F449840

General Info

Members Datasets Scaffolds Average Seq Length
467 234 934 155

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_12475445|Ga0111539_124754451
Length 171
Sequence LALPGGAWQMRLSYGGGGMNWFDLLRGLHIIAVIAWMSGMMYLPRLYAYHTETAPPGSEFDAHFKVWEHKLLKIIINPSMALTWIFGVTLILFHVYGLKQGWGFVLQPWMLTKLAAVIFLSGWHGFLSGARRKLAAGERPKTAKFWRATNEIPFLVAIVAVLAVTLQFGRR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
219 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
220 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
221 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
224 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
230 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
231 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
232 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
233 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
234 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.85
Nodule 0
Rhizoplane 2.78
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_12475445 3300009094 Bacteria 602
2 JGI25157J39369_1007805 3300002741 Bacteria 1525
3 JGI25153J46596_10014806 3300003215 Bacteria 3220
4 Ga0055536_1001714 3300003781 Bacteria 12971
5 Ga0055530_10000313 3300003791 Bacteria 44170
6 Ga0055531_10002388 3300003794 Bacteria 12617
7 Ga0055531_10026512 3300003794 Bacteria 2065
8 Ga0065165_1005530 3300005262 Bacteria 7058
9 Ga0070658_10105748 3300005327 Bacteria 2328
10 Ga0070658_10139775 3300005327 Bacteria 2022
11 Ga0070658_10381247 3300005327 Bacteria 1210
12 Ga0070690_100651718 3300005330 Bacteria 804
13 Ga0070670_100000004 3300005331 Bacteria 392110
14 Ga0070670_100043221 3300005331 Bacteria 3874
15 Ga0070670_100231330 3300005331 Bacteria 1609
16 Ga0070666_10133656 3300005335 Bacteria 1725
17 Ga0070666_10236132 3300005335 Bacteria 1292
18 Ga0070680_100001568 3300005336 Bacteria 16671
19 Ga0070680_100102111 3300005336 Bacteria 2381
20 Ga0070680_100323833 3300005336 Bacteria 1308
21 Ga0070660_100012600 3300005339 Bacteria 6041
22 Ga0070660_100156816 3300005339 Bacteria 1832
23 Ga0070660_100275138 3300005339 Bacteria 1377
24 Ga0070691_10021619 3300005341 Bacteria 2977
25 Ga0070668_100000279 3300005347 Bacteria 33807
26 Ga0070668_100045250 3300005347 Bacteria 3377
27 Ga0070669_100011256 3300005353 Bacteria 6353
28 Ga0070669_100358976 3300005353 Bacteria 1184
29 Ga0070675_101214831 3300005354 Bacteria 694
30 Ga0070671_100130253 3300005355 Bacteria 2118
31 Ga0070673_100131547 3300005364 Bacteria 2100
32 Ga0070659_100000552 3300005366 Bacteria 27366
33 Ga0070659_100040691 3300005366 Bacteria 3632
34 Ga0070667_100000105 3300005367 Bacteria 106633
35 Ga0070667_100005898 3300005367 Bacteria 10200
36 Ga0070667_100045761 3300005367 Bacteria 3680
37 Ga0070663_100784299 3300005455 Bacteria 816
38 Ga0070678_100072173 3300005456 Bacteria 2587
39 Ga0070662_100045679 3300005457 Bacteria 3144
40 Ga0070662_101341124 3300005457 Bacteria 616
41 Ga0070681_10001804 3300005458 Bacteria 19261
42 Ga0070681_10092634 3300005458 Bacteria 2970
43 Ga0070681_10277303 3300005458 Bacteria 1587
44 Ga0070698_100711166 3300005471 Bacteria 947
45 Ga0070679_100009290 3300005530 Bacteria 9295
46 Ga0070679_100054846 3300005530 Bacteria 3969
47 Ga0070679_100376407 3300005530 Bacteria 1367
48 Ga0070679_100538477 3300005530 Bacteria 1111
49 Ga0068853_101192980 3300005539 Bacteria 735
50 Ga0070665_100000198 3300005548 Bacteria 105999
51 Ga0070665_100000721 3300005548 Bacteria 44003
52 Ga0070665_100000738 3300005548 Bacteria 43554
53 Ga0070665_100167751 3300005548 Bacteria 2197
54 Ga0068855_100048559 3300005563 Bacteria 5008
55 Ga0068855_100085768 3300005563 Bacteria 3643
56 Ga0068855_100124601 3300005563 Bacteria 2947
57 Ga0070664_100163052 3300005564 Bacteria 1973
58 Ga0070664_100225450 3300005564 Bacteria 1678
59 Ga0070664_100860804 3300005564 Bacteria 849
60 Ga0068856_100215591 3300005614 Bacteria 1935
61 Ga0068856_100348212 3300005614 Bacteria 1500
62 Ga0068852_100105664 3300005616 Bacteria 2551
63 Ga0068852_101075499 3300005616 Bacteria 824
64 Ga0068859_100004565 3300005617 Bacteria 14125
65 Ga0068859_100470059 3300005617 Bacteria 1353
66 Ga0068864_100000082 3300005618 Bacteria 101182
67 Ga0068864_100000106 3300005618 Bacteria 81202
68 Ga0068864_100011668 3300005618 Bacteria 7255
69 Ga0068864_100075311 3300005618 Bacteria 2947
70 Ga0068864_100442541 3300005618 Bacteria 1242
71 Ga0068864_101077025 3300005618 Bacteria 799
