F449853

General Info

Members Datasets Scaffolds Average Seq Length
467 211 934 238

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10028250|Ga0157371_100282503
Length 247
Sequence LTGLVTRFQFFKTSYNLDNQDIIIRAATPADKVYAKTITDEMESSAKARGTGIAKRTPEYIEQKIDEGKAVIALTNNGTWVGFCYIETWEGEYVANSGLIVSPEFRKGGVAKKIKERVFALSREKYPEAKIFGLTTGLAVMKINSDLGYEPVTYSELTQDEKFWAGCKSCVNYDILMSKERKNCLCTAMLYDPKDHYEPKETKEFFEKKSKVLERLLQLKQXXXXNRLKRINSNPSRFRSLFNFFNL

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 2738541284 Pedobacter sp. YR016 Isolate Unclassified
211 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.28
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 1.93
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10028250 3300013102 Bacteria 4063
2 JGI24740J21852_10006938 3300001979 Bacteria 4650
3 rootH2_10133812 3300003320 Bacteria 1851
4 rootH1_10079096 3300003323 Bacteria 3607
5 Ga0065704_10084719 3300005289 Bacteria 3304
6 Ga0070658_10326823 3300005327 Bacteria 1310
7 Ga0070676_10104583 3300005328 Bacteria 1754
8 Ga0070683_100065330 3300005329 Bacteria 3388
9 Ga0070670_100015632 3300005331 Bacteria 6517
10 Ga0070670_100032500 3300005331 Bacteria 4494
11 Ga0070670_100079914 3300005331 Bacteria 2810
12 Ga0070677_10013518 3300005333 Bacteria 2857
13 Ga0068869_100244053 3300005334 Bacteria 1432
14 Ga0070666_10000323 3300005335 Bacteria 30548
15 Ga0070666_10002946 3300005335 Bacteria 10304
16 Ga0070666_10094762 3300005335 Bacteria 2054
17 Ga0070666_10295853 3300005335 Unclassified 1152
18 Ga0070680_100024474 3300005336 Bacteria 4824
19 Ga0070680_100537288 3300005336 Bacteria 1001
20 Ga0070682_100035359 3300005337 Bacteria 3050
21 Ga0070682_100065777 3300005337 Bacteria 2305
22 Ga0070682_100207929 3300005337 Bacteria 1385
23 Ga0070682_100262760 3300005337 Bacteria 1250
24 Ga0068868_100047119 3300005338 Bacteria 3376
25 Ga0068868_100277611 3300005338 Bacteria 1417
26 Ga0068868_100294625 3300005338 Bacteria 1376
27 Ga0070660_100158187 3300005339 Bacteria 1825
28 Ga0070660_100259399 3300005339 Bacteria 1419
29 Ga0070691_10000660 3300005341 Bacteria 13368
30 Ga0070661_100415802 3300005344 Bacteria 1065
31 Ga0070668_100023632 3300005347 Bacteria 4651
32 Ga0070669_100839823 3300005353 Bacteria 782
33 Ga0070675_100198031 3300005354 Bacteria 1743
34 Ga0070675_100602085 3300005354 Bacteria 997
35 Ga0070671_100030050 3300005355 Bacteria 4483
36 Ga0070671_100195512 3300005355 Bacteria 1715
37 Ga0070671_100274520 3300005355 Bacteria 1433
38 Ga0070674_100155041 3300005356 Bacteria 1732
39 Ga0070673_100018686 3300005364 Bacteria 4959
40 Ga0070688_100381447 3300005365 Bacteria 1039
41 Ga0070659_100046527 3300005366 Bacteria 3401
42 Ga0070659_100072138 3300005366 Bacteria 2747
43 Ga0070659_100579400 3300005366 Bacteria 963
44 Ga0070667_100029886 3300005367 Bacteria 4543
45 Ga0070667_100065818 3300005367 Bacteria 3078
46 Ga0070667_100150720 3300005367 Bacteria 2043
47 Ga0070667_100309721 3300005367 Bacteria 1423
48 Ga0070663_100273622 3300005455 Bacteria 1343
49 Ga0070678_100004999 3300005456 Bacteria 7599
50 Ga0070678_100196839 3300005456 Bacteria 1660
51 Ga0070678_100251932 3300005456 Bacteria 1481
52 Ga0070662_100112509 3300005457 Bacteria 2076
53 Ga0070681_10017068 3300005458 Bacteria 7255
54 Ga0070681_10036428 3300005458 Bacteria 4940
55 Ga0068867_100289369 3300005459 Bacteria 1346
56 Ga0070685_10104443 3300005466 Bacteria 1735
57 Ga0070706_100525984 3300005467 Bacteria 1100
58 Ga0070698_100002644 3300005471 Bacteria 19745
59 Ga0070698_100119798 3300005471 Bacteria 2592
60 Ga0070679_100025505 3300005530 Bacteria 5802
61 Ga0070679_100030821 3300005530 Bacteria 5298
62 Ga0070679_100042499 3300005530 Bacteria 4527
63 Ga0070679_100135740 3300005530 Bacteria 2441
64 Ga0070679_100324862 3300005530 Bacteria 1487
65 Ga0070679_100389087 3300005530 Bacteria 1341
66 Ga0070684_100544084 3300005535 Bacteria 1077
67 Ga0068853_100028221 3300005539 Bacteria 4719
68 Ga0068853_100037520 3300005539 Bacteria 4123
69 Ga0068853_100049652 3300005539 Bacteria 3606
70 Ga0068853_100199936 3300005539 Bacteria 1819
71 Ga0068853_100227190 3300005539 Bacteria 1706
72 Ga0068853_100465652 3300005539 Bacteria 1190
73 Ga0068853_100590824 3300005539 Bacteria 1054
74 Ga0070672_100088231 3300005543 Bacteria 2497
75 Ga0070686_100404324 3300005544 Bacteria 1039
76 Ga0070693_100013199 3300005547 Bacteria 4203
77 Ga0070693_100394156 3300005547 Bacteria 958
78 Ga0070665_100144492 3300005548 Bacteria 2382
