F449845

General Info

Members Datasets Scaffolds Average Seq Length
467 283 934 136

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10431433|Ga0105241_104314332
Length 135
Sequence MSGLTSTTPIPTGVVVHSKSRVLELQYGGESYRVPFELLRVYSPSAEVQGHGPGQETLQTGKREVTIIGIDPVGHYALQLNFSDGHNTGIYSWDILHDLATRQEDLWREYQAKLEAAGVDRDTPMAAKPTGGHCH

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
149 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
150 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
151 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
242 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2547132374 Acidovorax radicis N35 Isolate Unclassified
264 2643221570 Acidovorax sp. Root568 Isolate Unclassified
265 2643221596 Acidovorax sp. Root70 Isolate Unclassified
266 2643221652 Acidovorax sp. Root402 Isolate Unclassified
267 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
268 2643221717 Acidovorax sp. Root267 Isolate Unclassified
269 2721755523 Delftia sp. HK171 Isolate Unclassified
270 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
271 2842677519 Variovorax sp. R-72495 Isolate Unclassified
272 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
273 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
274 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
275 2904456579 Variovorax sp. 2002 Isolate Unclassified
276 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
277 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
278 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
279 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
280 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
281 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
282 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
283 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.07
Metatranscriptomes 0.43
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.63
Nodule 1.07
Rhizoplane 1.93
Rhizosphere 63.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10431433 3300009174 Bacteria 1162
2 JGI24737J22298_10108492 3300001990 Bacteria 822
3 JGI25156J39149_1000726 3300002705 Bacteria 17485
4 JGI25154J39366_1003521 3300002738 Bacteria 3245
5 JGI25157J39369_1001041 3300002741 Bacteria 12688
6 JGI25152J39213_1001428 3300002773 Bacteria 10325
7 JGI25150J39212_1003355 3300002774 Bacteria 3763
8 JGI25153J46596_10007422 3300003215 Bacteria 5397
9 JGI25153J46596_10007578 3300003215 Bacteria 5312
10 rootH1_10044352 3300003316 Bacteria 1365
11 rootH1_10053421 3300003316 Bacteria 1006
12 rootH1_10040739 3300003323 Bacteria 8213
13 rootH1_10220914 3300003323 Bacteria 2068
14 Ga0055539_1000431 3300003752 Bacteria 14924
15 Ga0055539_1010355 3300003752 Bacteria 1155
16 Ga0055533_1000053 3300003756 Bacteria 199478
17 Ga0055525_1000904 3300003759 Bacteria 8472
18 Ga0055535_1000418 3300003761 Bacteria 40100
19 Ga0055529_1000575 3300003763 Bacteria 29866
20 Ga0055526_1000968 3300003771 Bacteria 21218
21 Ga0055537_1000677 3300003773 Bacteria 17891
22 Ga0055534_1000337 3300003784 Bacteria 30592
23 Ga0055528_1002968 3300003790 Bacteria 8799
24 Ga0055531_10000007 3300003794 Bacteria 225289
25 Ga0070658_10070072 3300005327 Bacteria 2870
26 Ga0070658_10096192 3300005327 Bacteria 2445
27 Ga0070676_10037254 3300005328 Bacteria 2805
28 Ga0068869_100010105 3300005334 Bacteria 6142
29 Ga0070680_100130471 3300005336 Bacteria 2102
30 Ga0070680_100742391 3300005336 Bacteria 845
31 Ga0068868_100236667 3300005338 Bacteria 1533
32 Ga0070660_100416807 3300005339 Bacteria 1112
33 Ga0070675_100438515 3300005354 Bacteria 1170
34 Ga0070671_100285309 3300005355 Bacteria 1405
35 Ga0070671_101064196 3300005355 Bacteria 710
36 Ga0070674_100190097 3300005356 Bacteria 1579
37 Ga0070673_100370771 3300005364 Bacteria 1275
38 Ga0070659_100088337 3300005366 Bacteria 2482
39 Ga0070659_101622089 3300005366 Bacteria 578
40 Ga0070667_101074250 3300005367 Bacteria 752
41 Ga0070678_100462617 3300005456 Bacteria 1113
42 Ga0070678_100582665 3300005456 Bacteria 997
43 Ga0070662_100282550 3300005457 Bacteria 1344
44 Ga0070662_100615666 3300005457 Bacteria 914
45 Ga0068867_101178791 3300005459 Bacteria 703
46 Ga0068867_101595623 3300005459 Bacteria 610
47 Ga0070685_10618669 3300005466 Bacteria 781
48 Ga0070679_100187659 3300005530 Bacteria 2037
49 Ga0070684_101094561 3300005535 Bacteria 749
50 Ga0068855_100055462 3300005563 Bacteria 4654
51 Ga0068855_100360122 3300005563 Bacteria 1601
52 Ga0068855_100960028 3300005563 Bacteria 900
53 Ga0070664_101041864 3300005564 Bacteria 770
54 Ga0068854_100032592 3300005578 Bacteria 3627