72 Ga0068866_10996198 3300005718 Bacteria 595
73 Ga0068861_100328145 3300005719 Bacteria 1335
74 Ga0068861_100396876 3300005719 Bacteria 1223
75 Ga0068861_100690741 3300005719 Bacteria 947
76 Ga0068863_100000175 3300005841 Bacteria 67772
77 Ga0068863_100000560 3300005841 Bacteria 37696
78 Ga0068863_100018797 3300005841 Bacteria 6613
79 Ga0068863_100297978 3300005841 Bacteria 1564
80 Ga0068863_100345122 3300005841 Bacteria 1449
81 Ga0068858_100000006 3300005842 Bacteria 256011
82 Ga0068858_100024412 3300005842 Bacteria 5633
83 Ga0068858_100028847 3300005842 Bacteria 5153
84 Ga0068858_101404756 3300005842 Bacteria 688
85 Ga0068858_101538369 3300005842 Bacteria 656
86 Ga0068860_100000077 3300005843 Bacteria 171297
87 Ga0068860_100247944 3300005843 Bacteria 1733
88 Ga0068860_100542201 3300005843 Bacteria 1165
89 Ga0068862_100000183 3300005844 Bacteria 68758
90 Ga0068862_100012627 3300005844 Bacteria 6992
91 Ga0068862_100425273 3300005844 Bacteria 1247
92 Ga0070717_10065492 3300006028 Bacteria 3021
93 Ga0070717_11050957 3300006028 Bacteria 742
94 Ga0075362_10119489 3300006177 Bacteria 1246
95 Ga0097621_100273210 3300006237 Bacteria 1486
96 Ga0075370_10184903 3300006353 Bacteria 1227
97 Ga0068865_100119946 3300006881 Bacteria 1954
98 Ga0068865_100576322 3300006881 Bacteria 948
99 Ga0068865_101776321 3300006881 Bacteria 557
100 Ga0097620_100004565 3300006931 Bacteria 14125
101 Ga0097620_100470032 3300006931 Bacteria 1353
102 Ga0105250_10275183 3300009092 Bacteria 724
103 Ga0105240_10003768 3300009093 Bacteria 23424
104 Ga0105240_10026151 3300009093 Bacteria 7658
105 Ga0105240_10122406 3300009093 Bacteria 3131
106 Ga0105240_10208911 3300009093 Bacteria 2283
107 Ga0105240_10402084 3300009093 Bacteria 1542
108 Ga0105240_10465817 3300009093 Bacteria 1411
109 Ga0105240_10536424 3300009093 Bacteria 1296
110 Ga0105240_10641127 3300009093 Unclassified 1165
111 Ga0105245_10231709 3300009098 Bacteria 1786
112 Ga0105245_10536308 3300009098 Bacteria 1191
113 Ga0105245_10878267 3300009098 Bacteria 938
114 Ga0105247_10111571 3300009101 Bacteria 1761
115 Ga0105247_10185814 3300009101 Bacteria 1389
116 Ga0114129_11327852 3300009147 Bacteria 890
117 Ga0105241_11262092 3300009174 Bacteria 702
118 Ga0105242_10481862 3300009176 Bacteria 1176
119 Ga0105248_10000789 3300009177 Bacteria 35531
120 Ga0105248_10002055 3300009177 Bacteria 22287
121 Ga0105248_10007947 3300009177 Bacteria 11659
122 Ga0105248_10030965 3300009177 Bacteria 5977
123 Ga0105248_10046035 3300009177 Bacteria 4890
124 Ga0105248_10068560 3300009177 Bacteria 3982
125 Ga0105248_10122925 3300009177 Bacteria 2928
126 Ga0105248_10624094 3300009177 Bacteria 1216
127 Ga0105248_10822928 3300009177 Bacteria 1048
128 Ga0105248_11783066 3300009177 Bacteria 698
129 Ga0105237_10304158 3300009545 Bacteria 1598
130 Ga0105237_10652996 3300009545 Bacteria 1058
131 Ga0105238_10013031 3300009551 Bacteria 8391
132 Ga0105238_10022337 3300009551 Bacteria 6450
133 Ga0105238_10125019 3300009551 Bacteria 2551
134 Ga0105238_10450080 3300009551 Unclassified 1285
135 Ga0105238_11033416 3300009551 Bacteria 843
136 Ga0105238_11490391 3300009551 Bacteria 705
137 Ga0105238_12504452 3300009551 Bacteria 552
138 Ga0105249_10000838 3300009553 Bacteria 27558
139 Ga0105249_10357626 3300009553 Bacteria 1481
140 Ga0105239_10388659 3300010375 Bacteria 1578
141 Ga0105239_10550311 3300010375 Bacteria 1314
142 Ga0105239_10710364 3300010375 Bacteria 1150
143 Ga0157370_10709270 3300013104 Bacteria 918
144 Ga0157369_11536075 3300013105 Bacteria 677
145 Ga0157374_11207228 3300013296 Bacteria 778
146 Ga0157374_11466586 3300013296 Bacteria 705
147 Ga0157374_12073810 3300013296 Bacteria 595
148 Ga0163162_10442356 3300013306 Bacteria 1432
149 Ga0163162_10522519 3300013306 Bacteria 1316
150 Ga0157372_10296367 3300013307 Bacteria 1881
151 Ga0157375_10033763 3300013308 Bacteria 4866
152 Ga0163163_10000786 3300014325 Bacteria 26889
153 Ga0163163_10021371 3300014325 Bacteria 6106
154 Ga0163163_10221539 3300014325 Bacteria 1941
155 Ga0163163_10266874 3300014325 Bacteria 1763
156 Ga0163163_10546834 3300014325 Bacteria 1220
157 Ga0157379_10065912 3300014968 Bacteria 3238
158 Ga0157379_10127644 3300014968 Bacteria 2289
159 Ga0163161_11530376 3300017792 Bacteria 586
160 Ga0213876_10024356 3300021384 Bacteria 3195
161 Ga0209026_1000749 3300025250 Bacteria 18446
162 Ga0209026_1008352 3300025250 Bacteria 2172
163 Ga0209148_1012119 3300025254 Bacteria 1584
