c1	3300050514	Bacteria	6312
455	nmdc:mga0a205_103082_c1	3300050515	Bacteria	2390
456	nmdc:mga0a205_210224_c1	3300050515	Bacteria	1834
457	nmdc:mga0a205_223795_c1	3300050515	Bacteria	1431
458	nmdc:mga0a205_2470_c1	3300050515	Bacteria	16295
459	nmdc:mga0a205_33526_c1	3300050515	Bacteria	3974
460	nmdc:mga0a205_54_c1	3300050515	Bacteria	62054
461	nmdc:mga0a205_79096_c1	3300050515	Bacteria	3177
462	nmdc:mga0a205_96784_c1	3300050515	Bacteria	2850
463	Ga0495619_0024484	3300053085	Bacteria	3872
464	Ga0501084_0041463	3300054114	Bacteria	3851
465	Ga0590071_000483	3300059421	Bacteria	11637
466	Ga0590075_001045	3300059424	Bacteria	7142
467	Ga0590077_000078	3300059426	Bacteria	24810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049592	Ga0501076_0326740	Ga0501076_0326740_41_1141	366
2	3300025924	Ga0207694_10261671	Ga0207694_102616711	368
3	3300035088	Ga0373940_0000771	Ga0373940_0000771_4128_5234	368
4	3300025942	Ga0207689_10055623	Ga0207689_100556233	372
5	3300026075	Ga0207708_10034763	Ga0207708_100347632	372
6	3300048909	Ga0496106_0075205	Ga0496106_0075205_23_1141	372
7	3300042004	Ga0439445_0040620	Ga0439445_0040620_86_1207	373
8	3300048918	Ga0496115_0123373	Ga0496115_0123373_34_1155	373
9	3300005293	Ga0065715_10134347	Ga0065715_101343472	374
10	3300006846	Ga0075430_100082008	Ga0075430_1000820083	374
11	3300006880	Ga0075429_100158919	Ga0075429_1001589192	374
12	3300009147	Ga0114129_10434931	Ga0114129_104349312	374
13	3300034820	Ga0373959_0001934	Ga0373959_0001934_2145_3269	374
14	3300050508	nmdc:mga09592_87179_c1	nmdc:mga09592_87179_c1_858_1982	374
15	3300050509	nmdc:mga0qj67_78094_c1	nmdc:mga0qj67_78094_c1_466_1590	374
16	3300013100	Ga0157373_10047990	Ga0157373_100479902	375
17	3300013296	Ga0157374_10015392	Ga0157374_100153927	375
18	3300013308	Ga0157375_10286812	Ga0157375_102868123	375
19	3300031595	Ga0265313_10004346	Ga0265313_100043465	375
20	3300046516	Ga0495628_0306006	Ga0495628_0306006_23_1150	375
21	3300048915	Ga0496112_0046474	Ga0496112_0046474_615_1742	375
22	3300005290	Ga0065712_10119575	Ga0065712_101195752	376
23	3300007076	Ga0075435_100010951	Ga0075435_1000109516	376
24	3300009093	Ga0105240_10077751	Ga0105240_100777514	376
25	3300009093	Ga0105240_10108665	Ga0105240_101086652	376
26	3300009094	Ga0111539_10000638	Ga0111539_1000063835	376
27	3300009147	Ga0114129_10095330	Ga0114129_100953302	376
28	3300009147	Ga0114129_10163297	Ga0114129_101632973	376
29	3300009177	Ga0105248_10116919	Ga0105248_101169192	376
30	3300009551	Ga0105238_10094097	Ga0105238_100940972	376
31	3300013104	Ga0157370_10057817	Ga0157370_100578172	376
32	3300013104	Ga0157370_10112489	Ga0157370_101124893	376
33	3300013296	Ga0157374_10010950	Ga0157374_100109503	376
34	3300025949	Ga0207667_10052549	Ga0207667_100525494	376
35	3300026067	Ga0207678_10001280	Ga0207678_1000128016	376
36	3300048913	Ga0496110_0001983	Ga0496110_0001983_2881_4011	376
37	3300048915	Ga0496112_0004686	Ga0496112_0004686_1334_2464	376
38	3300049743	Ga0501081_0109097	Ga0501081_0109097_787_1917	376
39	3300050507	nmdc:mga05p37_17625_c1	nmdc:mga05p37_17625_c1_6109_7239	376
40	3300050507	nmdc:mga05p37_49905_c1	nmdc:mga05p37_49905_c1_44_1174	376
41	3300050513	nmdc:mga0rr50_133787_c1	nmdc:mga0rr50_133787_c1_173_1303	376
42	3300050513	nmdc:mga0rr50_138645_c1	nmdc:mga0rr50_138645_c1_215_1345	376
43	3300050515	nmdc:mga0a205_223795_c1	nmdc:mga0a205_223795_c1_273_1403	376
44	3300005356	Ga0070674_100005200	Ga0070674_1000052005	377
45	3300010375	Ga0105239_10083133	Ga0105239_100831333	377
46	3300046694	Ga0495649_0047400	Ga0495649_0047400_27_1160	377
47	3300047443	Ga0495687_027082	Ga0495687_027082_1322_2455	377
48	3300006871	Ga0075434_100001816	Ga0075434_1000018162	378
49	3300007076	Ga0075435_100020371	Ga0075435_1000203712	378
50	3300003320	rootH2_10091272	rootH2_100912722	384
51	3300007076	Ga0075435_100031731	Ga0075435_1000317313	387
52	3300048909	Ga0496106_0042195	Ga0496106_0042195_25_1188	387