55 Ga0068854_100160660 3300005578 Bacteria 1740
56 Ga0068856_100036308 3300005614 Bacteria 4832
57 Ga0068856_100206311 3300005614 Bacteria 1980
58 Ga0068852_100245939 3300005616 Bacteria 1712
59 Ga0068852_100403752 3300005616 Bacteria 1345
60 Ga0068852_100967294 3300005616 Bacteria 869
61 Ga0068852_101899130 3300005616 Bacteria 618
62 Ga0068866_10286299 3300005718 Bacteria 1023
63 Ga0068861_100861193 3300005719 Bacteria 855
64 Ga0068860_100038773 3300005843 Bacteria 4558
65 Ga0068860_100175972 3300005843 Bacteria 2068
66 Ga0075365_10467920 3300006038 Bacteria 890
67 Ga0075365_10740975 3300006038 Bacteria 694
68 Ga0075368_10067105 3300006042 Bacteria 1443
69 Ga0075363_100057058 3300006048 Bacteria 2095
70 Ga0075363_100063590 3300006048 Bacteria 1992
71 Ga0075363_100071411 3300006048 Bacteria 1887
72 Ga0075364_10031100 3300006051 Bacteria 3430
73 Ga0075362_10003146 3300006177 Bacteria 5701
74 Ga0075362_10003169 3300006177 Bacteria 5687
75 Ga0075362_10097430 3300006177 Bacteria 1371
76 Ga0075362_10214374 3300006177 Bacteria 940
77 Ga0075367_10001551 3300006178 Bacteria 9934
78 Ga0075367_10055010 3300006178 Bacteria 2360
79 Ga0075367_10096134 3300006178 Bacteria 1807
80 Ga0075369_10406565 3300006186 Bacteria 642
81 Ga0075366_10000385 3300006195 Bacteria 20480
82 Ga0075366_10015648 3300006195 Bacteria 4353
83 Ga0075366_10027028 3300006195 Bacteria 3365
84 Ga0075366_10038913 3300006195 Bacteria 2809
85 Ga0075366_10047033 3300006195 Bacteria 2557
86 Ga0075366_10047561 3300006195 Bacteria 2543
87 Ga0075366_10054153 3300006195 Bacteria 2383
88 Ga0075366_10054888 3300006195 Bacteria 2366
89 Ga0075366_10080354 3300006195 Bacteria 1947
90 Ga0075366_10142651 3300006195 Bacteria 1449
91 Ga0075370_10018852 3300006353 Bacteria 3747
92 Ga0075370_10024698 3300006353 Bacteria 3321
93 Ga0075370_10092641 3300006353 Bacteria 1744
94 Ga0075370_10194655 3300006353 Bacteria 1195
95 Ga0075370_10748720 3300006353 Bacteria 595
96 Ga0068871_100438614 3300006358 Bacteria 1169
97 Ga0068865_100360102 3300006881 Bacteria 1181
98 Ga0079104_1000055 3300006946 Bacteria 166522
99 Ga0099826_10075935 3300006948 Bacteria 2114
100 Ga0105250_10005866 3300009092 Bacteria 5444
101 Ga0105240_10002686 3300009093 Bacteria 28322
102 Ga0105240_10066203 3300009093 Bacteria 4483
103 Ga0105245_10111571 3300009098 Bacteria 2543
104 Ga0114129_10201359 3300009147 Bacteria 2696
105 Ga0105243_10004827 3300009148 Bacteria 10590
106 Ga0105243_10012663 3300009148 Bacteria 6372
107 Ga0105243_10254793 3300009148 Bacteria 1569
108 Ga0105241_10938952 3300009174 Bacteria 806
109 Ga0105241_10958687 3300009174 Bacteria 798
110 Ga0105241_11110813 3300009174 Bacteria 745
111 Ga0105242_10867758 3300009176 Bacteria 899
112 Ga0105237_10000739 3300009545 Bacteria 45075
113 Ga0105237_10023104 3300009545 Bacteria 6376
114 Ga0105237_10406382 3300009545 Bacteria 1366
115 Ga0105237_10567261 3300009545 Bacteria 1142
116 Ga0105238_10003731 3300009551 Bacteria 15154
117 Ga0105238_10605341 3300009551 Bacteria 1104
118 Ga0105238_10693190 3300009551 Bacteria 1030
119 Ga0105239_10014663 3300010375 Bacteria 8691
120 Ga0105239_10484702 3300010375 Bacteria 1405
121 Ga0105246_10751656 3300011119 Bacteria 860
122 Ga0157369_10055665 3300013105 Bacteria 4269
123 Ga0157374_10912410 3300013296 Bacteria 896
124 Ga0163162_10359637 3300013306 Bacteria 1589
125 Ga0157372_10882861 3300013307 Bacteria 1038
126 Ga0157375_10853632 3300013308 Bacteria 1057
127 Ga0157375_12742272 3300013308 Bacteria 589
128 Ga0157379_11373768 3300014968 Bacteria 684
129 Ga0157376_12670516 3300014969 Bacteria 539
130 Ga0182006_1057614 3300015261 Bacteria 1476
131 Ga0182006_1086987 3300015261 Bacteria 1130
132 Ga0209674_100039 3300025226 Bacteria 402292
133 Ga0209563_100080 3300025230 Bacteria 199504
134 Ga0207427_101227 3300025231 Bacteria 9906
135 Ga0209258_100072 3300025242 Bacteria 274355
136 Ga0209258_100222 3300025242 Bacteria 107982
137 Ga0207425_1000540 3300025245 Bacteria 22766
138 Ga0209646_1000076 3300025246 Bacteria 212891
139 Ga0209026_1000011 3300025250 Bacteria 507291
140 Ga0209677_100086 3300025253 Bacteria 112759
141 Ga0209677_100308 3300025253 Bacteria 32011
142 Ga0209677_101082 3300025253 Bacteria 12847
143 Ga0209148_1003254 3300025254 Bacteria 4609
144 Ga0209759_1000034 3300025256 Bacteria 271209
145 Ga0209759_1001756 3300025256 Bacteria 11114
146 Ga0209759_1003908 3300025256 Bacteria 5748
147 Ga0209759_1006233 3300025256 Bacteria 4043
148 Ga0209759_1012837 3300025256 Bacteria 2299
149 Ga0209759_1015311 3300025256 Bacteria 1984
150 Ga0209129_1000027 3300025258 Bacteria 409587