164 Ga0209148_1017609 3300025254 Bacteria 1211
165 Ga0209676_1000140 3300025292 Bacteria 176735
166 Ga0209676_1001880 3300025292 Bacteria 17151
167 Ga0209758_1001380 3300025297 Bacteria 28958
168 Ga0209050_1000053 3300025298 Bacteria 349521
169 Ga0209050_1006897 3300025298 Bacteria 6575
170 Ga0209050_1072098 3300025298 Bacteria 767
171 Ga0209257_1000292 3300025304 Bacteria 110440
172 Ga0209257_1000419 3300025304 Bacteria 81956
173 Ga0209257_1004976 3300025304 Bacteria 9723
174 Ga0207696_1116670 3300025711 Bacteria 721
175 Ga0207710_10071844 3300025900 Bacteria 1588
176 Ga0207680_10075222 3300025903 Bacteria 2106
177 Ga0207680_10266456 3300025903 Bacteria 1187
178 Ga0207680_11084553 3300025903 Bacteria 573
179 Ga0207705_10001218 3300025909 Bacteria 20813
180 Ga0207705_10111406 3300025909 Bacteria 2022
181 Ga0207707_10004282 3300025912 Bacteria 12629
182 Ga0207707_10100082 3300025912 Bacteria 2533
183 Ga0207707_10555373 3300025912 Bacteria 975
184 Ga0207695_10000269 3300025913 Bacteria 130183
185 Ga0207695_10001168 3300025913 Bacteria 45314
186 Ga0207695_10005132 3300025913 Bacteria 17533
187 Ga0207695_10014255 3300025913 Bacteria 9428
188 Ga0207695_10133643 3300025913 Bacteria 2436
189 Ga0207695_10310085 3300025913 Bacteria 1468
190 Ga0207660_10004245 3300025917 Bacteria 9341
191 Ga0207660_10125452 3300025917 Bacteria 1949
192 Ga0207657_10000235 3300025919 Bacteria 58394
193 Ga0207657_10097817 3300025919 Bacteria 2440
194 Ga0207657_10140389 3300025919 Bacteria 1974
195 Ga0207652_10315712 3300025921 Bacteria 1411
196 Ga0207652_10447337 3300025921 Bacteria 1165
197 Ga0207652_10560417 3300025921 Bacteria 1026
198 Ga0207681_10009523 3300025923 Bacteria 5938
199 Ga0207694_10137173 3300025924 Bacteria 1966
200 Ga0207694_10222997 3300025924 Bacteria 1538
201 Ga0207694_10361942 3300025924 Bacteria 1202
202 Ga0207694_10875930 3300025924 Bacteria 759
203 Ga0207694_11037727 3300025924 Bacteria 694
204 Ga0207650_10000033 3300025925 Bacteria 226809
205 Ga0207650_10081217 3300025925 Bacteria 2459
206 Ga0207650_10484877 3300025925 Bacteria 1032
207 Ga0207659_11031109 3300025926 Bacteria 708
208 Ga0207644_10001094 3300025931 Bacteria 17394
209 Ga0207644_10134286 3300025931 Bacteria 1898
210 Ga0207690_10000031 3300025932 Bacteria 154724
211 Ga0207690_10039787 3300025932 Bacteria 3069
212 Ga0207706_10348588 3300025933 Bacteria 1288
213 Ga0207704_10009776 3300025938 Bacteria 4644
214 Ga0207704_11152360 3300025938 Bacteria 660
215 Ga0207711_10000331 3300025941 Bacteria 50472
216 Ga0207711_10002318 3300025941 Bacteria 17056
217 Ga0207711_10003286 3300025941 Bacteria 14054
218 Ga0207711_10038726 3300025941 Bacteria 4054
219 Ga0207711_10092266 3300025941 Bacteria 2665
220 Ga0207711_11906270 3300025941 Bacteria 537
221 Ga0207679_10129569 3300025945 Bacteria 2022
222 Ga0207679_10591871 3300025945 Bacteria 999
223 Ga0207667_10031404 3300025949 Bacteria 5734
224 Ga0207667_10178019 3300025949 Bacteria 2184
225 Ga0207667_10192688 3300025949 Bacteria 2091
226 Ga0207667_10585131 3300025949 Bacteria 1126
227 Ga0207667_10622151 3300025949 Bacteria 1087
228 Ga0207651_10074487 3300025960 Bacteria 2418
229 Ga0207712_10000651 3300025961 Bacteria 27001
230 Ga0207712_10119106 3300025961 Bacteria 1994
231 Ga0207668_10000004 3300025972 Bacteria 201204
232 Ga0207668_10000217 3300025972 Bacteria 38890
233 Ga0207668_10002661 3300025972 Bacteria 10452
234 Ga0207658_10000229 3300025986 Bacteria 58984
235 Ga0207658_10069912 3300025986 Bacteria 2654
236 Ga0207658_10819297 3300025986 Bacteria 845
237 Ga0207703_10000027 3300026035 Bacteria 209608
238 Ga0207703_10005972 3300026035 Bacteria 9755
239 Ga0207703_10017248 3300026035 Bacteria 5634
240 Ga0207703_11268477 3300026035 Bacteria 708
241 Ga0207703_11375469 3300026035 Bacteria 679
242 Ga0207639_10003312 3300026041 Bacteria 10846
243 Ga0207639_10250717 3300026041 Bacteria 1544
244 Ga0207702_10060719 3300026078 Bacteria 3223
245 Ga0207702_10340167 3300026078 Bacteria 1433
246 Ga0207641_10000003 3300026088 Bacteria 496984
247 Ga0207641_10094761 3300026088 Bacteria 2618
248 Ga0207641_10110033 3300026088 Bacteria 2441
249 Ga0207641_10174338 3300026088 Bacteria 1965
250 Ga0207641_10481502 3300026088 Bacteria 1203
251 Ga0207676_10000068 3300026095 Bacteria 104705
252 Ga0207676_10001496 3300026095 Bacteria 17256
253 Ga0207676_10002933 3300026095 Bacteria 12151
254 Ga0207676_10466110 3300026095 Bacteria 1194
255 Ga0207676_10641711 3300026095 Bacteria 1024