53	3300050511	nmdc:mga08y16_33217_c1	nmdc:mga08y16_33217_c1_2231_3403	390
54	3300049574	Ga0501038_0210242	Ga0501038_0210242_77_1270	395
55	3300049587	Ga0501071_0016605	Ga0501071_0016605_87_1280	395
56	3300009093	Ga0105240_10001297	Ga0105240_1000129715	397
57	3300009093	Ga0105240_10110707	Ga0105240_101107072	398
58	3300009545	Ga0105237_10033225	Ga0105237_100332253	398
59	3300025913	Ga0207695_10061918	Ga0207695_100619182	398
60	3300044712	Ga0453684_0288606	Ga0453684_0288606_135_1343	398
61	3300044712	Ga0453684_0289428	Ga0453684_0289428_575_1786	398
62	3300050513	nmdc:mga0rr50_63524_c1	nmdc:mga0rr50_63524_c1_375_1571	398
63	3300009545	Ga0105237_10064133	Ga0105237_100641333	399
64	3300025941	Ga0207711_10119202	Ga0207711_101192022	399
65	3300045051	Ga0451576_0220555	Ga0451576_0220555_490_1689	399
66	3300049581	Ga0501047_0063442	Ga0501047_0063442_1836_3035	399
67	3300049586	Ga0501070_0049908	Ga0501070_0049908_1134_2333	399
68	3300049823	Ga0501044_0002453	Ga0501044_0002453_8829_10028	399
69	3300005547	Ga0070693_100010279	Ga0070693_1000102793	400
70	3300005617	Ga0068859_100108430	Ga0068859_1001084302	400
71	3300006931	Ga0097620_100108426	Ga0097620_1001084262	400
72	3300013297	Ga0157378_10421272	Ga0157378_104212721	400
73	3300025261	Ga0209233_1006643	Ga0209233_10066433	400
74	3300025916	Ga0207663_10116718	Ga0207663_101167182	400
75	3300044712	Ga0453684_0052487	Ga0453684_0052487_3939_5165	400
76	3300048929	Ga0496126_0000029	Ga0496126_0000029_301081_302313	400
77	3300005293	Ga0065715_10170788	Ga0065715_101707882	401
78	3300005330	Ga0070690_100060356	Ga0070690_1000603562	401
79	3300005355	Ga0070671_100050403	Ga0070671_1000504032	401
80	3300005364	Ga0070673_100067030	Ga0070673_1000670301	401
81	3300005444	Ga0070694_100015745	Ga0070694_1000157452	401
82	3300005545	Ga0070695_100017200	Ga0070695_1000172002	401
83	3300005549	Ga0070704_100002682	Ga0070704_1000026825	401
84	3300005617	Ga0068859_100000668	Ga0068859_10000066811	401
85	3300005719	Ga0068861_100194129	Ga0068861_1001941292	401
86	3300005841	Ga0068863_100268535	Ga0068863_1002685352	401
87	3300005844	Ga0068862_100064361	Ga0068862_1000643612	401
88	3300006881	Ga0068865_100111240	Ga0068865_1001112402	401
89	3300006931	Ga0097620_100000668	Ga0097620_10000066811	401
90	3300009553	Ga0105249_10082464	Ga0105249_100824642	401
91	3300025913	Ga0207695_10212233	Ga0207695_102122332	401
92	3300025922	Ga0207646_10160944	Ga0207646_101609442	401
93	3300025931	Ga0207644_10056618	Ga0207644_100566182	401
94	3300025933	Ga0207706_10126431	Ga0207706_101264312	401
95	3300025940	Ga0207691_10030423	Ga0207691_100304234	401
96	3300026023	Ga0207677_10075427	Ga0207677_100754272	401
97	3300026118	Ga0207675_100120699	Ga0207675_1001206992	401
98	3300026118	Ga0207675_100287273	Ga0207675_1002872732	401
99	3300027907	Ga0207428_10022492	Ga0207428_100224923	401
100	3300050511	nmdc:mga08y16_104970_c1	nmdc:mga08y16_104970_c1_682_1887	401
101	3300050512	nmdc:mga0n895_142653_c1	nmdc:mga0n895_142653_c1_177_1400	401
102	3300050514	nmdc:mga08x19_166917_c1	nmdc:mga08x19_166917_c1_39_1244	401
103	3300050515	nmdc:mga0a205_103082_c1	nmdc:mga0a205_103082_c1_41_1246	401
104	3300005331	Ga0070670_100026832	Ga0070670_1000268324	402
105	3300005336	Ga0070680_100109080	Ga0070680_1001090802	402
106	3300005340	Ga0070689_100041158	Ga0070689_1000411583	402
107	3300005365	Ga0070688_100045010	Ga0070688_1000450102	402
108	3300005365	Ga0070688_100069919	Ga0070688_1000699192	402
109	3300005436	Ga0070713_100102424	Ga0070713_1001024242	402
110	3300005518	Ga0070699_100024369	Ga0070699_1000243693	402
111	3300005518	Ga0070699_100135782	Ga0070699_1001357822	402
112	3300005544	Ga0070686_100000920	Ga0070686_1000009204	402
113	3300005985	Ga0081539_10007024	Ga0081539_100070243	402
114	3300006038	Ga0075365_10028228	Ga0075365_100282281	402
115	3300006038	Ga0075365_10108666	Ga0075365_101086661	402
116	3300006051	Ga0075364_10004040	Ga0075364_100040405	402
