F449868

General Info

Members Datasets Scaffolds Average Seq Length
467 281 404 316

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10003754|Ga0207671_100037547
Length 366
Sequence LRVCNSVLRRSFSIDLIFLLIPDLHFVYFFINAVLTKYPPFFYLCQNRILMTEKIVVLGSNGQIGTELVTALRKTYGESNVVACDIRRPDYDIKNAGPFEFVNVLEKETLNSIFQKYKPTQVYLLAALLSATGEQNPKLAWDLNMNGLLNILDLALVYKTAKVYWPSSIAVFGPNSPKDQTPQFCVMDPNTVYGISKLAGERWCEYYHQKYGLDVRSIRYPGLISWKAAPGGGTTDYAIHIFHDALKKGGYSSFLSAETELPMMYMDDAIRGTIELMDAEASKISIRSSYNFGGVSFTPEVLAAEIRKHIPEFKLTYTENDPRQQIANSWPRSIDDSFAAKDWAWKPEFDLAKMTIDMLDNLKSSK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541283 Pedobacter sp. OK701 Isolate Unclassified
12 2738541284 Pedobacter sp. YR016 Isolate Unclassified
13 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
14 2738541302 Pedobacter sp. CF074 Isolate Unclassified
15 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
16 2738543023 Pedobacter sp. OK628 Isolate Unclassified
17 2739367651 Pedobacter sp. OK291 Isolate Unclassified
18 2739367656 Pedobacter sp. CF523 Isolate Unclassified
19 2739367663 Pedobacter sp. YR510 Isolate Unclassified
20 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
21 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
22 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
23 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
24 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
25 2818991437 Pedobacter terrae 518 Isolate Unclassified
26 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
27 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
28 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
29 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
30 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
31 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
32 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
33 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
34 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
35 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
36 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
37 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
38 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
39 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
40 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
41 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
42 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
43 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
44 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
45 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
46 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
47 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
48 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
49 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
50 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
51 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
52 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
53 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
54 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
55 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
56 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
57 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
58 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
151 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
152 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
263 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
264 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