256 Ga0207675_100391762 3300026118 Bacteria 1368
257 Ga0207675_100469350 3300026118 Bacteria 1249
258 Ga0207675_100499480 3300026118 Bacteria 1211
259 Ga0207683_10065003 3300026121 Bacteria 3216
260 Ga0209981_1001164 3300027378 Bacteria 3336
261 Ga0210000_1070396 3300027462 Bacteria 570
262 Ga0209983_1004293 3300027665 Bacteria 3004
263 Ga0268266_10000003 3300028379 Bacteria 1701703
264 Ga0268266_10001373 3300028379 Bacteria 29333
265 Ga0268266_10028560 3300028379 Bacteria 4740
266 Ga0268266_10220536 3300028379 Bacteria 1743
267 Ga0268265_10002911 3300028380 Bacteria 12568
268 Ga0268265_10007932 3300028380 Bacteria 7166
269 Ga0268265_10221457 3300028380 Bacteria 1656
270 Ga0268264_10000032 3300028381 Bacteria 408337
271 Ga0268264_10051190 3300028381 Bacteria 3440
272 Ga0268264_10518564 3300028381 Bacteria 1165
273 Ga0307517_10014862 3300028786 Bacteria 10407
274 Ga0307517_10119986 3300028786 Bacteria 1949
275 Ga0307517_10264678 3300028786 Bacteria 995
276 Ga0307517_10304025 3300028786 Bacteria 893
277 Ga0307511_10029350 3300030521 Bacteria 4969
278 Ga0265327_10001587 3300031251 Bacteria 27712
279 Ga0265327_10102327 3300031251 Bacteria 1380
280 Ga0307513_10004553 3300031456 Bacteria 18488
281 Ga0307513_10006957 3300031456 Bacteria 14706
282 Ga0307513_10029439 3300031456 Bacteria 6260
283 Ga0307513_10360929 3300031456 Bacteria 1198
284 Ga0307513_10541029 3300031456 Bacteria 878
285 Ga0307408_100417724 3300031548 Bacteria 1156
286 Ga0307408_101858808 3300031548 Bacteria 577
287 Ga0307508_10422376 3300031616 Bacteria 925
288 Ga0307413_10315338 3300031824 Bacteria 1192
289 Ga0307406_10002758 3300031901 Bacteria 9586
290 Ga0307412_10004397 3300031911 Bacteria 7855
291 Ga0307414_10003924 3300032004 Bacteria 8014
292 Ga0307414_10076012 3300032004 Bacteria 2439
293 Ga0307414_10194242 3300032004 Bacteria 1645
294 Ga0307414_10323038 3300032004 Bacteria 1314
295 Ga0307414_10348624 3300032004 Bacteria 1270
296 Ga0307414_10537700 3300032004 Bacteria 1039
297 Ga0307414_10569054 3300032004 Bacteria 1012
298 Ga0307414_10749334 3300032004 Bacteria 887
299 Ga0307414_10907076 3300032004 Bacteria 808
300 Ga0307414_10995454 3300032004 Bacteria 771
301 Ga0307510_10007759 3300033180 Bacteria 12800
302 Ga0373936_0001577 3300035113 Bacteria 8320
303 Ga0373943_0061988 3300035170 Bacteria 1871
304 Ga0373946_0037987 3300035171 Bacteria 1959
305 Ga0373927_0000111 3300035695 Bacteria 62031
306 Ga0373947_0111924 3300035725 Bacteria 1726
307 Ga0373925_0000209 3300037068 Bacteria 64086
308 Ga0395899_0076063 3300037312 Bacteria 2451
309 Ga0395899_0213569 3300037312 Bacteria 1339
310 Ga0395900_0000002 3300037418 Bacteria 671103
311 Ga0395900_0034183 3300037418 Bacteria 5234
312 Ga0395900_0295441 3300037418 Bacteria 1608
313 Ga0395900_0306497 3300037418 Bacteria 1572
314 Ga0395900_0506229 3300037418 Bacteria 1157
315 Ga0395898_0004909 3300037466 Bacteria 14517
316 Ga0395898_0077621 3300037466 Bacteria 3206
317 Ga0395898_0390190 3300037466 Bacteria 1327
318 Ga0395898_0567987 3300037466 Bacteria 1077
319 Ga0395905_0079152 3300037471 Bacteria 3080
320 Ga0395905_0243598 3300037471 Bacteria 1680
321 Ga0395905_0270159 3300037471 Bacteria 1586
322 Ga0395905_0353134 3300037471 Bacteria 1362
323 Ga0395905_0505015 3300037471 Bacteria 1109
324 Ga0395905_0540462 3300037471 Bacteria 1066
325 Ga0395901_0001134 3300038443 Bacteria 28242
326 Ga0395901_0161344 3300038443 Bacteria 2354
327 Ga0395901_0164792 3300038443 Bacteria 2327
328 Ga0395901_2138163 3300038443 Bacteria 504
329 Ga0436365_1511548 3300039437 Bacteria 5258
330 Ga0436365_1592411 3300039437 Bacteria 3550
331 Ga0436360_0729471 3300039438 Unclassified 625
332 Ga0436363_0504019 3300039450 Bacteria 614
333 Ga0439436_0185900 3300041404 Bacteria 592
334 Ga0466957_0540070 3300044842 Bacteria 812
335 Ga0466957_0859005 3300044842 Bacteria 647
336 Ga0466958_0299868 3300045836 Bacteria 1032
337 Ga0495629_0003470 3300046459 Bacteria 11921
338 Ga0495651_0955389 3300046462 Bacteria 522
339 Ga0495650_0178447 3300046471 Bacteria 748
340 Ga0495583_0127883 3300046506 Bacteria 1065
341 Ga0495583_0350430 3300046506 Bacteria 583
342 Ga0495606_0171304 3300046507 Bacteria 1259
343 Ga0495620_0144698 3300046515 Bacteria 928
344 Ga0495628_0043526 3300046516 Bacteria 3576
345 Ga0495637_0139655 3300046520 Bacteria 920
346 Ga0495643_0003478 3300046522 Bacteria 11494
347 Ga0495642_0011775 3300046528 Bacteria 3369
348 Ga0495642_0059506 3300046528 Bacteria 1583