151 Ga0209565_1000067 3300025263 Bacteria 171247
152 Ga0209565_1034987 3300025263 Bacteria 961
153 Ga0209455_1000053 3300025272 Bacteria 365949
154 Ga0209673_1000097 3300025273 Bacteria 193482
155 Ga0209673_1023535 3300025273 Bacteria 2094
156 Ga0209675_1000038 3300025291 Bacteria 250481
157 Ga0209025_1000310 3300025294 Bacteria 108186
158 Ga0209564_1000139 3300025295 Bacteria 180328
159 Ga0209758_1000052 3300025297 Bacteria 338962
160 Ga0209050_1007646 3300025298 Bacteria 5988
161 Ga0209256_1009641 3300025299 Bacteria 4193
162 Ga0209051_1001911 3300025303 Bacteria 16199
163 Ga0209051_1031375 3300025303 Bacteria 2046
164 Ga0209257_1000021 3300025304 Bacteria 771986
165 Ga0209257_1035060 3300025304 Bacteria 1556
166 Ga0207682_10273944 3300025893 Bacteria 788
167 Ga0207688_10114558 3300025901 Bacteria 1568
168 Ga0207645_10042506 3300025907 Bacteria 2908
169 Ga0207645_10088674 3300025907 Bacteria 1989
170 Ga0207705_10019660 3300025909 Bacteria 4829
171 Ga0207705_10127325 3300025909 Bacteria 1893
172 Ga0207705_10139293 3300025909 Bacteria 1811
173 Ga0207695_10012072 3300025913 Bacteria 10384
174 Ga0207695_10032446 3300025913 Bacteria 5714
175 Ga0207695_10061522 3300025913 Bacteria 3880
176 Ga0207695_10062546 3300025913 Bacteria 3842
177 Ga0207671_10004924 3300025914 Bacteria 12529
178 Ga0207671_10029878 3300025914 Bacteria 4067
179 Ga0207671_10422942 3300025914 Bacteria 1060
180 Ga0207671_10439108 3300025914 Bacteria 1039
181 Ga0207660_10073509 3300025917 Bacteria 2493
182 Ga0207660_10567871 3300025917 Bacteria 923
183 Ga0207657_10056950 3300025919 Bacteria 3371
184 Ga0207652_10190953 3300025921 Bacteria 1842
185 Ga0207652_10235227 3300025921 Bacteria 1651
186 Ga0207652_10759732 3300025921 Bacteria 862
187 Ga0207694_10380073 3300025924 Bacteria 1172
188 Ga0207694_10698828 3300025924 Bacteria 855
189 Ga0207650_10729589 3300025925 Bacteria 838
190 Ga0207659_11812517 3300025926 Bacteria 518
191 Ga0207644_10042924 3300025931 Bacteria 3207
192 Ga0207644_10158487 3300025931 Bacteria 1757
193 Ga0207644_10692253 3300025931 Bacteria 850
194 Ga0207644_11333970 3300025931 Bacteria 603
195 Ga0207690_10048534 3300025932 Bacteria 2824
196 Ga0207690_10437704 3300025932 Bacteria 1049
197 Ga0207690_11365662 3300025932 Bacteria 592
198 Ga0207706_10001652 3300025933 Bacteria 22082
199 Ga0207706_10576954 3300025933 Bacteria 967
200 Ga0207709_10000111 3300025935 Bacteria 127580
201 Ga0207709_10062307 3300025935 Bacteria 2334
202 Ga0207709_10064568 3300025935 Bacteria 2299
203 Ga0207669_10166760 3300025937 Bacteria 1563
204 Ga0207669_10826270 3300025937 Bacteria 770
205 Ga0207704_10238963 3300025938 Bacteria 1356
206 Ga0207665_10965934 3300025939 Bacteria 677
207 Ga0207691_10644844 3300025940 Bacteria 895
208 Ga0207689_10036462 3300025942 Bacteria 4082
209 Ga0207689_10128407 3300025942 Bacteria 2085
210 Ga0207667_10003554 3300025949 Bacteria 19278
211 Ga0207667_10169014 3300025949 Bacteria 2248
212 Ga0207667_10494263 3300025949 Bacteria 1241
213 Ga0207667_12015323 3300025949 Bacteria 537
214 Ga0207651_10109045 3300025960 Bacteria 2073
215 Ga0207651_10656728 3300025960 Bacteria 921
216 Ga0207668_10603537 3300025972 Bacteria 956
217 Ga0207640_10011731 3300025981 Bacteria 4969
218 Ga0207658_10469825 3300025986 Bacteria 1116
219 Ga0207677_10681202 3300026023 Bacteria 910
220 Ga0207639_10286925 3300026041 Bacteria 1450
221 Ga0207639_10579220 3300026041 Bacteria 1033
222 Ga0207678_10193534 3300026067 Bacteria 1738
223 Ga0207702_10000629 3300026078 Bacteria 38750
224 Ga0207702_10138517 3300026078 Bacteria 2199
225 Ga0207648_10680495 3300026089 Bacteria 952
226 Ga0207676_11975975 3300026095 Bacteria 582
227 Ga0207674_10002708 3300026116 Bacteria 22119
228 Ga0207674_10003424 3300026116 Bacteria 19421
229 Ga0207675_100007765 3300026118 Bacteria 10122
230 Ga0207683_11065134 3300026121 Bacteria 750
231 Ga0207698_10246340 3300026142 Bacteria 1632
232 Ga0207698_10765947 3300026142 Bacteria 965
233 Ga0209281_1000007 3300027111 Bacteria 938265
234 Ga0209281_1016424 3300027111 Bacteria 1521
235 Ga0209282_1000250 3300027666 Bacteria 26928
236 Ga0209813_10107048 3300027866 Bacteria 958
237 Ga0209813_10118806 3300027866 Bacteria 918
238 Ga0209974_10036207 3300027876 Bacteria 1639
239 Ga0268266_10821791 3300028379 Bacteria 898
240 Ga0268264_10040974 3300028381 Bacteria 3828
241 Ga0265334_10184455 3300028573 Bacteria 728
242 Ga0265336_10000014 3300028666 Bacteria 241247
243 Ga0307517_10334529 3300028786 Bacteria 830
244 Ga0307515_10102753 3300028794 Bacteria 3434
245 Ga0307515_10274013 3300028794 Bacteria 1404