79 Ga0068855_100011561 3300005563 Bacteria 10660
80 Ga0068855_100033375 3300005563 Bacteria 6143
81 Ga0068855_100048633 3300005563 Bacteria 5004
82 Ga0068855_100066337 3300005563 Bacteria 4208
83 Ga0068855_100315972 3300005563 Bacteria 1727
84 Ga0070664_100096230 3300005564 Bacteria 2569
85 Ga0068857_100270700 3300005577 Bacteria 1561
86 Ga0068857_100313351 3300005577 Bacteria 1448
87 Ga0068854_100007137 3300005578 Bacteria 7133
88 Ga0068854_100159069 3300005578 Bacteria 1748
89 Ga0068854_100380301 3300005578 Bacteria 1163
90 Ga0068856_100059201 3300005614 Bacteria 3783
91 Ga0068856_100225706 3300005614 Unclassified 1888
92 Ga0068852_100007591 3300005616 Bacteria 7929
93 Ga0068852_100035370 3300005616 Bacteria 4166
94 Ga0068852_100108281 3300005616 Bacteria 2522
95 Ga0068852_100126883 3300005616 Bacteria 2344
96 Ga0068852_100681542 3300005616 Bacteria 1037
97 Ga0068859_100000106 3300005617 Bacteria 78128
98 Ga0068859_100161995 3300005617 Unclassified 2316
99 Ga0068859_100198308 3300005617 Bacteria 2091
100 Ga0068859_100815047 3300005617 Bacteria 1020
101 Ga0068864_100011427 3300005618 Bacteria 7334
102 Ga0068864_100112394 3300005618 Bacteria 2428
103 Ga0068864_100134365 3300005618 Bacteria 2226
104 Ga0068864_100185389 3300005618 Bacteria 1904
105 Ga0068864_100548692 3300005618 Unclassified 1117
106 Ga0068866_10055738 3300005718 Bacteria 2031
107 Ga0068866_10115435 3300005718 Bacteria 1505
108 Ga0068861_100051713 3300005719 Bacteria 3120
109 Ga0068861_100435331 3300005719 Bacteria 1171
110 Ga0068870_10001668 3300005840 Bacteria 9086
111 Ga0068863_100006081 3300005841 Bacteria 11840
112 Ga0068863_100032496 3300005841 Bacteria 4975
113 Ga0068863_100604498 3300005841 Bacteria 1085
114 Ga0068858_100006822 3300005842 Bacteria 11107
115 Ga0068860_100009409 3300005843 Bacteria 9711
116 Ga0068860_100011027 3300005843 Bacteria 8911
117 Ga0068860_100041827 3300005843 Bacteria 4378
118 Ga0068862_100076920 3300005844 Bacteria 2889
119 Ga0068862_100142298 3300005844 Bacteria 2130
120 Ga0075366_10021509 3300006195 Bacteria 3750
121 Ga0097621_100000531 3300006237 Bacteria 26760
122 Ga0097621_100127517 3300006237 Bacteria 2162
123 Ga0097621_100240994 3300006237 Bacteria 1581
124 Ga0097621_100307749 3300006237 Bacteria 1401
125 Ga0097621_100465768 3300006237 Bacteria 1140
126 Ga0097621_100517449 3300006237 Bacteria 1083
127 Ga0068871_100000042 3300006358 Bacteria 67951
128 Ga0068871_100002902 3300006358 Bacteria 11755
129 Ga0068871_100007280 3300006358 Bacteria 7894
130 Ga0068871_100255655 3300006358 Bacteria 1527
131 Ga0075428_100520960 3300006844 Bacteria 1272
132 Ga0075430_100004975 3300006846 Bacteria 11184
133 Ga0075430_100200560 3300006846 Bacteria 1657
134 Ga0075431_100026391 3300006847 Bacteria 5960
135 Ga0075429_100149016 3300006880 Bacteria 2048
136 Ga0097620_100000106 3300006931 Bacteria 78128
137 Ga0097620_100161995 3300006931 Unclassified 2316
138 Ga0097620_100198316 3300006931 Bacteria 2091
139 Ga0097620_100815067 3300006931 Bacteria 1020
140 Ga0105240_10000037 3300009093 Bacteria 270462
141 Ga0105240_10005515 3300009093 Bacteria 18851
142 Ga0105240_10043261 3300009093 Bacteria 5732
143 Ga0105240_10113999 3300009093 Bacteria 3266
144 Ga0111539_10017967 3300009094 Bacteria 8760
145 Ga0105245_10037011 3300009098 Bacteria 4337
146 Ga0105247_10000918 3300009101 Bacteria 22128
147 Ga0114129_10503772 3300009147 Bacteria 1581
148 Ga0105243_10221448 3300009148 Bacteria 1673
149 Ga0105241_10001462 3300009174 Bacteria 18113
150 Ga0105241_10002922 3300009174 Bacteria 12760
151 Ga0105241_10003042 3300009174 Bacteria 12514
152 Ga0105241_10117728 3300009174 Bacteria 2135
153 Ga0105241_10250858 3300009174 Bacteria 1500
154 Ga0105242_10086686 3300009176 Bacteria 2628
155 Ga0105242_10191145 3300009176 Bacteria 1812
156 Ga0105242_10303336 3300009176 Bacteria 1458
157 Ga0105248_10004482 3300009177 Bacteria 15453
158 Ga0105237_10002321 3300009545 Bacteria 23628
159 Ga0105237_10003093 3300009545 Bacteria 20049
160 Ga0105237_10016605 3300009545 Bacteria 7646
161 Ga0105249_10002137 3300009553 Bacteria 17128
162 Ga0105249_10019422 3300009553 Bacteria 6064
163 Ga0105249_10024010 3300009553 Bacteria 5476
164 Ga0105249_10198919 3300009553 Bacteria 1960
165 Ga0105249_10455166 3300009553 Unclassified 1319
166 Ga0105249_10699592 3300009553 Bacteria 1073
167 Ga0105239_10024908 3300010375 Bacteria 6590
168 Ga0105239_10025175 3300010375 Bacteria 6554