349 Ga0495642_0181606 3300046528 Bacteria 916
350 Ga0495654_0120834 3300046530 Bacteria 1186
351 Ga0495609_0010178 3300046538 Bacteria 4522
352 Ga0495597_0002967 3300046542 Bacteria 10281
353 Ga0495597_0283611 3300046542 Bacteria 645
354 Ga0495645_0050610 3300046543 Bacteria 3024
355 Ga0495622_0022837 3300046557 Bacteria 2916
356 Ga0495668_0088164 3300046616 Bacteria 1701
357 Ga0495668_0098038 3300046616 Bacteria 1604
358 Ga0495668_0202631 3300046616 Bacteria 1086
359 Ga0495668_0291120 3300046616 Bacteria 895
360 Ga0495668_0372635 3300046616 Bacteria 784
361 Ga0495668_0405763 3300046616 Bacteria 749
362 Ga0495625_0118465 3300046660 Bacteria 1804
363 Ga0495625_0170325 3300046660 Bacteria 1454
364 Ga0495625_0226286 3300046660 Bacteria 1223
365 Ga0495625_0357684 3300046660 Bacteria 921
366 Ga0495669_0000007 3300046684 Bacteria 180797
367 Ga0495669_0000548 3300046684 Bacteria 16774
368 Ga0495669_0036597 3300046684 Bacteria 2170
369 Ga0495669_0153194 3300046684 Bacteria 1092
370 Ga0495669_0487733 3300046684 Bacteria 599
371 Ga0495613_0082959 3300046689 Bacteria 2328
372 Ga0495672_0037537 3300047320 Bacteria 2963
373 Ga0495672_0062125 3300047320 Bacteria 2150
374 Ga0495687_015620 3300047443 Bacteria 3854
375 Ga0495677_0037194 3300047445 Bacteria 1778
376 Ga0495686_0065212 3300047472 Bacteria 2252
377 Ga0495593_0163477 3300047673 Bacteria 1123
378 Ga0495602_0181480 3300048088 Bacteria 1623
379 Ga0495615_0140423 3300048090 Unclassified 712
380 Ga0496101_0060165 3300048904 Bacteria 2755
381 Ga0496102_0142593 3300048905 Bacteria 2247
382 Ga0496103_0072513 3300048906 Bacteria 2157
383 Ga0496103_0081887 3300048906 Bacteria 2031
384 Ga0496105_0575488 3300048908 Bacteria 877
385 Ga0496106_0152718 3300048909 Bacteria 1822
386 Ga0496107_0137869 3300048910 Bacteria 1803
387 Ga0496109_0039822 3300048912 Bacteria 4255
388 Ga0496112_0169684 3300048915 Bacteria 2147
389 Ga0496113_0682164 3300048916 Bacteria 821
390 Ga0496115_0004365 3300048918 Bacteria 10236
391 Ga0496115_0023070 3300048918 Bacteria 4828
392 Ga0496115_0065937 3300048918 Bacteria 2925
393 Ga0496116_0015854 3300048919 Bacteria 5932
394 Ga0496117_0023735 3300048920 Bacteria 4875
395 Ga0496118_0044580 3300048921 Bacteria 3471
396 Ga0496119_0034551 3300048922 Bacteria 3326
397 Ga0496120_0093964 3300048923 Bacteria 1597
398 Ga0496121_0000042 3300048924 Bacteria 342304
399 Ga0496124_0202214 3300048927 Bacteria 1510
400 Ga0496125_0012260 3300048928 Bacteria 8524
401 Ga0496125_0117740 3300048928 Bacteria 1904
402 Ga0495682_0111118 3300049460 Bacteria 982
403 Ga0501033_0024133 3300049570 Bacteria 4589
404 Ga0501034_0118875 3300049571 Bacteria 2630
405 Ga0501034_0715496 3300049571 Bacteria 899
406 Ga0501037_0300291 3300049573 Bacteria 1115
407 Ga0501047_0002245 3300049581 Bacteria 18488
408 Ga0501047_0129677 3300049581 Bacteria 2402
409 Ga0501067_0141742 3300049583 Bacteria 1338
410 Ga0501072_0117224 3300049588 Bacteria 2121
411 Ga0501225_0265294 3300049705 Bacteria 570
412 Ga0501080_0052349 3300049742 Bacteria 3800
413 Ga0501083_0018074 3300049744 Bacteria 4914
414 Ga0501044_0041180 3300049823 Bacteria 4809
415 Ga0501044_0171373 3300049823 Bacteria 2142
416 Ga0501044_1093634 3300049823 Bacteria 667
417 nmdc:mga03683_105287_c1 3300050489 Bacteria 1243
418 nmdc:mga0yw44_458934_c1 3300050492 Bacteria 863
419 Ga0500635_0000051 3300053080 Bacteria 76510
420 Ga0500578_0229607 3300053086 Bacteria 1125
421 Ga0500643_000934 3300053087 Bacteria 18294
422 Ga0500643_015742 3300053087 Bacteria 2584
423 Ga0500647_0052227 3300053091 Bacteria 1967
424 Ga0500583_0138009 3300053092 Bacteria 1211
425 Ga0500651_0005008 3300053093 Bacteria 7514
426 Ga0500651_0050856 3300053093 Bacteria 2599
427 Ga0500566_0032578 3300053094 Bacteria 3040
428 Ga0500566_0208089 3300053094 Bacteria 982
429 Ga0500555_007124 3300053103 Bacteria 3180
430 Ga0500556_0021354 3300053104 Bacteria 2086
431 Ga0500557_072596 3300053105 Bacteria 1130
432 Ga0500562_001555 3300053108 Bacteria 5684
433 Ga0500562_004227 3300053108 Bacteria 3630
434 Ga0500569_000114 3300053109 Bacteria 12490
435 Ga0500582_152911 3300053114 Bacteria 797
436 Ga0500595_000938 3300053119 Bacteria 16518
437 Ga0500595_038393 3300053119 Bacteria 1557
438 Ga0500595_149522 3300053119 Bacteria 653
439 Ga0500607_042477 3300053121 Bacteria 2455
440 Ga0500607_076445 3300053121 Bacteria 1717
441 Ga0500608_012667 3300053122 Bacteria 3705
442 Ga0500642_0130865 3300053130 Bacteria 1176