246 Ga0307515_10844124 3300028794 Bacteria 542
247 Ga0265324_10006580 3300029957 Bacteria 4814
248 Ga0316177_1136770 3300030731 Bacteria 6811
249 Ga0314311_1021434 3300030733 Bacteria 4790
250 Ga0316179_1014077 3300030734 Bacteria 1313
251 Ga0316178_1029123 3300030735 Bacteria 1761
252 Ga0316180_1005021 3300030736 Bacteria 4076
253 Ga0316183_1070362 3300030742 Bacteria 2158
254 Ga0316181_1026598 3300030744 Bacteria 2756
255 Ga0316182_1104947 3300030745 Bacteria 1158
256 Ga0265328_10030286 3300031239 Bacteria 2016
257 Ga0265331_10312068 3300031250 Bacteria 704
258 Ga0265327_10000012 3300031251 Bacteria 530403
259 Ga0307408_100628646 3300031548 Bacteria 957
260 Ga0307408_100957342 3300031548 Bacteria 787
261 Ga0307408_101167383 3300031548 Bacteria 717
262 Ga0307516_10378678 3300031730 Bacteria 1077
263 Ga0307516_10500095 3300031730 Bacteria 870
264 Ga0307405_10142305 3300031731 Bacteria 1674
265 Ga0307413_10420007 3300031824 Bacteria 1053
266 Ga0307413_11073165 3300031824 Bacteria 694
267 Ga0307410_10217910 3300031852 Bacteria 1467
268 Ga0307407_10280382 3300031903 Bacteria 1154
269 Ga0307412_10042338 3300031911 Bacteria 2959
270 Ga0307412_10102965 3300031911 Bacteria 2023
271 Ga0307412_10203498 3300031911 Bacteria 1505
272 Ga0307412_10272875 3300031911 Bacteria 1324
273 Ga0307412_10409474 3300031911 Bacteria 1106
274 Ga0307412_10601354 3300031911 Bacteria 931
275 Ga0307412_10640015 3300031911 Bacteria 905
276 Ga0307412_11115980 3300031911 Bacteria 702
277 Ga0307409_100512788 3300031995 Bacteria 1170
278 Ga0307416_100753912 3300032002 Bacteria 1066
279 Ga0307416_101086042 3300032002 Bacteria 904
280 Ga0307414_10633112 3300032004 Bacteria 963
281 Ga0307411_10050406 3300032005 Bacteria 2711
282 Ga0307411_10650091 3300032005 Bacteria 913
283 Ga0307415_100853265 3300032126 Bacteria 836
284 Ga0307510_10225541 3300033180 Bacteria 1381
285 Ga0373959_0045363 3300034820 Bacteria 934
286 Ga0373934_0131926 3300035086 Bacteria 1019
287 Ga0373923_0696802 3300035111 Bacteria 504
288 Ga0373943_0711471 3300035170 Bacteria 595
289 Ga0373931_0001744 3300035691 Bacteria 9429
290 Ga0373931_0143987 3300035691 Bacteria 1383
291 Ga0373927_0487981 3300035695 Bacteria 814
292 Ga0395899_0010807 3300037312 Bacteria 6998
293 Ga0395900_0007383 3300037418 Bacteria 11363
294 Ga0395900_0296047 3300037418 Bacteria 1606
295 Ga0395898_0045803 3300037466 Bacteria 4298
296 Ga0395898_0266411 3300037466 Bacteria 1634
297 Ga0395905_0001875 3300037471 Bacteria 24218
298 Ga0395905_0006857 3300037471 Bacteria 11390
299 Ga0395905_0017942 3300037471 Bacteria 6721
300 Ga0395905_0161393 3300037471 Bacteria 2106
301 Ga0395905_0260176 3300037471 Bacteria 1620
302 Ga0395905_0473810 3300037471 Bacteria 1151
303 Ga0395905_0981911 3300037471 Bacteria 747
304 Ga0395901_0005935 3300038443 Bacteria 12368
305 Ga0395901_0089172 3300038443 Bacteria 3227
306 Ga0395901_0687132 3300038443 Bacteria 1022
307 Ga0436361_0567324 3300039447 Bacteria 1056
308 Ga0436361_0592677 3300039447 Bacteria 1400
309 Ga0451791_1028025 3300041451 Bacteria 816
310 Ga0451802_0379536 3300041460 Bacteria 505
311 Ga0451843_1731369 3300041509 Bacteria 548
312 Ga0451853_2201609 3300041512 Bacteria 766
313 Ga0451853_3239861 3300041512 Bacteria 945
314 Ga0451853_3646793 3300041512 Bacteria 694
315 Ga0439456_078281 3300042013 Bacteria 737
316 Ga0450910_016890 3300042147 Bacteria 1084
317 Ga0439446_0212281 3300042156 Bacteria 657
318 Ga0451577_0423876 3300042876 Bacteria 1208
319 Ga0466969_0000105 3300044656 Bacteria 44511
320 Ga0466969_0008421 3300044656 Bacteria 5469
321 Ga0466969_0041626 3300044656 Bacteria 2297
322 Ga0466972_0035699 3300044658 Bacteria 2433
323 Ga0466972_0047644 3300044658 Bacteria 2072
324 Ga0466972_0203401 3300044658 Bacteria 927
325 Ga0453683_0605162 3300044673 Bacteria 715
326 Ga0466965_0011163 3300044683 Bacteria 4205
327 Ga0466965_0156519 3300044683 Bacteria 1193
328 Ga0466965_0157825 3300044683 Bacteria 1188
329 Ga0466965_0626043 3300044683 Bacteria 613
330 Ga0466966_0010218 3300044684 Bacteria 6226
331 Ga0466966_0023898 3300044684 Bacteria 3999
332 Ga0466966_0048250 3300044684 Bacteria 2712
333 Ga0466966_0374184 3300044684 Bacteria 856
334 Ga0466961_0033437 3300044693 Bacteria 3303
335 Ga0466961_0071277 3300044693 Bacteria 2205
336 Ga0466961_0136679 3300044693 Bacteria 1535
337 Ga0466963_0039615 3300044694 Bacteria 3086
338 Ga0466963_0284150 3300044694 Bacteria 1163
339 Ga0466964_0079896 3300044706 Bacteria 1401
340 Ga0466964_0124318 3300044706 Bacteria 1167
341 Ga0466964_0319498 3300044706 Bacteria 788