265 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
277 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
278 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
279 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
280 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
281 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.87
Metatranscriptomes 0.64
Isolates 13.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 1.07
Rhizoplane 0.64
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2612864 2162886007 Bacteria 20804
2 SwRhRL2b_contig_2963908 2162886007 Bacteria 27528
3 SwRhRL2b_contig_3539523 2162886007 Bacteria 1267
4 2214800792 2209111006 Bacteria 2068
5 JGI24737J22298_10000406 3300001990 Bacteria 14738
6 JGI25162J39368_1000130 3300002737 Bacteria 83005
7 JGI25157J39369_1003942 3300002741 Bacteria 2845
8 JGI25152J39213_1000143 3300002773 Bacteria 48715
9 JGI25152J39213_1000208 3300002773 Bacteria 39726
10 JGI25150J39212_1000001 3300002774 Bacteria 1318726
11 JGI25150J39212_1000014 3300002774 Bacteria 170955
12 JGI25151J46595_10000001 3300003187 Bacteria 887211
13 JGI25151J46595_10000042 3300003187 Bacteria 170955
14 JGI25153J46596_10000001 3300003215 Bacteria 748985
15 JGI25153J46596_10000009 3300003215 Bacteria 340925
16 rootL2_10035926 3300003322 Bacteria 9354
17 rootL2_10137384 3300003322 Bacteria 2371
18 rootH1_10040582 3300003323 Bacteria 11491
19 rootH1_10138582 3300003323 Bacteria 1492
20 Ga0055536_1000019 3300003781 Bacteria 203087
21 Ga0065714_10002330 3300005288 Bacteria 30957
22 Ga0065714_10002519 3300005288 Bacteria 28238
23 Ga0065714_10002572 3300005288 Bacteria 21257
24 Ga0065714_10003280 3300005288 Bacteria 26984
25 Ga0065714_10003842 3300005288 Bacteria 6217
26 Ga0065714_10008294 3300005288 Bacteria 2885
27 Ga0065714_10072597 3300005288 Bacteria 3338
28 Ga0065714_10104906 3300005288 Bacteria 1576
29 Ga0065704_10000253 3300005289 Bacteria 50631
30 Ga0065704_10070251 3300005289 Bacteria 48366
31 Ga0065704_10085810 3300005289 Bacteria 3184
32 Ga0065704_10099909 3300005289 Bacteria 2292
33 Ga0065704_10125123 3300005289 Bacteria 1708
34 Ga0065715_10010416 3300005293 Bacteria 2808
35 Ga0065715_10179655 3300005293 Bacteria 1486
36 Ga0070658_10034425 3300005327 Bacteria 4075
37 Ga0070680_100150201 3300005336 Bacteria 1955
38 Ga0070659_100004699 3300005366 Bacteria 9749
39 Ga0070659_100186346 3300005366 Bacteria 1705
40 Ga0070681_10100583 3300005458 Bacteria 2837
41 Ga0068867_100003170 3300005459 Bacteria 11601
42 Ga0070679_100464730 3300005530 Bacteria 1210
43 Ga0070684_100037966 3300005535 Bacteria 4135
44 Ga0068855_100000049 3300005563 Bacteria 145321
45 Ga0068855_100000342 3300005563 Bacteria 57870
46 Ga0068855_100019577 3300005563 Bacteria 8129
47 Ga0068855_100070045 3300005563 Bacteria 4081
48 Ga0070664_100405251 3300005564 Bacteria 1247
49 Ga0068856_100000021 3300005614 Bacteria 145017
50 Ga0068856_100000056 3300005614 Bacteria 102483
51 Ga0068856_100060342 3300005614 Bacteria 3747
52 Ga0068856_100121808 3300005614 Unclassified 2610
53 Ga0068861_100176378 3300005719 Unclassified 1775
54 Ga0068851_10000199 3300005834 Bacteria 28976
55 Ga0068858_100120418 3300005842 Bacteria 2454
56 Ga0070712_100096467 3300006175 Unclassified 2177
57 Ga0097621_100000235 3300006237 Bacteria 37163
58 Ga0097621_100252054 3300006237 Bacteria 1546
59 Ga0068871_100004160 3300006358 Bacteria 10017
60 Ga0099824_1000074 3300006942 Bacteria 70834
61 Ga0079104_1000570 3300006946 Bacteria 37376
62 Ga0099826_10000224 3300006948 Bacteria 24740