443 Ga0500559_0009054 3300053136 Bacteria 4326
444 Ga0500559_0010455 3300053136 Bacteria 3984
445 Ga0500590_023466 3300053148 Bacteria 3202
446 Ga0500616_0311211 3300053153 Bacteria 651
447 Ga0500620_022422 3300053155 Bacteria 1901
448 Ga0500624_051272 3300053157 Bacteria 768
449 Ga0500638_045211 3300053162 Bacteria 2137
450 Ga0500639_135051 3300053163 Bacteria 1163
451 Ga0500639_192668 3300053163 Bacteria 886
452 Ga0500636_0024617 3300053177 Bacteria 3560
453 Ga0500637_0013005 3300053178 Bacteria 4349
454 Ga0500625_046694 3300053729 Bacteria 2017
455 Ga0500645_000539 3300053730 Bacteria 25211
456 Ga0500645_014316 3300053730 Bacteria 2530
457 Ga0500596_006612 3300053735 Bacteria 1948
458 Ga0501084_0036511 3300054114 Bacteria 4104
459 Ga0501082_0030957 3300060353 Bacteria 4612
460 Ga0501082_0233534 3300060353 Bacteria 1600
461 2643884531 2643221574 Bacteria 2789653
462 2644087626 2643221614 Bacteria 4260023
463 2644344330 2643221661 Bacteria 4267604
464 2644366985 2643221666 Bacteria 4265935
465 2644549087 2643221699 Bacteria 5731501
466 2644552767 2643221699 Bacteria 5731501
467 2941488084 2941485952 Bacteria 3591484
468 Ga0111539_12475445
469 JGI25157J39369_1007805
470 JGI25153J46596_10014806
471 Ga0055536_1001714
472 Ga0055530_10000313
473 Ga0055531_10002388
474 Ga0055531_10026512
475 Ga0065165_1005530
476 Ga0070658_10105748
477 Ga0070658_10139775
478 Ga0070658_10381247
479 Ga0070690_100651718
480 Ga0070670_100000004
481 Ga0070670_100043221
482 Ga0070670_100231330
483 Ga0070666_10133656
484 Ga0070666_10236132
485 Ga0070680_100001568
486 Ga0070680_100102111
487 Ga0070680_100323833
488 Ga0070660_100012600
489 Ga0070660_100156816
490 Ga0070660_100275138
491 Ga0070691_10021619
492 Ga0070668_100000279
493 Ga0070668_100045250
494 Ga0070669_100011256
495 Ga0070669_100358976
496 Ga0070675_101214831
497 Ga0070671_100130253
498 Ga0070673_100131547
499 Ga0070659_100000552
500 Ga0070659_100040691
501 Ga0070667_100000105
502 Ga0070667_100005898
503 Ga0070667_100045761
504 Ga0070663_100784299
505 Ga0070678_100072173
506 Ga0070662_100045679
507 Ga0070662_101341124
508 Ga0070681_10001804
509 Ga0070681_10092634
510 Ga0070681_10277303
511 Ga0070698_100711166
512 Ga0070679_100009290
513 Ga0070679_100054846
514 Ga0070679_100376407
515 Ga0070679_100538477
516 Ga0068853_101192980
517 Ga0070665_100000198
518 Ga0070665_100000721
519 Ga0070665_100000738
520 Ga0070665_100167751
521 Ga0068855_100048559
522 Ga0068855_100085768
523 Ga0068855_100124601
524 Ga0070664_100163052
525 Ga0070664_100225450
526 Ga0070664_100860804
527 Ga0068856_100215591
528 Ga0068856_100348212
529 Ga0068852_100105664
530 Ga0068852_101075499
531 Ga0068859_100004565
532 Ga0068859_100470059
533 Ga0068864_100000082
534 Ga0068864_100000106
535 Ga0068864_100011668
536 Ga0068864_100075311
537 Ga0068864_100442541
538 Ga0068864_101077025
539 Ga0068866_10996198
540 Ga0068861_100328145
541 Ga0068861_100396876
542 Ga0068861_100690741
543 Ga0068863_100000175
544 Ga0068863_100000560
545 Ga0068863_100018797
546 Ga0068863_100297978
547 Ga0068863_100345122
548 Ga0068858_100000006
549 Ga0068858_100024412
550 Ga0068858_100028847
551 Ga0068858_101404756
552 Ga0068858_101538369
553 Ga0068860_100000077
554 Ga0068860_100247944
555 Ga0068860_100542201
556 Ga0068862_100000183
557 Ga0068862_100012627
558 Ga0068862_100425273
559 Ga0070717_10065492
560 Ga0070717_11050957
561 Ga0075362_10119489
562 Ga0097621_100273210
563 Ga0075370_10184903
564 Ga0068865_100119946
565 Ga0068865_100576322
566 Ga0068865_101776321
567 Ga0097620_100004565
568 Ga0097620_100470032
569 Ga0105250_10275183
570 Ga0105240_10003768
571 Ga0105240_10026151
572 Ga0105240_10122406
573 Ga0105240_10208911
574 Ga0105240_10402084
575 Ga0105240_10465817
576 Ga0105240_10536424
577 Ga0105240_10641127
578 Ga0105245_10231709
579 Ga0105245_10536308
580 Ga0105245_10878267
581 Ga0105247_10111571
582 Ga0105247_10185814
583 Ga0114129_11327852
584 Ga0105241_11262092
585 Ga0105242_10481862
586 Ga0105248_10000789
587 Ga0105248_10002055
588 Ga0105248_10007947
589 Ga0105248_10030965
590 Ga0105248_10046035
591 Ga0105248_10068560
592 Ga0105248_10122925
593 Ga0105248_10624094
594 Ga0105248_10822928
595 Ga0105248_11783066
596 Ga0105237_10304158
597 Ga0105237_10652996
598 Ga0105238_10013031
599 Ga0105238_10022337
600 Ga0105238_10125019
601 Ga0105238_10450080
602 Ga0105238_11033416
603 Ga0105238_11490391
604 Ga0105238_12504452
605 Ga0105249_10000838