342 Ga0453684_0013441 3300044712 Bacteria 13293
343 Ga0453684_0194566 3300044712 Bacteria 2369
344 Ga0466971_0032473 3300044719 Bacteria 2339
345 Ga0466971_0283743 3300044719 Bacteria 793
346 Ga0466968_0109190 3300044735 Bacteria 1242
347 Ga0466970_0019679 3300044765 Bacteria 3501
348 Ga0466970_0054537 3300044765 Bacteria 2135
349 Ga0466970_0213590 3300044765 Bacteria 1075
350 Ga0466957_0305023 3300044842 Bacteria 1071
351 Ga0466960_0087023 3300044901 Bacteria 1585
352 Ga0466960_0159518 3300044901 Bacteria 1210
353 Ga0466959_0000027 3300045049 Bacteria 114262
354 Ga0466959_0014466 3300045049 Bacteria 5734
355 Ga0466959_0032734 3300045049 Bacteria 3848
356 Ga0451576_0104294 3300045051 Bacteria 2949
357 Ga0451576_1291823 3300045051 Bacteria 761
358 Ga0466967_0371813 3300045976 Bacteria 1386
359 Ga0466967_1801077 3300045976 Bacteria 609
360 Ga0495592_0183958 3300046454 Bacteria 1421
361 Ga0495590_0058786 3300046457 Bacteria 1345
362 Ga0495651_0322635 3300046462 Bacteria 1029
363 Ga0495650_0006230 3300046471 Bacteria 7478
364 Ga0495639_0009617 3300046475 Bacteria 4149
365 Ga0495585_0039217 3300046492 Bacteria 2663
366 Ga0495583_0000418 3300046506 Bacteria 64708
367 Ga0495606_0007392 3300046507 Bacteria 9850
368 Ga0495608_0326230 3300046511 Bacteria 948
369 Ga0495652_0535859 3300046529 Bacteria 807
370 Ga0495668_0011498 3300046616 Bacteria 5300
371 Ga0495625_0019481 3300046660 Bacteria 5262
372 Ga0495646_0576116 3300046680 Bacteria 573
373 Ga0495669_0212830 3300046684 Bacteria 925
374 Ga0495649_0000190 3300046694 Bacteria 53998
375 Ga0495589_0007457 3300046794 Bacteria 5733
376 Ga0495683_0143263 3300047323 Bacteria 1118
377 Ga0495686_0009907 3300047472 Bacteria 6824
378 Ga0495626_0111444 3300048091 Bacteria 1185
379 Ga0496100_0819301 3300048903 Bacteria 730
380 Ga0496100_1085121 3300048903 Bacteria 631
381 Ga0496101_1378060 3300048904 Bacteria 550
382 Ga0496104_0656002 3300048907 Bacteria 958
383 Ga0496109_0108502 3300048912 Bacteria 2580
384 Ga0496109_0667360 3300048912 Bacteria 977
385 Ga0496110_0112931 3300048913 Bacteria 2443
386 Ga0496121_0021046 3300048924 Bacteria 6413
387 Ga0496124_0284994 3300048927 Bacteria 1202
388 Ga0496125_0402574 3300048928 Bacteria 799
389 Ga0496125_0614526 3300048928 Bacteria 591
390 Ga0501306_071024 3300049127 Bacteria 588
391 Ga0501308_019563 3300049128 Bacteria 837
392 Ga0501298_012118 3300049521 Bacteria 1507
393 Ga0501036_0532078 3300049572 Bacteria 977
394 Ga0501037_1064502 3300049573 Bacteria 525
395 Ga0501073_0818678 3300049589 Bacteria 642
396 Ga0501202_026129 3300049652 Bacteria 1193
397 Ga0501222_003040 3300049662 Bacteria 2306
398 Ga0501249_010793 3300049679 Bacteria 1913
399 Ga0501225_0015730 3300049705 Bacteria 2104
400 Ga0501262_000785 3300049759 Bacteria 3664
401 Ga0501035_0068259 3300049822 Bacteria 3153
402 nmdc:mga03683_164677_c1 3300050489 Bacteria 1006
403 nmdc:mga03683_45721_c1 3300050489 Bacteria 1813
404 nmdc:mga03683_4761_c1 3300050489 Bacteria 4528
405 nmdc:mga03683_59123_c1 3300050489 Bacteria 1616
406 nmdc:mga03n38_135796_c1 3300050490 Bacteria 1224
407 nmdc:mga03n38_665286_c1 3300050490 Bacteria 598
408 nmdc:mga00v17_207717_c1 3300050491 Bacteria 1267
409 nmdc:mga0yw44_336963_c1 3300050492 Bacteria 1014
410 nmdc:mga0yw44_623553_c1 3300050492 Bacteria 733
411 nmdc:mga0k408_14752_c1 3300050493 Bacteria 4311
412 nmdc:mga0k408_1503_c1 3300050493 Bacteria 12602
413 nmdc:mga0k408_157204_c1 3300050493 Bacteria 1354
414 nmdc:mga0k408_20104_c1 3300050493 Bacteria 3736
415 nmdc:mga0k408_37460_c1 3300050493 Bacteria 2785
416 nmdc:mga0k408_391_c1 3300050493 Bacteria 24032
417 nmdc:mga0k408_403260_c1 3300050493 Bacteria 814
418 nmdc:mga0k408_45856_c1 3300050493 Bacteria 1615
419 nmdc:mga0k408_70079_c1 3300050493 Bacteria 2046
420 nmdc:mga0k408_72798_c1 3300050493 Bacteria 2007
421 nmdc:mga0k408_77638_c1 3300050493 Bacteria 1942
422 nmdc:mga0k408_8073_c1 3300050493 Bacteria 5642
423 nmdc:mga06z11_187943_c1 3300050494 Bacteria 1194
424 nmdc:mga06z11_296102_c1 3300050494 Bacteria 961
425 nmdc:mga06z11_314003_c1 3300050494 Bacteria 934
426 nmdc:mga06z11_357355_c1 3300050494 Bacteria 875
427 nmdc:mga06z11_83411_c1 3300050494 Bacteria 1720
428 nmdc:mga04h51_126020_c1 3300050495 Bacteria 958
429 nmdc:mga04h51_168018_c1 3300050495 Bacteria 847
430 nmdc:mga07m45_1014_c1 3300050496 Bacteria 12410
431 nmdc:mga07m45_12177_c1 3300050496 Bacteria 4539
432 nmdc:mga07m45_18749_c1 3300050496 Bacteria 3742
433 nmdc:mga07m45_3598_c1 3300050496 Bacteria 7483
434 nmdc:mga07m45_38080_c1 3300050496 Bacteria 2683
435 nmdc:mga07m45_394813_c1 3300050496 Bacteria 803