63 Ga0105244_10000065 3300009036 Bacteria 121781
64 Ga0105244_10083364 3300009036 Bacteria 1580
65 Ga0105240_10029147 3300009093 Bacteria 7198
66 Ga0105240_10594408 3300009093 Bacteria 1219
67 Ga0105243_10000003 3300009148 Bacteria 712931
68 Ga0105243_10074449 3300009148 Bacteria 2754
69 Ga0105241_10000852 3300009174 Bacteria 23137
70 Ga0105241_10004746 3300009174 Bacteria 10017
71 Ga0105242_10090919 3300009176 Bacteria 2569
72 Ga0105237_10003774 3300009545 Bacteria 17832
73 Ga0105237_10061570 3300009545 Bacteria 3752
74 Ga0105237_10092015 3300009545 Bacteria 3023
75 Ga0105238_10426167 3300009551 Bacteria 1322
76 Ga0105238_10645606 3300009551 Bacteria 1068
77 Ga0105249_10330417 3300009553 Bacteria 1538
78 Ga0105239_10000690 3300010375 Bacteria 48107
79 Ga0105239_10001435 3300010375 Bacteria 31777
80 Ga0105246_10000127 3300011119 Bacteria 35078
81 Ga0157373_10000003 3300013100 Bacteria 454601
82 Ga0157373_10000601 3300013100 Bacteria 27966
83 Ga0157373_10001710 3300013100 Bacteria 16689
84 Ga0157373_10002057 3300013100 Bacteria 15242
85 Ga0157373_10012353 3300013100 Bacteria 6279
86 Ga0157373_10044364 3300013100 Bacteria 3174
87 Ga0157371_10000220 3300013102 Bacteria 83813
88 Ga0157371_10000486 3300013102 Bacteria 48340
89 Ga0157371_10000978 3300013102 Bacteria 31762
90 Ga0157371_10001175 3300013102 Bacteria 28108
91 Ga0157371_10023728 3300013102 Bacteria 4484
92 Ga0157371_10024550 3300013102 Bacteria 4399
93 Ga0157371_10047997 3300013102 Bacteria 3035
94 Ga0157371_10066415 3300013102 Bacteria 2553
95 Ga0157370_10000166 3300013104 Bacteria 81040
96 Ga0157370_10001057 3300013104 Bacteria 34651
97 Ga0157370_10001184 3300013104 Bacteria 32508
98 Ga0157370_10001842 3300013104 Bacteria 26149
99 Ga0157370_10005530 3300013104 Bacteria 14165
100 Ga0157370_10006405 3300013104 Bacteria 12983
101 Ga0157370_10017747 3300013104 Bacteria 7173
102 Ga0157370_10022458 3300013104 Bacteria 6277
103 Ga0157370_10024548 3300013104 Bacteria 5970
104 Ga0157370_10030706 3300013104 Bacteria 5264
105 Ga0157370_10046327 3300013104 Bacteria 4169
106 Ga0157370_10047974 3300013104 Bacteria 4092
107 Ga0157370_10062648 3300013104 Bacteria 3526
108 Ga0157370_10068910 3300013104 Bacteria 3342
109 Ga0157370_10081225 3300013104 Bacteria 3050
110 Ga0157370_10082314 3300013104 Bacteria 3027
111 Ga0157370_10126117 3300013104 Bacteria 2389
112 Ga0157370_10134997 3300013104 Bacteria 2300
113 Ga0157370_10151781 3300013104 Bacteria 2156
114 Ga0157369_10000031 3300013105 Bacteria 203214
115 Ga0157369_10006222 3300013105 Bacteria 13851
116 Ga0157369_10045120 3300013105 Bacteria 4795
117 Ga0157369_10065570 3300013105 Bacteria 3908
118 Ga0157369_10072722 3300013105 Bacteria 3690
119 Ga0157374_10000125 3300013296 Bacteria 70183
120 Ga0157374_10000550 3300013296 Bacteria 33496
121 Ga0163162_10000227 3300013306 Bacteria 51464
122 Ga0163162_10043680 3300013306 Bacteria 4488
123 Ga0163162_10073416 3300013306 Bacteria 3477
124 Ga0157372_10005103 3300013307 Bacteria 13960
125 Ga0157375_10038421 3300013308 Bacteria 4597
126 Ga0157375_10141723 3300013308 Bacteria 2531
127 Ga0157380_10087582 3300014326 Bacteria 2561
128 Ga0182008_10000014 3300014497 Bacteria 263844
129 Ga0182008_10000021 3300014497 Bacteria 227140
130 Ga0182008_10000555 3300014497 Bacteria 27671
131 Ga0182008_10005283 3300014497 Bacteria 7380
132 Ga0182008_10022591 3300014497 Bacteria 3221
133 Ga0182008_10034959 3300014497 Bacteria 2518
134 Ga0182008_10095434 3300014497 Bacteria 1467
135 Ga0182006_1000173 3300015261 Bacteria 67776
136 Ga0182006_1002116 3300015261 Bacteria 11079