169 Ga0105239_10265060 3300010375 Bacteria 1931
170 Ga0105239_10676483 3300010375 Bacteria 1179
171 Ga0105246_10096705 3300011119 Bacteria 2141
172 Ga0105246_10132580 3300011119 Bacteria 1863
173 Ga0157373_10001318 3300013100 Bacteria 18986
174 Ga0157373_10012361 3300013100 Bacteria 6277
175 Ga0157373_10024469 3300013100 Bacteria 4373
176 Ga0157373_10033565 3300013100 Bacteria 3691
177 Ga0157373_10279465 3300013100 Bacteria 1183
178 Ga0157371_10000741 3300013102 Bacteria 38124
179 Ga0157371_10003861 3300013102 Bacteria 13371
180 Ga0157371_10012994 3300013102 Bacteria 6339
181 Ga0157371_10016536 3300013102 Bacteria 5501
182 Ga0157371_10018024 3300013102 Bacteria 5229
183 Ga0157371_10022302 3300013102 Bacteria 4643
184 Ga0157371_10303530 3300013102 Bacteria 1156
185 Ga0157371_10321731 3300013102 Bacteria 1123
186 Ga0157370_10003143 3300013104 Bacteria 19558
187 Ga0157370_10003785 3300013104 Bacteria 17653
188 Ga0157370_10005554 3300013104 Bacteria 14133
189 Ga0157370_10018487 3300013104 Bacteria 7006
190 Ga0157370_10074869 3300013104 Bacteria 3193
191 Ga0157370_10114926 3300013104 Bacteria 2514
192 Ga0157370_10262733 3300013104 Unclassified 1595
193 Ga0157370_10345238 3300013104 Bacteria 1372
194 Ga0157370_10571045 3300013104 Bacteria 1036
195 Ga0157370_10851671 3300013104 Bacteria 828
196 Ga0157369_10009363 3300013105 Bacteria 11200
197 Ga0157369_10019087 3300013105 Bacteria 7676
198 Ga0157374_10068905 3300013296 Bacteria 3330
199 Ga0157374_10174220 3300013296 Bacteria 2100
200 Ga0157374_10214452 3300013296 Bacteria 1888
201 Ga0157374_10358287 3300013296 Bacteria 1450
202 Ga0157378_10040421 3300013297 Bacteria 4135
203 Ga0157378_10064746 3300013297 Unclassified 3271
204 Ga0157378_10067407 3300013297 Bacteria 3207
205 Ga0157378_10103217 3300013297 Bacteria 2605
206 Ga0157378_10204344 3300013297 Bacteria 1870
207 Ga0163162_10001265 3300013306 Bacteria 23633
208 Ga0163162_10002681 3300013306 Bacteria 16870
209 Ga0163162_10111176 3300013306 Bacteria 2837
210 Ga0163162_10128295 3300013306 Bacteria 2644
211 Ga0163162_10142026 3300013306 Bacteria 2515
212 Ga0163162_10427654 3300013306 Bacteria 1456
213 Ga0163162_11041581 3300013306 Bacteria 926
214 Ga0157372_10014060 3300013307 Bacteria 8549
215 Ga0157372_10047384 3300013307 Bacteria 4776
216 Ga0157372_10104350 3300013307 Bacteria 3240
217 Ga0157372_10315675 3300013307 Bacteria 1819
218 Ga0157372_10413567 3300013307 Bacteria 1572
219 Ga0157372_10442381 3300013307 Bacteria 1515
220 Ga0157372_10564903 3300013307 Bacteria 1326
221 Ga0157375_10000182 3300013308 Bacteria 59120
222 Ga0157375_10178516 3300013308 Bacteria 2274
223 Ga0157375_10180085 3300013308 Bacteria 2264
224 Ga0157375_10190571 3300013308 Bacteria 2205
225 Ga0157375_10293635 3300013308 Bacteria 1789
226 Ga0157375_10295855 3300013308 Bacteria 1782
227 Ga0157375_10439668 3300013308 Bacteria 1470
228 Ga0157375_10938655 3300013308 Unclassified 1007
229 Ga0163163_10069653 3300014325 Bacteria 3502
230 Ga0163163_10219372 3300014325 Bacteria 1950
231 Ga0157377_10194552 3300014745 Bacteria 1283
232 Ga0157379_10015886 3300014968 Bacteria 6617
233 Ga0157379_10019354 3300014968 Bacteria 6012
234 Ga0157376_10002418 3300014969 Bacteria 12621
235 Ga0157376_10005152 3300014969 Bacteria 9116
236 Ga0157376_10178734 3300014969 Bacteria 1938
237 Ga0157376_10250467 3300014969 Bacteria 1654
238 Ga0157376_10590307 3300014969 Bacteria 1104
239 Ga0157376_10632937 3300014969 Bacteria 1068
240 Ga0163161_10020838 3300017792 Bacteria 4604
241 Ga0163161_10028180 3300017792 Bacteria 3986
242 Ga0163161_10517263 3300017792 Bacteria 974
243 Ga0207656_10039157 3300025321 Bacteria 2003
244 Ga0207682_10039285 3300025893 Bacteria 1923
245 Ga0207682_10098388 3300025893 Bacteria 1276
246 Ga0207688_10002010 3300025901 Bacteria 10907
247 Ga0207680_10000125 3300025903 Bacteria 35925
248 Ga0207680_10070285 3300025903 Bacteria 2166
249 Ga0207680_10236890 3300025903 Bacteria 1256
250 Ga0207647_10080289 3300025904 Bacteria 1956
251 Ga0207685_10110881 3300025905 Bacteria 1189
252 Ga0207645_10002278 3300025907 Bacteria 15224
253 Ga0207645_10124472 3300025907 Bacteria 1675
254 Ga0207643_10027418 3300025908 Bacteria 3158
255 Ga0207705_10030795 3300025909 Bacteria 3829
256 Ga0207705_10049636 3300025909 Bacteria 3020
257 Ga0207705_10066747 3300025909 Bacteria 2603
258 Ga0207705_10200577 3300025909 Bacteria 1512
259 Ga0207654_10003790 3300025911 Bacteria 7624
260 Ga0207654_10005359 3300025911 Bacteria 6480