117	3300006177	Ga0075362_10000899	Ga0075362_100008993	402
118	3300006195	Ga0075366_10041788	Ga0075366_100417883	402
119	3300006353	Ga0075370_10004835	Ga0075370_100048352	402
120	3300009093	Ga0105240_10293069	Ga0105240_102930692	402
121	3300009094	Ga0111539_10000002	Ga0111539_10000002740	402
122	3300009094	Ga0111539_10047897	Ga0111539_100478973	402
123	3300025903	Ga0207680_10023911	Ga0207680_100239113	402
124	3300025928	Ga0207700_10055014	Ga0207700_100550142	402
125	3300025936	Ga0207670_10027657	Ga0207670_100276573	402
126	3300026121	Ga0207683_10139644	Ga0207683_101396442	402
127	3300027907	Ga0207428_10000026	Ga0207428_1000002687	402
128	3300032002	Ga0307416_100024029	Ga0307416_1000240293	402
129	3300034816	Ga0373930_0001743	Ga0373930_0001743_270_1478	402
130	3300034818	Ga0373950_0003131	Ga0373950_0003131_782_1990	402
131	3300034819	Ga0373958_0001989	Ga0373958_0001989_998_2206	402
132	3300035085	Ga0373929_0000638	Ga0373929_0000638_1625_2833	402
133	3300035091	Ga0373951_0006075	Ga0373951_0006075_889_2097	402
134	3300035112	Ga0373932_0000187	Ga0373932_0000187_11391_12599	402
135	3300035114	Ga0373939_0001435	Ga0373939_0001435_3568_4776	402
136	3300035115	Ga0373941_0000856	Ga0373941_0000856_4868_6076	402
137	3300035120	Ga0373957_0054269	Ga0373957_0054269_159_1367	402
138	3300035207	Ga0373942_0001787	Ga0373942_0001787_4099_5307	402
139	3300035241	Ga0373961_0000779	Ga0373961_0000779_5967_7175	402
140	3300035691	Ga0373931_0008273	Ga0373931_0008273_2041_3249	402
141	3300035692	Ga0373935_0072627	Ga0373935_0072627_807_2015	402
142	3300045051	Ga0451576_0010777	Ga0451576_0010777_4853_6061	402
143	3300048905	Ga0496102_0075201	Ga0496102_0075201_779_1987	402
144	3300050489	nmdc:mga03683_3406_c1	nmdc:mga03683_3406_c1_1361_2569	402
145	3300050491	nmdc:mga00v17_17869_c1	nmdc:mga00v17_17869_c1_1801_3009	402
146	3300050493	nmdc:mga0k408_4848_c1	nmdc:mga0k408_4848_c1_4156_5364	402
147	3300050494	nmdc:mga06z11_33070_c1	nmdc:mga06z11_33070_c1_1084_2292	402
148	3300050511	nmdc:mga08y16_2_c1	nmdc:mga08y16_2_c1_133262_134485	402
149	3300050511	nmdc:mga08y16_63907_c1	nmdc:mga08y16_63907_c1_1226_2443	402
150	3300050511	nmdc:mga08y16_72562_c1	nmdc:mga08y16_72562_c1_1880_3088	402
151	3300050512	nmdc:mga0n895_203909_c1	nmdc:mga0n895_203909_c1_541_1749	402
152	3300050512	nmdc:mga0n895_51659_c1	nmdc:mga0n895_51659_c1_2560_3768	402
153	3300050513	nmdc:mga0rr50_11455_c1	nmdc:mga0rr50_11455_c1_1393_2601	402
154	3300050514	nmdc:mga08x19_4241_c1	nmdc:mga08x19_4241_c1_1441_2649	402
155	3300050515	nmdc:mga0a205_210224_c1	nmdc:mga0a205_210224_c1_469_1677	402
156	3300005295	Ga0065707_10102298	Ga0065707_101022982	403
157	3300005338	Ga0068868_100258399	Ga0068868_1002583991	403
158	3300005440	Ga0070705_100087346	Ga0070705_1000873462	403
159	3300005458	Ga0070681_10132464	Ga0070681_101324642	403
160	3300005468	Ga0070707_100058172	Ga0070707_1000581722	403
161	3300005547	Ga0070693_100049004	Ga0070693_1000490041	403
162	3300005548	Ga0070665_100004736	Ga0070665_10000473611	403
163	3300005842	Ga0068858_100035150	Ga0068858_1000351503	403
164	3300006195	Ga0075366_10047755	Ga0075366_100477552	403
165	3300009093	Ga0105240_10277976	Ga0105240_102779762	403
166	3300009094	Ga0111539_10061206	Ga0111539_100612062	403
167	3300009098	Ga0105245_10002725	Ga0105245_100027257	403
168	3300009177	Ga0105248_10225591	Ga0105248_102255912	403
169	3300009545	Ga0105237_10120210	Ga0105237_101202102	403
170	3300009553	Ga0105249_10042040	Ga0105249_100420403	403
171	3300013306	Ga0163162_10037614	Ga0163162_100376143	403
172	3300013308	Ga0157375_10438189	Ga0157375_104381891	403
173	3300014745	Ga0157377_10027618	Ga0157377_100276181	403
174	3300025903	Ga0207680_10018462	Ga0207680_100184622	403
175	3300025906	Ga0207699_10119945	Ga0207699_101199452	403
176	3300025922	Ga0207646_10116843	Ga0207646_101168431	403
177	3300025926	Ga0207659_10001387	Ga0207659_100013879	403
178	3300025941	Ga0207711_10146651	Ga0207711_101466512	403