137 Ga0182006_1003188 3300015261 Bacteria 8548
138 Ga0182006_1004518 3300015261 Bacteria 6849
139 Ga0182006_1010374 3300015261 Bacteria 4143
140 Ga0182006_1012418 3300015261 Bacteria 3724
141 Ga0182007_10000002 3300015262 Bacteria 564661
142 Ga0182007_10007767 3300015262 Bacteria 4460
143 Ga0183373_1004 3300015682 Bacteria 537398
144 Ga0163161_10000033 3300017792 Bacteria 163809
145 Ga0163161_10000445 3300017792 Bacteria 34489
146 Ga0163161_10000465 3300017792 Bacteria 33670
147 Ga0163161_10008855 3300017792 Bacteria 6959
148 Ga0163161_10034596 3300017792 Bacteria 3615
149 Ga0163161_10053872 3300017792 Bacteria 2918
150 Ga0163161_10296214 3300017792 Bacteria 1273
151 Ga0206351_10787581 3300020077 Bacteria 1423
152 Ga0206350_10940938 3300020080 Bacteria 1409
153 Ga0209437_100089 3300025233 Bacteria 250476
154 Ga0207425_1000002 3300025245 Bacteria 1362590
155 Ga0207425_1000023 3300025245 Bacteria 341339
156 Ga0209026_1000310 3300025250 Bacteria 52783
157 Ga0209026_1002050 3300025250 Bacteria 7957
158 Ga0209129_1000002 3300025258 Bacteria 1359086
159 Ga0209129_1000032 3300025258 Bacteria 341150
160 Ga0209676_1000009 3300025292 Bacteria 981719
161 Ga0209025_1000004 3300025294 Bacteria 1361782
162 Ga0209025_1000047 3300025294 Bacteria 341150
163 Ga0209758_1000006 3300025297 Bacteria 1359562
164 Ga0209758_1000145 3300025297 Bacteria 170553
165 Ga0209050_1000094 3300025298 Bacteria 242893
166 Ga0207656_10000320 3300025321 Bacteria 16514
167 Ga0207655_1000003 3300025728 Bacteria 1081376
168 Ga0207647_10107612 3300025904 Bacteria 1650
169 Ga0207705_10003593 3300025909 Bacteria 11816
170 Ga0207654_10038514 3300025911 Bacteria 2683
171 Ga0207654_10039137 3300025911 Bacteria 2665
172 Ga0207654_10322804 3300025911 Bacteria 1056
173 Ga0207695_10002519 3300025913 Bacteria 26912
174 Ga0207695_10457793 3300025913 Bacteria 1159
175 Ga0207671_10003754 3300025914 Bacteria 14953
176 Ga0207671_10004438 3300025914 Bacteria 13418
177 Ga0207671_10052210 3300025914 Bacteria 3029
178 Ga0207660_10008586 3300025917 Bacteria 6610
179 Ga0207657_10059625 3300025919 Bacteria 3277
180 Ga0207652_10033090 3300025921 Bacteria 4351
181 Ga0207690_10146098 3300025932 Bacteria 1748
182 Ga0207706_10000009 3300025933 Bacteria 200607
183 Ga0207686_10035491 3300025934 Bacteria 2994
184 Ga0207709_10000008 3300025935 Bacteria 713099
185 Ga0207709_10102247 3300025935 Bacteria 1897
186 Ga0207689_10437781 3300025942 Bacteria 1092
187 Ga0207679_10111953 3300025945 Bacteria 2156
188 Ga0207667_10000015 3300025949 Bacteria 417534
189 Ga0207667_10001910 3300025949 Bacteria 26166
190 Ga0207667_10028156 3300025949 Bacteria 6104
191 Ga0207667_10154085 3300025949 Bacteria 2365
192 Ga0207677_10152853 3300026023 Bacteria 1783
193 Ga0207702_10000515 3300026078 Bacteria 43571
194 Ga0207702_10028112 3300026078 Bacteria 4672
195 Ga0207702_10042272 3300026078 Bacteria 3823
196 Ga0207702_10043780 3300026078 Bacteria 3760
197 Ga0207648_10355632 3300026089 Bacteria 1321
198 Ga0207698_10395471 3300026142 Bacteria 1319
199 Ga0209281_1000392 3300027111 Bacteria 68425
200 Ga0209984_1005057 3300027424 Bacteria 1573
201 Ga0210002_1006523 3300027617 Bacteria 1762
202 Ga0209282_1001017 3300027666 Bacteria 14745
203 Ga0307515_10019786 3300028794 Bacteria 12078
204 Ga0316176_1217528 3300030732 Bacteria 11800
205 Ga0316183_1126062 3300030742 Bacteria 44101
206 Ga0316181_1121975 3300030744 Bacteria 30956
207 Ga0265327_10000545 3300031251 Bacteria 64273
208 Ga0307509_10073552 3300031507 Bacteria 3558
209 Ga0307408_100001496 3300031548 Bacteria 17333
210 Ga0307408_100006358 3300031548 Bacteria 7838