261 Ga0207654_10031761 3300025911 Bacteria 2911
262 Ga0207654_10054274 3300025911 Bacteria 2316
263 Ga0207707_10000160 3300025912 Bacteria 70695
264 Ga0207707_10108687 3300025912 Unclassified 2425
265 Ga0207707_10816281 3300025912 Unclassified 776
266 Ga0207695_10000092 3300025913 Bacteria 270514
267 Ga0207695_10002404 3300025913 Bacteria 27705
268 Ga0207695_10006542 3300025913 Bacteria 15089
269 Ga0207671_10007245 3300025914 Bacteria 9660
270 Ga0207671_10032471 3300025914 Bacteria 3886
271 Ga0207660_10001905 3300025917 Bacteria 13897
272 Ga0207660_10024790 3300025917 Bacteria 4063
273 Ga0207660_10036737 3300025917 Bacteria 3407
274 Ga0207660_10168167 3300025917 Unclassified 1696
275 Ga0207657_10015945 3300025919 Bacteria 7259
276 Ga0207657_10063853 3300025919 Bacteria 3146
277 Ga0207657_10121681 3300025919 Bacteria 2147
278 Ga0207657_10194961 3300025919 Bacteria 1632
279 Ga0207657_10267767 3300025919 Bacteria 1359
280 Ga0207652_10000029 3300025921 Bacteria 149054
281 Ga0207652_10000115 3300025921 Bacteria 87927
282 Ga0207652_10000406 3300025921 Bacteria 44756
283 Ga0207652_10000961 3300025921 Bacteria 26939
284 Ga0207652_10048100 3300025921 Bacteria 3645
285 Ga0207652_10054962 3300025921 Bacteria 3423
286 Ga0207652_10067110 3300025921 Bacteria 3110
287 Ga0207652_10389649 3300025921 Bacteria 1257
288 Ga0207681_10102685 3300025923 Bacteria 2065
289 Ga0207659_10331869 3300025926 Bacteria 1258
290 Ga0207687_10083371 3300025927 Bacteria 2314
291 Ga0207644_10020232 3300025931 Bacteria 4523
292 Ga0207644_10191608 3300025931 Unclassified 1608
293 Ga0207690_10106967 3300025932 Bacteria 2008
294 Ga0207690_10212596 3300025932 Bacteria 1475
295 Ga0207706_10219389 3300025933 Bacteria 1665
296 Ga0207686_10100784 3300025934 Bacteria 1927
297 Ga0207686_10199803 3300025934 Bacteria 1431
298 Ga0207709_10265488 3300025935 Bacteria 1261
299 Ga0207670_10098549 3300025936 Unclassified 2083
300 Ga0207691_10005078 3300025940 Bacteria 12705
301 Ga0207691_10108403 3300025940 Bacteria 2472
302 Ga0207691_10145549 3300025940 Bacteria 2086
303 Ga0207691_10336995 3300025940 Bacteria 1291
304 Ga0207711_10049439 3300025941 Bacteria 3601
305 Ga0207689_10000360 3300025942 Bacteria 42854
306 Ga0207689_10001010 3300025942 Bacteria 27038
307 Ga0207689_10026464 3300025942 Bacteria 4857
308 Ga0207689_10235184 3300025942 Bacteria 1514
309 Ga0207689_10307588 3300025942 Bacteria 1314
310 Ga0207661_10409570 3300025944 Bacteria 1230
311 Ga0207679_10049336 3300025945 Bacteria 3071
312 Ga0207679_10289152 3300025945 Bacteria 1408
313 Ga0207667_10005373 3300025949 Bacteria 15618
314 Ga0207667_10009279 3300025949 Bacteria 11610
315 Ga0207667_10092593 3300025949 Bacteria 3122
316 Ga0207667_10190650 3300025949 Bacteria 2103
317 Ga0207651_10017358 3300025960 Bacteria 4251
318 Ga0207712_10001164 3300025961 Bacteria 18264
319 Ga0207712_10011162 3300025961 Bacteria 5720
320 Ga0207712_10050010 3300025961 Bacteria 2917
321 Ga0207712_10342528 3300025961 Unclassified 1240
322 Ga0207668_10110762 3300025972 Bacteria 2059
323 Ga0207668_10167943 3300025972 Bacteria 1718
324 Ga0207640_10043174 3300025981 Bacteria 2880
325 Ga0207640_10138059 3300025981 Bacteria 1773
326 Ga0207658_10056798 3300025986 Bacteria 2906
327 Ga0207658_10057653 3300025986 Bacteria 2887
328 Ga0207658_10083804 3300025986 Bacteria 2452
329 Ga0207658_10393454 3300025986 Bacteria 1217
330 Ga0207658_10638431 3300025986 Bacteria 959
331 Ga0207677_10227342 3300026023 Bacteria 1500
332 Ga0207677_10602130 3300026023 Bacteria 964
333 Ga0207703_10001922 3300026035 Bacteria 18410
334 Ga0207639_10020682 3300026041 Bacteria 4714
335 Ga0207639_10026346 3300026041 Bacteria 4226
336 Ga0207639_10056788 3300026041 Bacteria 3002
337 Ga0207639_10068769 3300026041 Bacteria 2760
338 Ga0207639_10180650 3300026041 Bacteria 1794
339 Ga0207639_10187440 3300026041 Bacteria 1764
340 Ga0207639_10420574 3300026041 Bacteria 1208
341 Ga0207639_10478770 3300026041 Bacteria 1134
342 Ga0207639_10629600 3300026041 Bacteria 991
343 Ga0207708_10360012 3300026075 Bacteria 1195
344 Ga0207708_10626815 3300026075 Bacteria 913
345 Ga0207702_10029417 3300026078 Bacteria 4570
346 Ga0207702_10076949 3300026078 Bacteria 2884
347 Ga0207641_10000082 3300026088 Bacteria 138385
348 Ga0207641_10021690 3300026088 Bacteria 5278
349 Ga0207641_10082894 3300026088 Bacteria 2787
350 Ga0207641_10336869 3300026088 Bacteria 1434
351 Ga0207641_10639858 3300026088 Bacteria 1044