179	3300025942	Ga0207689_10073775	Ga0207689_100737752	403
180	3300025986	Ga0207658_10246265	Ga0207658_102462651	403
181	3300026035	Ga0207703_10086317	Ga0207703_100863172	403
182	3300026088	Ga0207641_10050072	Ga0207641_100500723	403
183	3300028379	Ga0268266_10016827	Ga0268266_100168276	403
184	3300046472	Ga0495580_0055941	Ga0495580_0055941_1086_2297	403
185	3300048915	Ga0496112_0198407	Ga0496112_0198407_276_1487	403
186	3300048917	Ga0496114_0015764	Ga0496114_0015764_4666_5976	403
187	3300049570	Ga0501033_0081152	Ga0501033_0081152_719_1930	403
188	3300049571	Ga0501034_0057283	Ga0501034_0057283_1775_2986	403
189	3300049581	Ga0501047_0145390	Ga0501047_0145390_175_1386	403
190	3300049586	Ga0501070_0090986	Ga0501070_0090986_969_2180	403
191	3300049822	Ga0501035_0033732	Ga0501035_0033732_2819_4030	403
192	3300049824	Ga0501045_0110242	Ga0501045_0110242_818_2029	403
193	3300050493	nmdc:mga0k408_45030_c1	nmdc:mga0k408_45030_c1_71_1282	403
194	3300050511	nmdc:mga08y16_212535_c1	nmdc:mga08y16_212535_c1_574_1785	403
195	3300005295	Ga0065707_10102434	Ga0065707_101024342	404
196	3300005366	Ga0070659_100267632	Ga0070659_1002676321	404
197	3300005437	Ga0070710_10024341	Ga0070710_100243412	404
198	3300005457	Ga0070662_100142625	Ga0070662_1001426252	404
199	3300005547	Ga0070693_100015290	Ga0070693_1000152903	404
200	3300005844	Ga0068862_100047151	Ga0068862_1000471512	404
201	3300006237	Ga0097621_100115296	Ga0097621_1001152962	404
202	3300006871	Ga0075434_100000085	Ga0075434_1000000859	404
203	3300006871	Ga0075434_100125005	Ga0075434_1001250052	404
204	3300006914	Ga0075436_100000505	Ga0075436_10000050511	404
205	3300007076	Ga0075435_100000190	Ga0075435_10000019026	404
206	3300007076	Ga0075435_100150829	Ga0075435_1001508291	404
207	3300009147	Ga0114129_10000241	Ga0114129_1000024127	404
208	3300013296	Ga0157374_10233213	Ga0157374_102332131	404
209	3300014325	Ga0163163_10011918	Ga0163163_100119182	404
210	3300014325	Ga0163163_10044254	Ga0163163_100442543	404
211	3300014325	Ga0163163_10211755	Ga0163163_102117551	404
212	3300014326	Ga0157380_10077158	Ga0157380_100771582	404
213	3300025898	Ga0207692_10046128	Ga0207692_100461282	404
214	3300025928	Ga0207700_10081580	Ga0207700_100815802	404
215	3300025933	Ga0207706_10200842	Ga0207706_102008422	404
216	3300028380	Ga0268265_10132124	Ga0268265_101321242	404
217	3300047319	Ga0495674_0018600	Ga0495674_0018600_1052_2302	404
218	3300048088	Ga0495602_0167303	Ga0495602_0167303_58_1308	404
219	3300048915	Ga0496112_0232145	Ga0496112_0232145_14_1228	404
220	3300049571	Ga0501034_0132443	Ga0501034_0132443_233_1471	404
221	3300049578	Ga0501042_0020248	Ga0501042_0020248_1151_2365	404
222	3300049587	Ga0501071_0003748	Ga0501071_0003748_8028_9242	404
223	3300049588	Ga0501072_0095380	Ga0501072_0095380_1084_2298	404
224	3300049591	Ga0501075_0014221	Ga0501075_0014221_2498_3712	404
225	3300049822	Ga0501035_0143568	Ga0501035_0143568_514_1752	404
226	3300049823	Ga0501044_0001343	Ga0501044_0001343_3038_4276	404
227	3300049823	Ga0501044_0099061	Ga0501044_0099061_1051_2289	404
228	3300050507	nmdc:mga05p37_533_c2	nmdc:mga05p37_533_c2_17508_18782	404
229	3300050510	nmdc:mga06r32_258536_c1	nmdc:mga06r32_258536_c1_496_1710	404
230	3300050510	nmdc:mga06r32_394454_c1	nmdc:mga06r32_394454_c1_119_1333	404
231	3300050512	nmdc:mga0n895_49_c1	nmdc:mga0n895_49_c1_48622_49836	404
232	3300050513	nmdc:mga0rr50_16_c1	nmdc:mga0rr50_16_c1_173344_174558	404
233	3300050514	nmdc:mga08x19_435_c1	nmdc:mga08x19_435_c1_4912_6126	404
234	3300053085	Ga0495619_0024484	Ga0495619_0024484_2060_3373	404
235	3300005290	Ga0065712_10004085	Ga0065712_100040851	405
236	3300005290	Ga0065712_10069720	Ga0065712_100697205	405
237	3300005290	Ga0065712_10085241	Ga0065712_100852412	405
238	3300005293	Ga0065715_10004954	Ga0065715_100049544	405
239	3300005293	Ga0065715_10006111	Ga0065715_100061114	405
240	3300005293	Ga0065715_10126440	Ga0065715_101264401	405
241	3300005295	Ga0065707_10086701	Ga0065707_100867012	405