436 nmdc:mga07m45_634299_c1 3300050496 Bacteria 616
437 nmdc:mga08y16_1537316_c1 3300050511 Bacteria 625
438 nmdc:mga0sz30_106748_c1 3300050516 Bacteria 620
439 nmdc:mga0sz30_14739_c1 3300050516 Bacteria 3082
440 Ga0500635_0000238 3300053080 Bacteria 24308
441 Ga0500651_0665543 3300053093 Bacteria 559
442 Ga0500608_117469 3300053122 Bacteria 1211
443 Ga0500564_124358 3300053138 Bacteria 1121
444 Ga0500636_0011155 3300053177 Bacteria 5257
445 Ga0466962_0003926 3300061719 Bacteria 7114
446 Ga0466962_0055412 3300061719 Bacteria 1894
447 2548499010 2547132374 Bacteria 5530232
448 2643867784 2643221570 Bacteria 5103772
449 2643991646 2643221596 Bacteria 5006805
450 2644293393 2643221652 Bacteria 5140275
451 2644301407 2643221654 Bacteria 5273570
452 2644648467 2643221717 Bacteria 5676132
453 2722882002 2721755523 Bacteria 6430384
454 2839143972 2839138175 Bacteria 6549354
455 2842677544 2842677519 Bacteria 5615038
456 2842718741 2842718218 Bacteria 4560148
457 2885196921 2885192300 Bacteria 5882526
458 2904451834 2904449895 Bacteria 6927402
459 2904462509 2904456579 Bacteria 6819253
460 2904545113 2904541872 Bacteria 8915136
461 2919467182 2919462493 Bacteria 5817112
462 2919707147 2919704043 Bacteria 5560311
463 2929165291 2929160207 Bacteria 9075316
464 2945946136 2945945610 Bacteria 5951079
465 2945975736 2945972063 Bacteria 6086495
466 2974320374 2974320154 Bacteria 4571377
467 2990713906 2990710928 Bacteria 5002431
468 Ga0105241_10431433
469 JGI24737J22298_10108492
470 JGI25156J39149_1000726
471 JGI25154J39366_1003521
472 JGI25157J39369_1001041
473 JGI25152J39213_1001428
474 JGI25150J39212_1003355
475 JGI25153J46596_10007422
476 JGI25153J46596_10007578
477 rootH1_10044352
478 rootH1_10053421
479 rootH1_10040739
480 rootH1_10220914
481 Ga0055539_1000431
482 Ga0055539_1010355
483 Ga0055533_1000053
484 Ga0055525_1000904
485 Ga0055535_1000418
486 Ga0055529_1000575
487 Ga0055526_1000968
488 Ga0055537_1000677
489 Ga0055534_1000337
490 Ga0055528_1002968
491 Ga0055531_10000007
492 Ga0070658_10070072
493 Ga0070658_10096192
494 Ga0070676_10037254
495 Ga0068869_100010105
496 Ga0070680_100130471
497 Ga0070680_100742391
498 Ga0068868_100236667
499 Ga0070660_100416807
500 Ga0070675_100438515
501 Ga0070671_100285309
502 Ga0070671_101064196
503 Ga0070674_100190097
504 Ga0070673_100370771
505 Ga0070659_100088337
506 Ga0070659_101622089
507 Ga0070667_101074250
508 Ga0070678_100462617
509 Ga0070678_100582665
510 Ga0070662_100282550
511 Ga0070662_100615666
512 Ga0068867_101178791
513 Ga0068867_101595623
514 Ga0070685_10618669
515 Ga0070679_100187659
516 Ga0070684_101094561
517 Ga0068855_100055462
518 Ga0068855_100360122
519 Ga0068855_100960028
520 Ga0070664_101041864
521 Ga0068854_100032592
522 Ga0068854_100160660
523 Ga0068856_100036308
524 Ga0068856_100206311
525 Ga0068852_100245939
526 Ga0068852_100403752
527 Ga0068852_100967294
528 Ga0068852_101899130
529 Ga0068866_10286299
530 Ga0068861_100861193
531 Ga0068860_100038773
532 Ga0068860_100175972
533 Ga0075365_10467920
534 Ga0075365_10740975
535 Ga0075368_10067105
536 Ga0075363_100057058
537 Ga0075363_100063590
538 Ga0075363_100071411
539 Ga0075364_10031100
540 Ga0075362_10003146
541 Ga0075362_10003169
542 Ga0075362_10097430
543 Ga0075362_10214374
544 Ga0075367_10001551
545 Ga0075367_10055010
546 Ga0075367_10096134
547 Ga0075369_10406565
548 Ga0075366_10000385
549 Ga0075366_10015648
550 Ga0075366_10027028
551 Ga0075366_10038913
552 Ga0075366_10047033
553 Ga0075366_10047561
554 Ga0075366_10054153
555 Ga0075366_10054888
556 Ga0075366_10080354
557 Ga0075366_10142651
558 Ga0075370_10018852
559 Ga0075370_10024698
560 Ga0075370_10092641
561 Ga0075370_10194655
562 Ga0075370_10748720
563 Ga0068871_100438614
564 Ga0068865_100360102
565 Ga0079104_1000055
566 Ga0099826_10075935
567 Ga0105250_10005866
568 Ga0105240_10002686
569 Ga0105240_10066203
570 Ga0105245_10111571
571 Ga0114129_10201359
572 Ga0105243_10004827
573 Ga0105243_10012663
574 Ga0105243_10254793
575 Ga0105241_10938952
576 Ga0105241_10958687
577 Ga0105241_11110813
578 Ga0105242_10867758
579 Ga0105237_10000739
580 Ga0105237_10023104
581 Ga0105237_10406382
582 Ga0105237_10567261
583 Ga0105238_10003731
584 Ga0105238_10605341
585 Ga0105238_10693190
586 Ga0105239_10014663
587 Ga0105239_10484702
588 Ga0105246_10751656
589 Ga0157369_10055665
590 Ga0157374_10912410
591 Ga0163162_10359637
592 Ga0157372_10882861
593 Ga0157375_10853632
594 Ga0157375_12742272
595 Ga0157379_11373768
596 Ga0157376_12670516
597 Ga0182006_1057614
598 Ga0182006_1086987
599 Ga0209674_100039
600 Ga0209563_100080