352 Ga0207648_10001709 3300026089 Bacteria 24030
353 Ga0207648_10015449 3300026089 Bacteria 7022
354 Ga0207648_10204952 3300026089 Bacteria 1750
355 Ga0207648_10301983 3300026089 Bacteria 1436
356 Ga0207676_10007584 3300026095 Bacteria 7700
357 Ga0207676_10007982 3300026095 Bacteria 7526
358 Ga0207676_10294585 3300026095 Bacteria 1479
359 Ga0207674_10069416 3300026116 Bacteria 3544
360 Ga0207674_10138924 3300026116 Bacteria 2390
361 Ga0207674_10149872 3300026116 Bacteria 2290
362 Ga0207674_10157231 3300026116 Bacteria 2228
363 Ga0207674_10375686 3300026116 Bacteria 1374
364 Ga0207675_100025419 3300026118 Bacteria 5512
365 Ga0207675_100039652 3300026118 Bacteria 4395
366 Ga0207675_100176101 3300026118 Unclassified 2046
367 Ga0207675_100600880 3300026118 Bacteria 1103
368 Ga0207683_10000974 3300026121 Bacteria 26229
369 Ga0207683_10146886 3300026121 Bacteria 2127
370 Ga0207683_10533961 3300026121 Bacteria 1084
371 Ga0207698_10009220 3300026142 Bacteria 6279
372 Ga0207698_10057254 3300026142 Unclassified 3015
373 Ga0207698_10272574 3300026142 Bacteria 1561
374 Ga0207698_10361615 3300026142 Bacteria 1375
375 Ga0268265_10007650 3300028380 Bacteria 7291
376 Ga0268265_10274726 3300028380 Bacteria 1505
377 Ga0268264_10005919 3300028381 Bacteria 10351
378 Ga0268264_10011786 3300028381 Bacteria 7208
379 Ga0268264_10059634 3300028381 Bacteria 3197
380 Ga0268264_10116650 3300028381 Bacteria 2347
381 Ga0307515_10000190 3300028794 Bacteria 150300
382 Ga0265324_10013758 3300029957 Bacteria 3010
383 Ga0307513_10312842 3300031456 Bacteria 1332
384 Ga0307509_10036852 3300031507 Bacteria 5351
385 Ga0307509_10047226 3300031507 Bacteria 4632
386 Ga0307509_10238451 3300031507 Bacteria 1614
387 Ga0307408_100119552 3300031548 Unclassified 2039
388 Ga0307410_10222070 3300031852 Unclassified 1454
389 Ga0307406_10239911 3300031901 Unclassified 1359
390 Ga0307414_10001064 3300032004 Bacteria 14054
391 Ga0373927_0021777 3300035695 Bacteria 4201
392 Ga0395899_0002144 3300037312 Bacteria 16228
393 Ga0395899_0031560 3300037312 Bacteria 3981
394 Ga0395899_0069966 3300037312 Bacteria 2568
395 Ga0395899_0420106 3300037312 Bacteria 881
396 Ga0395900_0005622 3300037418 Bacteria 13110
397 Ga0395900_0327559 3300037418 Bacteria 1510
398 Ga0395898_0009304 3300037466 Bacteria 10331
399 Ga0395898_0031676 3300037466 Bacteria 5281
400 Ga0395901_0002351 3300038443 Bacteria 19230
401 Ga0395901_0014642 3300038443 Bacteria 7970
402 Ga0451802_1088219 3300041460 Unclassified 1019
403 Ga0439446_0065926 3300042156 Bacteria 1101
404 Ga0450893_0002717 3300042532 Bacteria 2769
405 Ga0453683_0209770 3300044673 Bacteria 1237
406 Ga0466970_0000495 3300044765 Bacteria 19372
407 Ga0466970_0080061 3300044765 Bacteria 1765
408 Ga0451576_0005169 3300045051 Bacteria 16516
409 Ga0466967_0124880 3300045976 Bacteria 2383
410 Ga0495650_0021678 3300046471 Bacteria 3096
411 Ga0495630_0423778 3300046517 Bacteria 1020
412 Ga0495598_0082795 3300046537 Unclassified 1033
413 Ga0495668_0000257 3300046616 Bacteria 75166
414 Ga0495625_0175042 3300046660 Bacteria 1430
415 Ga0495657_0412712 3300046675 Bacteria 793
416 Ga0496100_0169261 3300048903 Bacteria 1572
417 Ga0496101_0026933 3300048904 Bacteria 3998
418 Ga0496102_0246588 3300048905 Bacteria 1684
419 Ga0496105_0141546 3300048908 Bacteria 1980
420 Ga0496110_0225553 3300048913 Bacteria 1704
421 Ga0496114_0079646 3300048917 Bacteria 2766
422 Ga0496115_0140334 3300048918 Bacteria 1994
423 Ga0496115_0289205 3300048918 Bacteria 1345
424 Ga0501306_009025 3300049127 Bacteria 1229
425 Ga0501308_004676 3300049128 Bacteria 1332
426 Ga0501309_008559 3300049129 Bacteria 1290
427 Ga0501305_006051 3300049161 Bacteria 1491
428 Ga0501312_008974 3300049528 Bacteria 1309
429 Ga0501315_002569 3300049531 Bacteria 1725
430 Ga0501034_0159697 3300049571 Bacteria 2226
431 Ga0501034_0423257 3300049571 Bacteria 1252
432 Ga0501036_0687914 3300049572 Bacteria 845
433 Ga0501043_0025390 3300049579 Bacteria 4649
434 Ga0501043_0254252 3300049579 Unclassified 1353
435 Ga0501046_0032815 3300049580 Bacteria 4201
436 Ga0501047_0042862 3300049581 Bacteria 4372
437 Ga0501047_0251904 3300049581 Bacteria 1614
438 Ga0501067_0006775 3300049583 Bacteria 6354
439 Ga0501069_0025041 3300049585 Bacteria 3259
440 Ga0501070_0203541 3300049586 Bacteria 1625
441 Ga0501070_0315477 3300049586 Bacteria 1272
442 Ga0501071_0214811 3300049587 Bacteria 1447
443 Ga0501073_0169463 3300049589 Bacteria 1511
444 Ga0501074_0086774 3300049590 Bacteria 2242