211 Ga0307408_100033871 3300031548 Bacteria 3572
212 Ga0307405_10000001 3300031731 Bacteria 1731270
213 Ga0307405_10000015 3300031731 Bacteria 206299
214 Ga0307405_10012358 3300031731 Bacteria 4516
215 Ga0307413_10000014 3300031824 Bacteria 49146
216 Ga0307410_10000127 3300031852 Bacteria 27161
217 Ga0307406_10000042 3300031901 Bacteria 72211
218 Ga0307406_10013710 3300031901 Bacteria 4649
219 Ga0307407_10000027 3300031903 Bacteria 107307
220 Ga0307412_10000043 3300031911 Bacteria 166562
221 Ga0307412_10000091 3300031911 Bacteria 78460
222 Ga0307412_10096839 3300031911 Bacteria 2078
223 Ga0307409_100015011 3300031995 Bacteria 5065
224 Ga0307416_100000002 3300032002 Bacteria 509907
225 Ga0307416_100000411 3300032002 Bacteria 21858
226 Ga0307414_10000022 3300032004 Bacteria 212123
227 Ga0307414_10001947 3300032004 Bacteria 10683
228 Ga0307414_10002905 3300032004 Bacteria 9061
229 Ga0307414_10012073 3300032004 Bacteria 5096
230 Ga0307414_10020005 3300032004 Bacteria 4162
231 Ga0307414_10023850 3300032004 Bacteria 3888
232 Ga0307414_10039923 3300032004 Bacteria 3166
233 Ga0307414_10057180 3300032004 Bacteria 2740
234 Ga0307414_10124398 3300032004 Bacteria 1989
235 Ga0307411_10000003 3300032005 Bacteria 477556
236 Ga0307411_10033297 3300032005 Bacteria 3195
237 Ga0316574_0094878 3300035398 Bacteria 1906
238 Ga0316574_0276821 3300035398 Bacteria 1069
239 Ga0316582_0085982 3300036647 Archaea 2062
240 Ga0395899_0003633 3300037312 Bacteria 12209
241 Ga0395899_0009347 3300037312 Bacteria 7531
242 Ga0395899_0031883 3300037312 Bacteria 3960
243 Ga0395900_0015815 3300037418 Bacteria 7690
244 Ga0395900_0068446 3300037418 Bacteria 3648
245 Ga0395905_0000001 3300037471 Bacteria 2037079
246 Ga0395901_0002993 3300038443 Bacteria 17046
247 Ga0395901_0082767 3300038443 Bacteria 3353
248 Ga0395901_0091596 3300038443 Bacteria 3182
249 Ga0439466_0001094 3300041411 Bacteria 10526
250 Ga0439448_0000942 3300042005 Bacteria 7164
251 Ga0451577_0110868 3300042876 Bacteria 2455
252 Ga0451577_0156229 3300042876 Unclassified 2053
253 Ga0466969_0048424 3300044656 Bacteria 2101
254 Ga0466972_0000549 3300044658 Bacteria 18404
255 Ga0466965_0010665 3300044683 Bacteria 4294
256 Ga0466965_0010964 3300044683 Bacteria 4239
257 Ga0466965_0093362 3300044683 Bacteria 1532
258 Ga0466966_0040892 3300044684 Bacteria 2981
259 Ga0466961_0033309 3300044693 Bacteria 3311
260 Ga0466961_0148220 3300044693 Bacteria 1466
261 Ga0466963_0004918 3300044694 Bacteria 7792
262 Ga0466964_0007587 3300044706 Bacteria 4058
263 Ga0466964_0080733 3300044706 Bacteria 1395
264 Ga0453684_0000370 3300044712 Bacteria 184579
265 Ga0453684_0006212 3300044712 Bacteria 22908
266 Ga0453684_0148382 3300044712 Bacteria 2790
267 Ga0453684_0178225 3300044712 Bacteria 2497
268 Ga0466971_0007139 3300044719 Bacteria 4862
269 Ga0466971_0094836 3300044719 Bacteria 1368
270 Ga0466971_0114814 3300044719 Bacteria 1244
271 Ga0466968_0013957 3300044735 Bacteria 3167
272 Ga0466970_0157766 3300044765 Bacteria 1254
273 Ga0466957_0000081 3300044842 Bacteria 38526
274 Ga0466959_0197808 3300045049 Bacteria 1400
275 Ga0451576_0007647 3300045051 Bacteria 12849
276 Ga0466958_0065867 3300045836 Bacteria 2211
277 Ga0466967_0139945 3300045976 Bacteria 2253
278 Ga0495627_033717 3300046453 Bacteria 1604
279 Ga0495590_0013581 3300046457 Bacteria 2989
280 Ga0495653_0020513 3300046463 Bacteria 5357
281 Ga0495650_0000003 3300046471 Bacteria 900730
282 Ga0495580_0009317 3300046472 Bacteria 7726
283 Ga0495582_0011545 3300046473 Bacteria 4866
284 Ga0495584_0000001 3300046491 Bacteria 649329