601 Ga0207427_101227
602 Ga0209258_100072
603 Ga0209258_100222
604 Ga0207425_1000540
605 Ga0209646_1000076
606 Ga0209026_1000011
607 Ga0209677_100086
608 Ga0209677_100308
609 Ga0209677_101082
610 Ga0209148_1003254
611 Ga0209759_1000034
612 Ga0209759_1001756
613 Ga0209759_1003908
614 Ga0209759_1006233
615 Ga0209759_1012837
616 Ga0209759_1015311
617 Ga0209129_1000027
618 Ga0209565_1000067
619 Ga0209565_1034987
620 Ga0209455_1000053
621 Ga0209673_1000097
622 Ga0209673_1023535
623 Ga0209675_1000038
624 Ga0209025_1000310
625 Ga0209564_1000139
626 Ga0209758_1000052
627 Ga0209050_1007646
628 Ga0209256_1009641
629 Ga0209051_1001911
630 Ga0209051_1031375
631 Ga0209257_1000021
632 Ga0209257_1035060
633 Ga0207682_10273944
634 Ga0207688_10114558
635 Ga0207645_10042506
636 Ga0207645_10088674
637 Ga0207705_10019660
638 Ga0207705_10127325
639 Ga0207705_10139293
640 Ga0207695_10012072
641 Ga0207695_10032446
642 Ga0207695_10061522
643 Ga0207695_10062546
644 Ga0207671_10004924
645 Ga0207671_10029878
646 Ga0207671_10422942
647 Ga0207671_10439108
648 Ga0207660_10073509
649 Ga0207660_10567871
650 Ga0207657_10056950
651 Ga0207652_10190953
652 Ga0207652_10235227
653 Ga0207652_10759732
654 Ga0207694_10380073
655 Ga0207694_10698828
656 Ga0207650_10729589
657 Ga0207659_11812517
658 Ga0207644_10042924
659 Ga0207644_10158487
660 Ga0207644_10692253
661 Ga0207644_11333970
662 Ga0207690_10048534
663 Ga0207690_10437704
664 Ga0207690_11365662
665 Ga0207706_10001652
666 Ga0207706_10576954
667 Ga0207709_10000111
668 Ga0207709_10062307
669 Ga0207709_10064568
670 Ga0207669_10166760
671 Ga0207669_10826270
672 Ga0207704_10238963
673 Ga0207665_10965934
674 Ga0207691_10644844
675 Ga0207689_10036462
676 Ga0207689_10128407
677 Ga0207667_10003554
678 Ga0207667_10169014
679 Ga0207667_10494263
680 Ga0207667_12015323
681 Ga0207651_10109045
682 Ga0207651_10656728
683 Ga0207668_10603537
684 Ga0207640_10011731
685 Ga0207658_10469825
686 Ga0207677_10681202
687 Ga0207639_10286925
688 Ga0207639_10579220
689 Ga0207678_10193534
690 Ga0207702_10000629
691 Ga0207702_10138517
692 Ga0207648_10680495
693 Ga0207676_11975975
694 Ga0207674_10002708
695 Ga0207674_10003424
696 Ga0207675_100007765
697 Ga0207683_11065134
698 Ga0207698_10246340
699 Ga0207698_10765947
700 Ga0209281_1000007
701 Ga0209281_1016424
702 Ga0209282_1000250
703 Ga0209813_10107048
704 Ga0209813_10118806
705 Ga0209974_10036207
706 Ga0268266_10821791
707 Ga0268264_10040974
708 Ga0265334_10184455
709 Ga0265336_10000014
710 Ga0307517_10334529
711 Ga0307515_10102753
712 Ga0307515_10274013
713 Ga0307515_10844124
714 Ga0265324_10006580
715 Ga0316177_1136770
716 Ga0314311_1021434
717 Ga0316179_1014077
718 Ga0316178_1029123
719 Ga0316180_1005021
720 Ga0316183_1070362
721 Ga0316181_1026598
722 Ga0316182_1104947
723 Ga0265328_10030286
724 Ga0265331_10312068
725 Ga0265327_10000012
726 Ga0307408_100628646
727 Ga0307408_100957342
728 Ga0307408_101167383
729 Ga0307516_10378678
730 Ga0307516_10500095
731 Ga0307405_10142305
732 Ga0307413_10420007
733 Ga0307413_11073165
734 Ga0307410_10217910
735 Ga0307407_10280382
736 Ga0307412_10042338
737 Ga0307412_10102965
738 Ga0307412_10203498
739 Ga0307412_10272875
740 Ga0307412_10409474
741 Ga0307412_10601354
742 Ga0307412_10640015
743 Ga0307412_11115980
744 Ga0307409_100512788
745 Ga0307416_100753912
746 Ga0307416_101086042
747 Ga0307414_10633112
748 Ga0307411_10050406
749 Ga0307411_10650091
750 Ga0307415_100853265
751 Ga0307510_10225541
752 Ga0373959_0045363
753 Ga0373934_0131926
754 Ga0373923_0696802
755 Ga0373943_0711471
756 Ga0373931_0001744
757 Ga0373931_0143987
758 Ga0373927_0487981
759 Ga0395899_0010807
760 Ga0395900_0007383
761 Ga0395900_0296047
762 Ga0395898_0045803
763 Ga0395898_0266411
764 Ga0395905_0001875
765 Ga0395905_0006857
766 Ga0395905_0017942
767 Ga0395905_0161393
768 Ga0395905_0260176
769 Ga0395905_0473810
770 Ga0395905_0981911
771 Ga0395901_0005935
772 Ga0395901_0089172
773 Ga0395901_0687132
774 Ga0436361_0567324
775 Ga0436361_0592677
776 Ga0451791_1028025
777 Ga0451802_0379536
778 Ga0451843_1731369
779 Ga0451853_2201609
780 Ga0451853_3239861
781 Ga0451853_3646793
782 Ga0439456_078281
783 Ga0450910_016890
784 Ga0439446_0212281
785 Ga0451577_0423876
786 Ga0466969_0000105
787 Ga0466969_0008421
788 Ga0466969_0041626
789 Ga0466972_0035699
790 Ga0466972_0047644
791 Ga0466972_0203401
792 Ga0453683_0605162
793 Ga0466965_0011163
794 Ga0466965_0156519
795 Ga0466965_0157825
796 Ga0466965_0626043
797 Ga0466966_0010218
798 Ga0466966_0023898
799 Ga0466966_0048250
800 Ga0466966_0374184
801 Ga0466961_0033437
802 Ga0466961_0071277