445 Ga0501202_005968 3300049652 Bacteria 2167
446 Ga0501210_000224 3300049657 Bacteria 2337
447 Ga0501217_052831 3300049661 Bacteria 1067
448 Ga0501236_014175 3300049670 Bacteria 1100
449 Ga0501257_020666 3300049686 Bacteria 1548
450 Ga0501221_060492 3300049704 Bacteria 875
451 Ga0501083_0007152 3300049744 Bacteria 7922
452 Ga0501264_001173 3300049761 Bacteria 3052
453 Ga0501035_0085782 3300049822 Bacteria 2775
454 Ga0501035_0264132 3300049822 Unclassified 1458
455 Ga0501044_0122501 3300049823 Bacteria 2600
456 Ga0501044_0159239 3300049823 Bacteria 2236
457 Ga0501044_0447161 3300049823 Bacteria 1199
458 nmdc:mga0k408_125535_c1 3300050493 Bacteria 1522
459 nmdc:mga05p37_410298_c1 3300050507 Bacteria 1579
460 nmdc:mga0qj67_32376_c1 3300050509 Bacteria 4077
461 nmdc:mga06r32_70338_c1 3300050510 Bacteria 3384
462 Ga0500604_0010748 3300053151 Bacteria 2452
463 Ga0500622_0000155 3300053156 Bacteria 72050
464 Ga0501084_0093786 3300054114 Bacteria 2520
465 Ga0501082_0126052 3300060353 Bacteria 2220
466 2738761463 2738541284 Bacteria 5199923
467 2881957555 2881955468 Bacteria 3545609
468 Ga0157371_10028250
469 JGI24740J21852_10006938
470 rootH2_10133812
471 rootH1_10079096
472 Ga0065704_10084719
473 Ga0070658_10326823
474 Ga0070676_10104583
475 Ga0070683_100065330
476 Ga0070670_100015632
477 Ga0070670_100032500
478 Ga0070670_100079914
479 Ga0070677_10013518
480 Ga0068869_100244053
481 Ga0070666_10000323
482 Ga0070666_10002946
483 Ga0070666_10094762
484 Ga0070666_10295853
485 Ga0070680_100024474
486 Ga0070680_100537288
487 Ga0070682_100035359
488 Ga0070682_100065777
489 Ga0070682_100207929
490 Ga0070682_100262760
491 Ga0068868_100047119
492 Ga0068868_100277611
493 Ga0068868_100294625
494 Ga0070660_100158187
495 Ga0070660_100259399
496 Ga0070691_10000660
497 Ga0070661_100415802
498 Ga0070668_100023632
499 Ga0070669_100839823
500 Ga0070675_100198031
501 Ga0070675_100602085
502 Ga0070671_100030050
503 Ga0070671_100195512
504 Ga0070671_100274520
505 Ga0070674_100155041
506 Ga0070673_100018686
507 Ga0070688_100381447
508 Ga0070659_100046527
509 Ga0070659_100072138
510 Ga0070659_100579400
511 Ga0070667_100029886
512 Ga0070667_100065818
513 Ga0070667_100150720
514 Ga0070667_100309721
515 Ga0070663_100273622
516 Ga0070678_100004999
517 Ga0070678_100196839
518 Ga0070678_100251932
519 Ga0070662_100112509
520 Ga0070681_10017068
521 Ga0070681_10036428
522 Ga0068867_100289369
523 Ga0070685_10104443
524 Ga0070706_100525984
525 Ga0070698_100002644
526 Ga0070698_100119798
527 Ga0070679_100025505
528 Ga0070679_100030821
529 Ga0070679_100042499
530 Ga0070679_100135740
531 Ga0070679_100324862
532 Ga0070679_100389087
533 Ga0070684_100544084
534 Ga0068853_100028221
535 Ga0068853_100037520
536 Ga0068853_100049652
537 Ga0068853_100199936
538 Ga0068853_100227190
539 Ga0068853_100465652
540 Ga0068853_100590824
541 Ga0070672_100088231
542 Ga0070686_100404324
543 Ga0070693_100013199
544 Ga0070693_100394156
545 Ga0070665_100144492
546 Ga0068855_100011561
547 Ga0068855_100033375
548 Ga0068855_100048633
549 Ga0068855_100066337
550 Ga0068855_100315972
551 Ga0070664_100096230
552 Ga0068857_100270700
553 Ga0068857_100313351
554 Ga0068854_100007137
555 Ga0068854_100159069
556 Ga0068854_100380301
557 Ga0068856_100059201
558 Ga0068856_100225706
559 Ga0068852_100007591
560 Ga0068852_100035370
561 Ga0068852_100108281
562 Ga0068852_100126883
563 Ga0068852_100681542
564 Ga0068859_100000106
565 Ga0068859_100161995
566 Ga0068859_100198308
567 Ga0068859_100815047
568 Ga0068864_100011427
569 Ga0068864_100112394
570 Ga0068864_100134365
571 Ga0068864_100185389
572 Ga0068864_100548692
573 Ga0068866_10055738
574 Ga0068866_10115435
575 Ga0068861_100051713
576 Ga0068861_100435331
577 Ga0068870_10001668
578 Ga0068863_100006081
579 Ga0068863_100032496
580 Ga0068863_100604498
581 Ga0068858_100006822
582 Ga0068860_100009409
583 Ga0068860_100011027
584 Ga0068860_100041827
585 Ga0068862_100076920
586 Ga0068862_100142298
587 Ga0075366_10021509
588 Ga0097621_100000531
589 Ga0097621_100127517
590 Ga0097621_100240994
591 Ga0097621_100307749
592 Ga0097621_100465768
593 Ga0097621_100517449
594 Ga0068871_100000042
595 Ga0068871_100002902
596 Ga0068871_100007280
597 Ga0068871_100255655
598 Ga0075428_100520960
599 Ga0075430_100004975
600 Ga0075430_100200560
601 Ga0075431_100026391
602 Ga0075429_100149016
603 Ga0097620_100000106
604 Ga0097620_100161995
605 Ga0097620_100198316
606 Ga0097620_100815067