242	3300005329	Ga0070683_100049551	Ga0070683_1000495512	405
243	3300005329	Ga0070683_100106636	Ga0070683_1001066362	405
244	3300005331	Ga0070670_100020481	Ga0070670_1000204815	405
245	3300005344	Ga0070661_100012730	Ga0070661_1000127305	405
246	3300005353	Ga0070669_100001018	Ga0070669_1000010188	405
247	3300005353	Ga0070669_100088743	Ga0070669_1000887432	405
248	3300005366	Ga0070659_100057109	Ga0070659_1000571094	405
249	3300005367	Ga0070667_100007773	Ga0070667_1000077737	405
250	3300005441	Ga0070700_100118570	Ga0070700_1001185702	405
251	3300005456	Ga0070678_100117310	Ga0070678_1001173102	405
252	3300005535	Ga0070684_100001901	Ga0070684_10000190110	405
253	3300005535	Ga0070684_100157843	Ga0070684_1001578432	405
254	3300005563	Ga0068855_100021719	Ga0068855_1000217195	405
255	3300005564	Ga0070664_100041340	Ga0070664_1000413402	405
256	3300005614	Ga0068856_100124566	Ga0068856_1001245662	405
257	3300005844	Ga0068862_100023670	Ga0068862_1000236702	405
258	3300005844	Ga0068862_100031911	Ga0068862_1000319111	405
259	3300006028	Ga0070717_10047863	Ga0070717_100478632	405
260	3300006844	Ga0075428_100000769	Ga0075428_10000076914	405
261	3300006847	Ga0075431_100013806	Ga0075431_1000138067	405
262	3300006871	Ga0075434_100057462	Ga0075434_1000574623	405
263	3300009094	Ga0111539_10134317	Ga0111539_101343173	405
264	3300009147	Ga0114129_10005288	Ga0114129_100052882	405
265	3300009147	Ga0114129_10006362	Ga0114129_1000636212	405
266	3300009147	Ga0114129_10023247	Ga0114129_100232475	405
267	3300009553	Ga0105249_10009175	Ga0105249_100091757	405
268	3300010375	Ga0105239_10282693	Ga0105239_102826932	405
269	3300013100	Ga0157373_10092758	Ga0157373_100927582	405
270	3300013105	Ga0157369_10013033	Ga0157369_100130333	405
271	3300014325	Ga0163163_10045847	Ga0163163_100458472	405
272	3300014326	Ga0157380_10292876	Ga0157380_102928762	405
273	3300025315	Ga0207697_10034118	Ga0207697_100341182	405
274	3300025920	Ga0207649_10007602	Ga0207649_100076025	405
275	3300025920	Ga0207649_10045006	Ga0207649_100450062	405
276	3300025923	Ga0207681_10029086	Ga0207681_100290862	405
277	3300025923	Ga0207681_10120338	Ga0207681_101203382	405
278	3300025925	Ga0207650_10157174	Ga0207650_101571741	405
279	3300025926	Ga0207659_10014613	Ga0207659_100146134	405
280	3300025932	Ga0207690_10052198	Ga0207690_100521982	405
281	3300025937	Ga0207669_10133701	Ga0207669_101337011	405
282	3300025944	Ga0207661_10139616	Ga0207661_101396162	405
283	3300025949	Ga0207667_10018897	Ga0207667_100188975	405
284	3300026078	Ga0207702_10209626	Ga0207702_102096262	405
285	3300026118	Ga0207675_100127810	Ga0207675_1001278102	405
286	3300035695	Ga0373927_0012049	Ga0373927_0012049_509_1726	405
287	3300048904	Ga0496101_0190671	Ga0496101_0190671_263_1480	405
288	3300048905	Ga0496102_0013174	Ga0496102_0013174_1471_2688	405
289	3300048918	Ga0496115_0043285	Ga0496115_0043285_1751_2968	405
290	3300049572	Ga0501036_0128342	Ga0501036_0128342_761_1993	405
291	3300049588	Ga0501072_0006958	Ga0501072_0006958_5633_6850	405
292	3300049590	Ga0501074_0070236	Ga0501074_0070236_365_1597	405
293	3300049591	Ga0501075_0001896	Ga0501075_0001896_8483_9715	405
294	3300049591	Ga0501075_0039050	Ga0501075_0039050_1934_3151	405
295	3300049592	Ga0501076_0002357	Ga0501076_0002357_8242_9459	405
296	3300049824	Ga0501045_0135552	Ga0501045_0135552_565_1797	405
297	3300050507	nmdc:mga05p37_28194_c1	nmdc:mga05p37_28194_c1_1404_2621	405
298	3300050507	nmdc:mga05p37_3817_c1	nmdc:mga05p37_3817_c1_1166_2398	405
299	3300050507	nmdc:mga05p37_46710_c1	nmdc:mga05p37_46710_c1_1523_2740	405
300	3300050508	nmdc:mga09592_68022_c1	nmdc:mga09592_68022_c1_1041_2258	405
301	3300050509	nmdc:mga0qj67_73208_c1	nmdc:mga0qj67_73208_c1_574_1791	405
302	3300050511	nmdc:mga08y16_32913_c1	nmdc:mga08y16_32913_c1_3106_4323	405
303	3300050511	nmdc:mga08y16_331249_c1	nmdc:mga08y16_331249_c1_195_1439	405
304	3300050512	nmdc:mga0n895_113562_c1	nmdc:mga0n895_113562_c1_1314_2546	405