803 Ga0466961_0136679
804 Ga0466963_0039615
805 Ga0466963_0284150
806 Ga0466964_0079896
807 Ga0466964_0124318
808 Ga0466964_0319498
809 Ga0453684_0013441
810 Ga0453684_0194566
811 Ga0466971_0032473
812 Ga0466971_0283743
813 Ga0466968_0109190
814 Ga0466970_0019679
815 Ga0466970_0054537
816 Ga0466970_0213590
817 Ga0466957_0305023
818 Ga0466960_0087023
819 Ga0466960_0159518
820 Ga0466959_0000027
821 Ga0466959_0014466
822 Ga0466959_0032734
823 Ga0451576_0104294
824 Ga0451576_1291823
825 Ga0466967_0371813
826 Ga0466967_1801077
827 Ga0495592_0183958
828 Ga0495590_0058786
829 Ga0495651_0322635
830 Ga0495650_0006230
831 Ga0495639_0009617
832 Ga0495585_0039217
833 Ga0495583_0000418
834 Ga0495606_0007392
835 Ga0495608_0326230
836 Ga0495652_0535859
837 Ga0495668_0011498
838 Ga0495625_0019481
839 Ga0495646_0576116
840 Ga0495669_0212830
841 Ga0495649_0000190
842 Ga0495589_0007457
843 Ga0495683_0143263
844 Ga0495686_0009907
845 Ga0495626_0111444
846 Ga0496100_0819301
847 Ga0496100_1085121
848 Ga0496101_1378060
849 Ga0496104_0656002
850 Ga0496109_0108502
851 Ga0496109_0667360
852 Ga0496110_0112931
853 Ga0496121_0021046
854 Ga0496124_0284994
855 Ga0496125_0402574
856 Ga0496125_0614526
857 Ga0501306_071024
858 Ga0501308_019563
859 Ga0501298_012118
860 Ga0501036_0532078
861 Ga0501037_1064502
862 Ga0501073_0818678
863 Ga0501202_026129
864 Ga0501222_003040
865 Ga0501249_010793
866 Ga0501225_0015730
867 Ga0501262_000785
868 Ga0501035_0068259
869 nmdc:mga03683_164677_c1
870 nmdc:mga03683_45721_c1
871 nmdc:mga03683_4761_c1
872 nmdc:mga03683_59123_c1
873 nmdc:mga03n38_135796_c1
874 nmdc:mga03n38_665286_c1
875 nmdc:mga00v17_207717_c1
876 nmdc:mga0yw44_336963_c1
877 nmdc:mga0yw44_623553_c1
878 nmdc:mga0k408_14752_c1
879 nmdc:mga0k408_1503_c1
880 nmdc:mga0k408_157204_c1
881 nmdc:mga0k408_20104_c1
882 nmdc:mga0k408_37460_c1
883 nmdc:mga0k408_391_c1
884 nmdc:mga0k408_403260_c1
885 nmdc:mga0k408_45856_c1
886 nmdc:mga0k408_70079_c1
887 nmdc:mga0k408_72798_c1
888 nmdc:mga0k408_77638_c1
889 nmdc:mga0k408_8073_c1
890 nmdc:mga06z11_187943_c1
891 nmdc:mga06z11_296102_c1
892 nmdc:mga06z11_314003_c1
893 nmdc:mga06z11_357355_c1
894 nmdc:mga06z11_83411_c1
895 nmdc:mga04h51_126020_c1
896 nmdc:mga04h51_168018_c1
897 nmdc:mga07m45_1014_c1
898 nmdc:mga07m45_12177_c1
899 nmdc:mga07m45_18749_c1
900 nmdc:mga07m45_3598_c1
901 nmdc:mga07m45_38080_c1
902 nmdc:mga07m45_394813_c1
903 nmdc:mga07m45_634299_c1
904 nmdc:mga08y16_1537316_c1
905 nmdc:mga0sz30_106748_c1
906 nmdc:mga0sz30_14739_c1
907 Ga0500635_0000238
908 Ga0500651_0665543
909 Ga0500608_117469
910 Ga0500564_124358
911 Ga0500636_0011155
912 Ga0466962_0003926
913 Ga0466962_0055412
914 2548499010
915 2643867784
916 2643991646
917 2644293393
918 2644301407
919 2644648467
920 2722882002
921 2839143972
922 2842677544
923 2842718741
924 2885196921
925 2904451834
926 2904462509
927 2904545113
928 2919467182
929 2919707147
930 2929165291
931 2945946136
932 2945975736
933 2974320374
934 2990713906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

14

97

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.9144 11 100
7ytu-assembly1.cif.gz_A crystal structure of vaccinia virus g3/l5 sub-complex (semet-labeled, p31 space group) 0.9003 14 37
3ifv-assembly1.cif.gz_C crystal structure of the haloferax volcanii proliferating cell nuclear antigen 0.8604 14 35
7aof-assembly1.cif.gz_I atomic structure of the poxvirus transcription late pre-initiation complex 0.851 9 42
7amv-assembly1.cif.gz_I atomic structure of the poxvirus transcription pre-initiation complex in the initially melted state 0.8383 9 41
ID Description Score Start End Superfamily
af_F1QJZ8_1_409_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9021 11 36 2.130.10.10
af_A0A2R8QGT5_36_439_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.897 11 36 2.130.10.10
af_Q58280_207_250_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8969 11 37 3.10.450.750
af_Q54GQ0_68_145_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8749 32 100 3.30.2020.30
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8499 7 100 3.30.2020.30
ID Description Score Start End GO Terms
AF-A0A3B9TVQ7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.97 57 121 GO:0046872
AF-A0A2G4ISK0-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9575 7 123 GO:0046872
AF-A0A356VU18-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.956 6 118 GO:0016853
GO:0046872
AF-A0A537BM05-F1-model_v4 DUF971 domain-containing protein 0.9541 9 111 GO:0046872
AF-A0A2E2TH02-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9507 11 115 GO:0046872

Map