606 Ga0105249_10357626
607 Ga0105239_10388659
608 Ga0105239_10550311
609 Ga0105239_10710364
610 Ga0157370_10709270
611 Ga0157369_11536075
612 Ga0157374_11207228
613 Ga0157374_11466586
614 Ga0157374_12073810
615 Ga0163162_10442356
616 Ga0163162_10522519
617 Ga0157372_10296367
618 Ga0157375_10033763
619 Ga0163163_10000786
620 Ga0163163_10021371
621 Ga0163163_10221539
622 Ga0163163_10266874
623 Ga0163163_10546834
624 Ga0157379_10065912
625 Ga0157379_10127644
626 Ga0163161_11530376
627 Ga0213876_10024356
628 Ga0209026_1000749
629 Ga0209026_1008352
630 Ga0209148_1012119
631 Ga0209148_1017609
632 Ga0209676_1000140
633 Ga0209676_1001880
634 Ga0209758_1001380
635 Ga0209050_1000053
636 Ga0209050_1006897
637 Ga0209050_1072098
638 Ga0209257_1000292
639 Ga0209257_1000419
640 Ga0209257_1004976
641 Ga0207696_1116670
642 Ga0207710_10071844
643 Ga0207680_10075222
644 Ga0207680_10266456
645 Ga0207680_11084553
646 Ga0207705_10001218
647 Ga0207705_10111406
648 Ga0207707_10004282
649 Ga0207707_10100082
650 Ga0207707_10555373
651 Ga0207695_10000269
652 Ga0207695_10001168
653 Ga0207695_10005132
654 Ga0207695_10014255
655 Ga0207695_10133643
656 Ga0207695_10310085
657 Ga0207660_10004245
658 Ga0207660_10125452
659 Ga0207657_10000235
660 Ga0207657_10097817
661 Ga0207657_10140389
662 Ga0207652_10315712
663 Ga0207652_10447337
664 Ga0207652_10560417
665 Ga0207681_10009523
666 Ga0207694_10137173
667 Ga0207694_10222997
668 Ga0207694_10361942
669 Ga0207694_10875930
670 Ga0207694_11037727
671 Ga0207650_10000033
672 Ga0207650_10081217
673 Ga0207650_10484877
674 Ga0207659_11031109
675 Ga0207644_10001094
676 Ga0207644_10134286
677 Ga0207690_10000031
678 Ga0207690_10039787
679 Ga0207706_10348588
680 Ga0207704_10009776
681 Ga0207704_11152360
682 Ga0207711_10000331
683 Ga0207711_10002318
684 Ga0207711_10003286
685 Ga0207711_10038726
686 Ga0207711_10092266
687 Ga0207711_11906270
688 Ga0207679_10129569
689 Ga0207679_10591871
690 Ga0207667_10031404
691 Ga0207667_10178019
692 Ga0207667_10192688
693 Ga0207667_10585131
694 Ga0207667_10622151
695 Ga0207651_10074487
696 Ga0207712_10000651
697 Ga0207712_10119106
698 Ga0207668_10000004
699 Ga0207668_10000217
700 Ga0207668_10002661
701 Ga0207658_10000229
702 Ga0207658_10069912
703 Ga0207658_10819297
704 Ga0207703_10000027
705 Ga0207703_10005972
706 Ga0207703_10017248
707 Ga0207703_11268477
708 Ga0207703_11375469
709 Ga0207639_10003312
710 Ga0207639_10250717
711 Ga0207702_10060719
712 Ga0207702_10340167
713 Ga0207641_10000003
714 Ga0207641_10094761
715 Ga0207641_10110033
716 Ga0207641_10174338
717 Ga0207641_10481502
718 Ga0207676_10000068
719 Ga0207676_10001496
720 Ga0207676_10002933
721 Ga0207676_10466110
722 Ga0207676_10641711
723 Ga0207675_100391762
724 Ga0207675_100469350
725 Ga0207675_100499480
726 Ga0207683_10065003
727 Ga0209981_1001164
728 Ga0210000_1070396
729 Ga0209983_1004293
730 Ga0268266_10000003
731 Ga0268266_10001373
732 Ga0268266_10028560
733 Ga0268266_10220536
734 Ga0268265_10002911
735 Ga0268265_10007932
736 Ga0268265_10221457
737 Ga0268264_10000032
738 Ga0268264_10051190
739 Ga0268264_10518564
740 Ga0307517_10014862
741 Ga0307517_10119986
742 Ga0307517_10264678
743 Ga0307517_10304025
744 Ga0307511_10029350
745 Ga0265327_10001587
746 Ga0265327_10102327
747 Ga0307513_10004553
748 Ga0307513_10006957
749 Ga0307513_10029439
750 Ga0307513_10360929
751 Ga0307513_10541029
752 Ga0307408_100417724
753 Ga0307408_101858808
754 Ga0307508_10422376
755 Ga0307413_10315338
756 Ga0307406_10002758
757 Ga0307412_10004397
758 Ga0307414_10003924
759 Ga0307414_10076012
760 Ga0307414_10194242
761 Ga0307414_10323038
762 Ga0307414_10348624
763 Ga0307414_10537700
764 Ga0307414_10569054
765 Ga0307414_10749334
766 Ga0307414_10907076
767 Ga0307414_10995454
768 Ga0307510_10007759
769 Ga0373936_0001577
770 Ga0373943_0061988
771 Ga0373946_0037987
772 Ga0373927_0000111
773 Ga0373947_0111924
774 Ga0373925_0000209
775 Ga0395899_0076063
776 Ga0395899_0213569
777 Ga0395900_0000002
778 Ga0395900_0034183
779 Ga0395900_0295441
780 Ga0395900_0306497
781 Ga0395900_0506229
782 Ga0395898_0004909
783 Ga0395898_0077621
784 Ga0395898_0390190
785 Ga0395898_0567987
786 Ga0395905_0079152
787 Ga0395905_0243598
788 Ga0395905_0270159
789 Ga0395905_0353134
790 Ga0395905_0505015
791 Ga0395905_0540462
792 Ga0395901_0001134
793 Ga0395901_0161344
794 Ga0395901_0164792
795 Ga0395901_2138163
796 Ga0436365_1511548
797 Ga0436365_1592411
798 Ga0436360_0729471
799 Ga0436363_0504019