305	3300050513	nmdc:mga0rr50_154205_c1	nmdc:mga0rr50_154205_c1_441_1658	405
306	3300054114	Ga0501084_0041463	Ga0501084_0041463_984_2201	405
307	3300005328	Ga0070676_10013585	Ga0070676_100135852	406
308	3300005438	Ga0070701_10001781	Ga0070701_100017814	406
309	3300005440	Ga0070705_100023959	Ga0070705_1000239591	406
310	3300005441	Ga0070700_100018692	Ga0070700_1000186922	406
311	3300005459	Ga0068867_100286111	Ga0068867_1002861111	406
312	3300005545	Ga0070695_100002109	Ga0070695_1000021098	406
313	3300005546	Ga0070696_100031140	Ga0070696_1000311403	406
314	3300005548	Ga0070665_100003444	Ga0070665_1000034444	406
315	3300005549	Ga0070704_100006254	Ga0070704_1000062542	406
316	3300005615	Ga0070702_100021973	Ga0070702_1000219733	406
317	3300005617	Ga0068859_100240928	Ga0068859_1002409282	406
318	3300005719	Ga0068861_100010682	Ga0068861_1000106822	406
319	3300005842	Ga0068858_100252109	Ga0068858_1002521092	406
320	3300006358	Ga0068871_100007588	Ga0068871_1000075885	406
321	3300006847	Ga0075431_100124076	Ga0075431_1001240762	406
322	3300006852	Ga0075433_10000693	Ga0075433_1000069315	406
323	3300006931	Ga0097620_100240930	Ga0097620_1002409302	406
324	3300009094	Ga0111539_10000364	Ga0111539_1000036436	406
325	3300009094	Ga0111539_10049980	Ga0111539_100499802	406
326	3300009094	Ga0111539_10231104	Ga0111539_102311042	406
327	3300009094	Ga0111539_10335793	Ga0111539_103357931	406
328	3300009101	Ga0105247_10006677	Ga0105247_100066777	406
329	3300009147	Ga0114129_10071176	Ga0114129_100711764	406
330	3300009147	Ga0114129_10081265	Ga0114129_100812652	406
331	3300009176	Ga0105242_10003495	Ga0105242_100034957	406
332	3300009177	Ga0105248_10009425	Ga0105248_100094253	406
333	3300009177	Ga0105248_10061804	Ga0105248_100618043	406
334	3300009553	Ga0105249_10065051	Ga0105249_100650513	406
335	3300014325	Ga0163163_10016058	Ga0163163_100160586	406
336	3300014969	Ga0157376_10004347	Ga0157376_100043476	406
337	3300025904	Ga0207647_10028116	Ga0207647_100281163	406
338	3300025907	Ga0207645_10006359	Ga0207645_100063596	406
339	3300025925	Ga0207650_10020838	Ga0207650_100208383	406
340	3300025941	Ga0207711_10227196	Ga0207711_102271962	406
341	3300025961	Ga0207712_10292559	Ga0207712_102925591	406
342	3300026075	Ga0207708_10023605	Ga0207708_100236054	406
343	3300026089	Ga0207648_10005314	Ga0207648_1000531414	406
344	3300026118	Ga0207675_100001571	Ga0207675_1000015713	406
345	3300027907	Ga0207428_10005738	Ga0207428_100057384	406
346	3300027907	Ga0207428_10016890	Ga0207428_100168904	406
347	3300028379	Ga0268266_10055790	Ga0268266_100557902	406
348	3300042436	Ga0439435_0009482	Ga0439435_0009482_883_2103	406
349	3300049587	Ga0501071_0107587	Ga0501071_0107587_108_1355	406
350	3300050507	nmdc:mga05p37_17111_c1	nmdc:mga05p37_17111_c1_1356_2576	406
351	3300050507	nmdc:mga05p37_55832_c1	nmdc:mga05p37_55832_c1_1513_2733	406
352	3300050510	nmdc:mga06r32_153744_c1	nmdc:mga06r32_153744_c1_351_1571	406
353	3300050510	nmdc:mga06r32_188273_c1	nmdc:mga06r32_188273_c1_269_1519	406
354	3300050511	nmdc:mga08y16_5963_c1	nmdc:mga08y16_5963_c1_10827_12050	406
355	3300050515	nmdc:mga0a205_2470_c1	nmdc:mga0a205_2470_c1_987_2207	406
356	3300003203	JGI25406J46586_10004452	JGI25406J46586_100044526	407
357	3300005289	Ga0065704_10097865	Ga0065704_100978651	407
358	3300005293	Ga0065715_10008144	Ga0065715_100081442	407
359	3300005295	Ga0065707_10105347	Ga0065707_101053472	407
360	3300005330	Ga0070690_100004703	Ga0070690_1000047034	407
361	3300005331	Ga0070670_100006651	Ga0070670_1000066515	407
362	3300005340	Ga0070689_100038807	Ga0070689_1000388072	407
363	3300005354	Ga0070675_100001252	Ga0070675_10000125212	407
364	3300005354	Ga0070675_100013676	Ga0070675_1000136761	407
365	3300005364	Ga0070673_100050738	Ga0070673_1000507383	407
366	3300005438	Ga0070701_10059699	Ga0070701_100596991	407
367	3300005468	Ga0070707_100058667	Ga0070707_1000586673	407
368	3300005518	Ga0070699_100014189	Ga0070699_1000141896	407