607 Ga0105240_10000037
608 Ga0105240_10005515
609 Ga0105240_10043261
610 Ga0105240_10113999
611 Ga0111539_10017967
612 Ga0105245_10037011
613 Ga0105247_10000918
614 Ga0114129_10503772
615 Ga0105243_10221448
616 Ga0105241_10001462
617 Ga0105241_10002922
618 Ga0105241_10003042
619 Ga0105241_10117728
620 Ga0105241_10250858
621 Ga0105242_10086686
622 Ga0105242_10191145
623 Ga0105242_10303336
624 Ga0105248_10004482
625 Ga0105237_10002321
626 Ga0105237_10003093
627 Ga0105237_10016605
628 Ga0105249_10002137
629 Ga0105249_10019422
630 Ga0105249_10024010
631 Ga0105249_10198919
632 Ga0105249_10455166
633 Ga0105249_10699592
634 Ga0105239_10024908
635 Ga0105239_10025175
636 Ga0105239_10265060
637 Ga0105239_10676483
638 Ga0105246_10096705
639 Ga0105246_10132580
640 Ga0157373_10001318
641 Ga0157373_10012361
642 Ga0157373_10024469
643 Ga0157373_10033565
644 Ga0157373_10279465
645 Ga0157371_10000741
646 Ga0157371_10003861
647 Ga0157371_10012994
648 Ga0157371_10016536
649 Ga0157371_10018024
650 Ga0157371_10022302
651 Ga0157371_10303530
652 Ga0157371_10321731
653 Ga0157370_10003143
654 Ga0157370_10003785
655 Ga0157370_10005554
656 Ga0157370_10018487
657 Ga0157370_10074869
658 Ga0157370_10114926
659 Ga0157370_10262733
660 Ga0157370_10345238
661 Ga0157370_10571045
662 Ga0157370_10851671
663 Ga0157369_10009363
664 Ga0157369_10019087
665 Ga0157374_10068905
666 Ga0157374_10174220
667 Ga0157374_10214452
668 Ga0157374_10358287
669 Ga0157378_10040421
670 Ga0157378_10064746
671 Ga0157378_10067407
672 Ga0157378_10103217
673 Ga0157378_10204344
674 Ga0163162_10001265
675 Ga0163162_10002681
676 Ga0163162_10111176
677 Ga0163162_10128295
678 Ga0163162_10142026
679 Ga0163162_10427654
680 Ga0163162_11041581
681 Ga0157372_10014060
682 Ga0157372_10047384
683 Ga0157372_10104350
684 Ga0157372_10315675
685 Ga0157372_10413567
686 Ga0157372_10442381
687 Ga0157372_10564903
688 Ga0157375_10000182
689 Ga0157375_10178516
690 Ga0157375_10180085
691 Ga0157375_10190571
692 Ga0157375_10293635
693 Ga0157375_10295855
694 Ga0157375_10439668
695 Ga0157375_10938655
696 Ga0163163_10069653
697 Ga0163163_10219372
698 Ga0157377_10194552
699 Ga0157379_10015886
700 Ga0157379_10019354
701 Ga0157376_10002418
702 Ga0157376_10005152
703 Ga0157376_10178734
704 Ga0157376_10250467
705 Ga0157376_10590307
706 Ga0157376_10632937
707 Ga0163161_10020838
708 Ga0163161_10028180
709 Ga0163161_10517263
710 Ga0207656_10039157
711 Ga0207682_10039285
712 Ga0207682_10098388
713 Ga0207688_10002010
714 Ga0207680_10000125
715 Ga0207680_10070285
716 Ga0207680_10236890
717 Ga0207647_10080289
718 Ga0207685_10110881
719 Ga0207645_10002278
720 Ga0207645_10124472
721 Ga0207643_10027418
722 Ga0207705_10030795
723 Ga0207705_10049636
724 Ga0207705_10066747
725 Ga0207705_10200577
726 Ga0207654_10003790
727 Ga0207654_10005359
728 Ga0207654_10031761
729 Ga0207654_10054274
730 Ga0207707_10000160
731 Ga0207707_10108687
732 Ga0207707_10816281
733 Ga0207695_10000092
734 Ga0207695_10002404
735 Ga0207695_10006542
736 Ga0207671_10007245
737 Ga0207671_10032471
738 Ga0207660_10001905
739 Ga0207660_10024790
740 Ga0207660_10036737
741 Ga0207660_10168167
742 Ga0207657_10015945
743 Ga0207657_10063853
744 Ga0207657_10121681
745 Ga0207657_10194961
746 Ga0207657_10267767
747 Ga0207652_10000029
748 Ga0207652_10000115
749 Ga0207652_10000406
750 Ga0207652_10000961
751 Ga0207652_10048100
752 Ga0207652_10054962
753 Ga0207652_10067110
754 Ga0207652_10389649
755 Ga0207681_10102685
756 Ga0207659_10331869
757 Ga0207687_10083371
758 Ga0207644_10020232
759 Ga0207644_10191608
760 Ga0207690_10106967
761 Ga0207690_10212596
762 Ga0207706_10219389
763 Ga0207686_10100784
764 Ga0207686_10199803
765 Ga0207709_10265488
766 Ga0207670_10098549
767 Ga0207691_10005078
768 Ga0207691_10108403
769 Ga0207691_10145549
770 Ga0207691_10336995
771 Ga0207711_10049439
772 Ga0207689_10000360
773 Ga0207689_10001010
774 Ga0207689_10026464
775 Ga0207689_10235184
776 Ga0207689_10307588
777 Ga0207661_10409570
778 Ga0207679_10049336
779 Ga0207679_10289152
780 Ga0207667_10005373
781 Ga0207667_10009279
782 Ga0207667_10092593
783 Ga0207667_10190650
784 Ga0207651_10017358
785 Ga0207712_10001164
786 Ga0207712_10011162
787 Ga0207712_10050010
788 Ga0207712_10342528
789 Ga0207668_10110762
790 Ga0207668_10167943
791 Ga0207640_10043174
792 Ga0207640_10138059
793 Ga0207658_10056798
794 Ga0207658_10057653
795 Ga0207658_10083804
796 Ga0207658_10393454
797 Ga0207658_10638431
798 Ga0207677_10227342
799 Ga0207677_10602130