800 Ga0439436_0185900
801 Ga0466957_0540070
802 Ga0466957_0859005
803 Ga0466958_0299868
804 Ga0495629_0003470
805 Ga0495651_0955389
806 Ga0495650_0178447
807 Ga0495583_0127883
808 Ga0495583_0350430
809 Ga0495606_0171304
810 Ga0495620_0144698
811 Ga0495628_0043526
812 Ga0495637_0139655
813 Ga0495643_0003478
814 Ga0495642_0011775
815 Ga0495642_0059506
816 Ga0495642_0181606
817 Ga0495654_0120834
818 Ga0495609_0010178
819 Ga0495597_0002967
820 Ga0495597_0283611
821 Ga0495645_0050610
822 Ga0495622_0022837
823 Ga0495668_0088164
824 Ga0495668_0098038
825 Ga0495668_0202631
826 Ga0495668_0291120
827 Ga0495668_0372635
828 Ga0495668_0405763
829 Ga0495625_0118465
830 Ga0495625_0170325
831 Ga0495625_0226286
832 Ga0495625_0357684
833 Ga0495669_0000007
834 Ga0495669_0000548
835 Ga0495669_0036597
836 Ga0495669_0153194
837 Ga0495669_0487733
838 Ga0495613_0082959
839 Ga0495672_0037537
840 Ga0495672_0062125
841 Ga0495687_015620
842 Ga0495677_0037194
843 Ga0495686_0065212
844 Ga0495593_0163477
845 Ga0495602_0181480
846 Ga0495615_0140423
847 Ga0496101_0060165
848 Ga0496102_0142593
849 Ga0496103_0072513
850 Ga0496103_0081887
851 Ga0496105_0575488
852 Ga0496106_0152718
853 Ga0496107_0137869
854 Ga0496109_0039822
855 Ga0496112_0169684
856 Ga0496113_0682164
857 Ga0496115_0004365
858 Ga0496115_0023070
859 Ga0496115_0065937
860 Ga0496116_0015854
861 Ga0496117_0023735
862 Ga0496118_0044580
863 Ga0496119_0034551
864 Ga0496120_0093964
865 Ga0496121_0000042
866 Ga0496124_0202214
867 Ga0496125_0012260
868 Ga0496125_0117740
869 Ga0495682_0111118
870 Ga0501033_0024133
871 Ga0501034_0118875
872 Ga0501034_0715496
873 Ga0501037_0300291
874 Ga0501047_0002245
875 Ga0501047_0129677
876 Ga0501067_0141742
877 Ga0501072_0117224
878 Ga0501225_0265294
879 Ga0501080_0052349
880 Ga0501083_0018074
881 Ga0501044_0041180
882 Ga0501044_0171373
883 Ga0501044_1093634
884 nmdc:mga03683_105287_c1
885 nmdc:mga0yw44_458934_c1
886 Ga0500635_0000051
887 Ga0500578_0229607
888 Ga0500643_000934
889 Ga0500643_015742
890 Ga0500647_0052227
891 Ga0500583_0138009
892 Ga0500651_0005008
893 Ga0500651_0050856
894 Ga0500566_0032578
895 Ga0500566_0208089
896 Ga0500555_007124
897 Ga0500556_0021354
898 Ga0500557_072596
899 Ga0500562_001555
900 Ga0500562_004227
901 Ga0500569_000114
902 Ga0500582_152911
903 Ga0500595_000938
904 Ga0500595_038393
905 Ga0500595_149522
906 Ga0500607_042477
907 Ga0500607_076445
908 Ga0500608_012667
909 Ga0500642_0130865
910 Ga0500559_0009054
911 Ga0500559_0010455
912 Ga0500590_023466
913 Ga0500616_0311211
914 Ga0500620_022422
915 Ga0500624_051272
916 Ga0500638_045211
917 Ga0500639_135051
918 Ga0500639_192668
919 Ga0500636_0024617
920 Ga0500637_0013005
921 Ga0500625_046694
922 Ga0500645_000539
923 Ga0500645_014316
924 Ga0500596_006612
925 Ga0501084_0036511
926 Ga0501082_0030957
927 Ga0501082_0233534
928 2643884531
929 2644087626
930 2644344330
931 2644366985
932 2644549087
933 2644552767
934 2941488084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

19

168

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.652 1 147
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6267 1 147
8b4o-assembly1.cif.gz_A cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.5725 6 145
8b4o-assembly1.cif.gz_A cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.5302 6 145
2xl4-assembly1.cif.gz_A lnta, a virulence factor from listeria monocytogenes 0.5158 9 150
ID Description Score Start End Superfamily
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5934 7 145 3.10.20.90
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5697 7 145 3.10.20.90
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4976 5 148 1.20.120.1770
af_A0A1D8PLU5_1_236_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4924 1 151 1.20.1250.20
af_A0A1D8PLU5_1_236_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4861 1 151 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7U1EAK3-F1-model_v4 deleted 0.9705 20 150
AF-A0A2P2E7G1-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9689 4 152 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A838UFE2-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9649 2 153 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A7X6B8V8-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9636 7 148 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A5C4NJL0-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9626 4 151 GO:0005886
GO:0006782
GO:0046872
GO:0070818

Map