369	3300005543	Ga0070672_100036232	Ga0070672_1000362322	407
370	3300005563	Ga0068855_100043268	Ga0068855_1000432682	407
371	3300005564	Ga0070664_100107614	Ga0070664_1001076142	407
372	3300005617	Ga0068859_100033269	Ga0068859_1000332694	407
373	3300005985	Ga0081539_10004337	Ga0081539_100043379	407
374	3300005985	Ga0081539_10005197	Ga0081539_100051975	407
375	3300006844	Ga0075428_100018718	Ga0075428_1000187184	407
376	3300006844	Ga0075428_100127659	Ga0075428_1001276592	407
377	3300006846	Ga0075430_100003614	Ga0075430_1000036142	407
378	3300006847	Ga0075431_100064795	Ga0075431_1000647953	407
379	3300006871	Ga0075434_100032983	Ga0075434_1000329832	407
380	3300006871	Ga0075434_100132367	Ga0075434_1001323672	407
381	3300006880	Ga0075429_100016903	Ga0075429_1000169033	407
382	3300006914	Ga0075436_100061947	Ga0075436_1000619472	407
383	3300006931	Ga0097620_100033269	Ga0097620_1000332694	407
384	3300009094	Ga0111539_10000927	Ga0111539_1000092711	407
385	3300009094	Ga0111539_10047023	Ga0111539_100470234	407
386	3300009147	Ga0114129_10005633	Ga0114129_100056333	407
387	3300009147	Ga0114129_10008040	Ga0114129_1000804011	407
388	3300009147	Ga0114129_10014132	Ga0114129_100141327	407
389	3300009147	Ga0114129_10126945	Ga0114129_101269452	407
390	3300009147	Ga0114129_10372354	Ga0114129_103723542	407
391	3300025918	Ga0207662_10081339	Ga0207662_100813392	407
392	3300025922	Ga0207646_10044549	Ga0207646_100445492	407
393	3300025925	Ga0207650_10075238	Ga0207650_100752382	407
394	3300025926	Ga0207659_10020360	Ga0207659_100203604	407
395	3300025926	Ga0207659_10224326	Ga0207659_102243262	407
396	3300025936	Ga0207670_10040258	Ga0207670_100402582	407
397	3300025940	Ga0207691_10051520	Ga0207691_100515203	407
398	3300025960	Ga0207651_10017080	Ga0207651_100170804	407
399	3300026095	Ga0207676_10211336	Ga0207676_102113362	407
400	3300027907	Ga0207428_10000719	Ga0207428_1000071921	407
401	3300049520	Ga0501297_004027	Ga0501297_004027_28_1251	407
402	3300050507	nmdc:mga05p37_18987_c1	nmdc:mga05p37_18987_c1_4024_5274	407
403	3300050507	nmdc:mga05p37_191168_c1	nmdc:mga05p37_191168_c1_234_1460	407
404	3300050507	nmdc:mga05p37_3269_c1	nmdc:mga05p37_3269_c1_14825_16051	407
405	3300050507	nmdc:mga05p37_4431_c1	nmdc:mga05p37_4431_c1_11474_12700	407
406	3300050508	nmdc:mga09592_3715_c1	nmdc:mga09592_3715_c1_3620_4846	407
407	3300050509	nmdc:mga0qj67_21380_c1	nmdc:mga0qj67_21380_c1_2840_4066	407
408	3300050510	nmdc:mga06r32_186594_c1	nmdc:mga06r32_186594_c1_46_1272	407
409	3300050511	nmdc:mga08y16_9538_c1	nmdc:mga08y16_9538_c1_8249_9475	407
410	3300050512	nmdc:mga0n895_131307_c1	nmdc:mga0n895_131307_c1_56_1279	407
411	3300050512	nmdc:mga0n895_160571_c1	nmdc:mga0n895_160571_c1_471_1721	407
412	3300050513	nmdc:mga0rr50_5104_c1	nmdc:mga0rr50_5104_c1_3121_4344	407
413	3300050513	nmdc:mga0rr50_74478_c1	nmdc:mga0rr50_74478_c1_372_1598	407
414	3300050514	nmdc:mga08x19_20683_c1	nmdc:mga08x19_20683_c1_2155_3378	407
415	3300050515	nmdc:mga0a205_54_c1	nmdc:mga0a205_54_c1_59323_60549	407
416	3300050515	nmdc:mga0a205_79096_c1	nmdc:mga0a205_79096_c1_1605_2828	407
417	3300005355	Ga0070671_100025047	Ga0070671_1000250473	408
418	3300005444	Ga0070694_100079916	Ga0070694_1000799162	408
419	3300005471	Ga0070698_100078452	Ga0070698_1000784522	408
420	3300005841	Ga0068863_100014096	Ga0068863_1000140963	408
421	3300006871	Ga0075434_100002353	Ga0075434_1000023535	408
422	3300009147	Ga0114129_10031666	Ga0114129_100316663	408
423	3300009147	Ga0114129_10055987	Ga0114129_100559872	408
424	3300009177	Ga0105248_10075816	Ga0105248_100758163	408
425	3300013297	Ga0157378_10079421	Ga0157378_100794213	408
426	3300013308	Ga0157375_10086949	Ga0157375_100869492	408
427	3300014968	Ga0157379_10073623	Ga0157379_100736233	408
428	3300025936	Ga0207670_10139760	Ga0207670_101397602	408
429	3300025940	Ga0207691_10011664	Ga0207691_100116645	408
430	3300026088	Ga0207641_10013659	Ga0207641_100136596	408