800 Ga0207703_10001922
801 Ga0207639_10020682
802 Ga0207639_10026346
803 Ga0207639_10056788
804 Ga0207639_10068769
805 Ga0207639_10180650
806 Ga0207639_10187440
807 Ga0207639_10420574
808 Ga0207639_10478770
809 Ga0207639_10629600
810 Ga0207708_10360012
811 Ga0207708_10626815
812 Ga0207702_10029417
813 Ga0207702_10076949
814 Ga0207641_10000082
815 Ga0207641_10021690
816 Ga0207641_10082894
817 Ga0207641_10336869
818 Ga0207641_10639858
819 Ga0207648_10001709
820 Ga0207648_10015449
821 Ga0207648_10204952
822 Ga0207648_10301983
823 Ga0207676_10007584
824 Ga0207676_10007982
825 Ga0207676_10294585
826 Ga0207674_10069416
827 Ga0207674_10138924
828 Ga0207674_10149872
829 Ga0207674_10157231
830 Ga0207674_10375686
831 Ga0207675_100025419
832 Ga0207675_100039652
833 Ga0207675_100176101
834 Ga0207675_100600880
835 Ga0207683_10000974
836 Ga0207683_10146886
837 Ga0207683_10533961
838 Ga0207698_10009220
839 Ga0207698_10057254
840 Ga0207698_10272574
841 Ga0207698_10361615
842 Ga0268265_10007650
843 Ga0268265_10274726
844 Ga0268264_10005919
845 Ga0268264_10011786
846 Ga0268264_10059634
847 Ga0268264_10116650
848 Ga0307515_10000190
849 Ga0265324_10013758
850 Ga0307513_10312842
851 Ga0307509_10036852
852 Ga0307509_10047226
853 Ga0307509_10238451
854 Ga0307408_100119552
855 Ga0307410_10222070
856 Ga0307406_10239911
857 Ga0307414_10001064
858 Ga0373927_0021777
859 Ga0395899_0002144
860 Ga0395899_0031560
861 Ga0395899_0069966
862 Ga0395899_0420106
863 Ga0395900_0005622
864 Ga0395900_0327559
865 Ga0395898_0009304
866 Ga0395898_0031676
867 Ga0395901_0002351
868 Ga0395901_0014642
869 Ga0451802_1088219
870 Ga0439446_0065926
871 Ga0450893_0002717
872 Ga0453683_0209770
873 Ga0466970_0000495
874 Ga0466970_0080061
875 Ga0451576_0005169
876 Ga0466967_0124880
877 Ga0495650_0021678
878 Ga0495630_0423778
879 Ga0495598_0082795
880 Ga0495668_0000257
881 Ga0495625_0175042
882 Ga0495657_0412712
883 Ga0496100_0169261
884 Ga0496101_0026933
885 Ga0496102_0246588
886 Ga0496105_0141546
887 Ga0496110_0225553
888 Ga0496114_0079646
889 Ga0496115_0140334
890 Ga0496115_0289205
891 Ga0501306_009025
892 Ga0501308_004676
893 Ga0501309_008559
894 Ga0501305_006051
895 Ga0501312_008974
896 Ga0501315_002569
897 Ga0501034_0159697
898 Ga0501034_0423257
899 Ga0501036_0687914
900 Ga0501043_0025390
901 Ga0501043_0254252
902 Ga0501046_0032815
903 Ga0501047_0042862
904 Ga0501047_0251904
905 Ga0501067_0006775
906 Ga0501069_0025041
907 Ga0501070_0203541
908 Ga0501070_0315477
909 Ga0501071_0214811
910 Ga0501073_0169463
911 Ga0501074_0086774
912 Ga0501202_005968
913 Ga0501210_000224
914 Ga0501217_052831
915 Ga0501236_014175
916 Ga0501257_020666
917 Ga0501221_060492
918 Ga0501083_0007152
919 Ga0501264_001173
920 Ga0501035_0085782
921 Ga0501035_0264132
922 Ga0501044_0122501
923 Ga0501044_0159239
924 Ga0501044_0447161
925 nmdc:mga0k408_125535_c1
926 nmdc:mga05p37_410298_c1
927 nmdc:mga0qj67_32376_c1
928 nmdc:mga06r32_70338_c1
929 Ga0500604_0010748
930 Ga0500622_0000155
931 Ga0501084_0093786
932 Ga0501082_0126052
933 2738761463
934 2881957555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

39

139

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.8381 54 138
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.8185 6 143
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8103 53 118
3b8g-assembly1.cif.gz_A crysta structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and n-acetyl-glutamate 0.7835 6 177
2i79-assembly3.cif.gz_D the crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae 0.783 6 138
ID Description Score Start End Superfamily
af_Q19835_80_302_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8999 53 105 3.40.630.30
af_K7KKJ3_19_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8725 62 109 3.40.630.30
af_C6KTC5_112_283_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.852 59 137 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8381 54 138 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8293 65 109 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W1PSK2-F1-model_v4 GNAT family N-acetyltransferase 0.9763 6 111 GO:0016747
AF-A0A537JEU5-F1-model_v4 GNAT family N-acetyltransferase 0.976 27 152 GO:0016747
AF-A0A661Y4J0-F1-model_v4 GNAT family N-acetyltransferase 0.962 6 148 GO:0016747
AF-A0A537JEU5-F1-model_v4 GNAT family N-acetyltransferase 0.9611 27 152 GO:0016747
AF-A0A644ZY24-F1-model_v4 N-acetyltransferase domain-containing protein 0.9563 50 129

Map