431	3300028381	Ga0268264_10284079	Ga0268264_102840791	408
432	3300050507	nmdc:mga05p37_11698_c1	nmdc:mga05p37_11698_c1_3494_4738	408
433	3300050507	nmdc:mga05p37_59376_c1	nmdc:mga05p37_59376_c1_988_2214	408
434	3300050508	nmdc:mga09592_166169_c1	nmdc:mga09592_166169_c1_255_1490	408
435	3300050512	nmdc:mga0n895_495_c1	nmdc:mga0n895_495_c1_4178_5425	408
436	3300050514	nmdc:mga08x19_7924_c1	nmdc:mga08x19_7924_c1_3604_4848	408
437	3300050515	nmdc:mga0a205_33526_c1	nmdc:mga0a205_33526_c1_1591_2838	408
438	3300002459	JGI24751J29686_10013630	JGI24751J29686_100136302	409
439	3300005331	Ga0070670_100001651	Ga0070670_10000165110	409
440	3300005335	Ga0070666_10037373	Ga0070666_100373732	409
441	3300005338	Ga0068868_100002690	Ga0068868_1000026904	409
442	3300005356	Ga0070674_100027033	Ga0070674_1000270332	409
443	3300005564	Ga0070664_100038741	Ga0070664_1000387413	409
444	3300005577	Ga0068857_100036724	Ga0068857_1000367244	409
445	3300005719	Ga0068861_100029713	Ga0068861_1000297132	409
446	3300005844	Ga0068862_100009293	Ga0068862_1000092933	409
447	3300006237	Ga0097621_100000256	Ga0097621_10000025631	409
448	3300006358	Ga0068871_100085883	Ga0068871_1000858832	409
449	3300009098	Ga0105245_10000814	Ga0105245_1000081410	409
450	3300009174	Ga0105241_10275317	Ga0105241_102753172	409
451	3300013296	Ga0157374_10044864	Ga0157374_100448643	409
452	3300013297	Ga0157378_10000409	Ga0157378_1000040914	409
453	3300013306	Ga0163162_10225551	Ga0163162_102255512	409
454	3300025925	Ga0207650_10009349	Ga0207650_100093498	409
455	3300025945	Ga0207679_10026258	Ga0207679_100262583	409
456	3300026089	Ga0207648_10075042	Ga0207648_100750422	409
457	3300026116	Ga0207674_10396217	Ga0207674_103962171	409
458	3300026118	Ga0207675_100028823	Ga0207675_1000288233	409
459	3300028381	Ga0268264_10353820	Ga0268264_103538202	409
460	3300031548	Ga0307408_100032661	Ga0307408_1000326612	409
461	3300031824	Ga0307413_10027377	Ga0307413_100273772	409
462	3300031911	Ga0307412_10126549	Ga0307412_101265491	409
463	3300032002	Ga0307416_100063056	Ga0307416_1000630562	409
464	3300050515	nmdc:mga0a205_96784_c1	nmdc:mga0a205_96784_c1_92_1333	409
465	3300059421	Ga0590071_000483	Ga0590071_000483_10367_11596	409
466	3300059424	Ga0590075_001045	Ga0590075_001045_1822_3051	409
467	3300059426	Ga0590077_000078	Ga0590077_000078_3894_5123	409

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1zx5-assembly1.cif.gz_A	the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus	0.8171	17	394
1zx5-assembly1.cif.gz_A	the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus	0.7948	17	394
2q1z-assembly1.cif.gz_B	crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr	0.7923	297	391
1qwr-assembly2.cif.gz_B	crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis	0.773	16	392
1qwr-assembly2.cif.gz_B	crystal structure analysis of the mannose 6-phosphate isomerase from bacillus subtilis	0.7663	16	392

ID	Description	Score	Start	End	Superfamily
1qwrB02	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.8005	285	392	2.60.120.10
af_O43014_313_412_2.60.110.10	Mainly Beta;Sandwich;Thaumatin;Thaumatin	0.7808	299	394	2.60.110.10
1zx5A01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.7802	17	234	2.60.120.10
1qwrB02	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.7761	285	392	2.60.120.10
af_Q4DN69_1_81_2.60.120.1030	Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain	0.7676	308	394	2.60.120.1030

ID	Description	Score	Start	End
AF-A0A7C6DDU5-F1-model_v4	Uncharacterized protein	1.003	323	392
AF-A0A3N5X380-F1-model_v4	Uncharacterized protein	0.9914	308	397
AF-X1AHP1-F1-model_v4	Mannose-6-phosphate isomerase	0.9896	180	395
AF-X1J9C6-F1-model_v4	Mannose-6-phosphate isomerase	0.9836	144	268
AF-A0A359IVP9-F1-model_v4	deleted	0.9832	320	401

Feature Viewer

pLDDT	pTM	Quality
93.05	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449838

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map