285 Ga0495584_0020970 3300046491 Bacteria 3318
286 Ga0495585_0002110 3300046492 Bacteria 14539
287 Ga0495585_0018479 3300046492 Bacteria 4019
288 Ga0495594_0006151 3300046499 Bacteria 6171
289 Ga0495594_0042218 3300046499 Bacteria 2497
290 Ga0495607_0025710 3300046501 Bacteria 3659
291 Ga0495606_0000163 3300046507 Bacteria 117268
292 Ga0495606_0014484 3300046507 Bacteria 6149
293 Ga0495606_0036031 3300046507 Bacteria 3376
294 Ga0495606_0065637 3300046507 Bacteria 2305
295 Ga0495606_0151264 3300046507 Bacteria 1362
296 Ga0495610_0000232 3300046512 Bacteria 59379
297 Ga0495610_0002155 3300046512 Bacteria 16749
298 Ga0495610_0005169 3300046512 Bacteria 9351
299 Ga0495630_0068702 3300046517 Bacteria 2665
300 Ga0495637_0033516 3300046520 Bacteria 2255
301 Ga0495637_0080202 3300046520 Bacteria 1302
302 Ga0495643_0000987 3300046522 Bacteria 29153
303 Ga0495666_0000465 3300046526 Bacteria 18043
304 Ga0495642_0107479 3300046528 Unclassified 1191
305 Ga0495652_0047594 3300046529 Bacteria 3677
306 Ga0495665_0003619 3300046531 Bacteria 8383
307 Ga0495640_0138610 3300046533 Bacteria 1569
308 Ga0495586_0018668 3300046535 Bacteria 3691
309 Ga0495586_0080938 3300046535 Bacteria 1784
310 Ga0495587_0171936 3300046536 Bacteria 1230
311 Ga0495609_0007309 3300046538 Bacteria 5527
312 Ga0495609_0036667 3300046538 Bacteria 2213
313 Ga0495622_0014572 3300046557 Bacteria 3651
314 Ga0495622_0053052 3300046557 Bacteria 1881
315 Ga0495633_0030732 3300046558 Bacteria 2607
316 Ga0495668_0061729 3300046616 Bacteria 2067
317 Ga0495634_0007098 3300046642 Bacteria 8448
318 Ga0495611_0026879 3300046648 Bacteria 2512
319 Ga0495625_0000005 3300046660 Bacteria 596135
320 Ga0495625_0032879 3300046660 Bacteria 3840
321 Ga0495625_0064158 3300046660 Bacteria 2592
322 Ga0495661_0002680 3300046665 Bacteria 13617
323 Ga0495661_0003022 3300046665 Bacteria 12676
324 Ga0495661_0041779 3300046665 Bacteria 2833
325 Ga0495588_0000041 3300046674 Bacteria 377896
326 Ga0495588_0011194 3300046674 Bacteria 4202
327 Ga0495623_0015422 3300046679 Bacteria 4939
328 Ga0495646_0105680 3300046680 Bacteria 1608
329 Ga0495670_0012613 3300046691 Bacteria 4156
330 Ga0495649_0000003 3300046694 Bacteria 880817
331 Ga0495600_0031380 3300046809 Bacteria 3442
332 Ga0495660_0100867 3300046810 Bacteria 1486
333 Ga0495581_0052639 3300047315 Bacteria 2351
334 Ga0495604_0021685 3300047317 Bacteria 5128
335 Ga0495604_0144009 3300047317 Bacteria 1700
336 Ga0495636_0001256 3300047318 Bacteria 9606
337 Ga0495680_0029119 3300047322 Bacteria 4524
338 Ga0495680_0117096 3300047322 Bacteria 1970
339 Ga0495683_0031563 3300047323 Bacteria 2700
340 Ga0495675_0147071 3300047444 Bacteria 1457
341 Ga0495681_0001529 3300047470 Bacteria 17264
342 Ga0495686_0000146 3300047472 Bacteria 141435
343 Ga0495686_0000783 3300047472 Bacteria 41638
344 Ga0495686_0005080 3300047472 Bacteria 10533
345 Ga0495593_0021374 3300047673 Bacteria 3616
346 Ga0495602_0052132 3300048088 Bacteria 3637
347 Ga0495614_0038753 3300048089 Bacteria 2045
348 Ga0495626_0000027 3300048091 Bacteria 206022
349 Ga0496104_0091566 3300048907 Bacteria 2907
350 Ga0496113_0021155 3300048916 Bacteria 4586
351 Ga0496115_0008736 3300048918 Bacteria 7510
352 Ga0496116_0000002 3300048919 Bacteria 920291
353 Ga0496117_0001212 3300048920 Bacteria 38690
354 Ga0496117_0096131 3300048920 Bacteria 1891
355 Ga0496118_0073186 3300048921 Bacteria 2456
356 Ga0496118_0090940 3300048921 Bacteria 2101
357 Ga0496118_0117452 3300048921 Bacteria 1745
358 Ga0496121_0005787 3300048924 Bacteria 15687
359 Ga0496122_0000395 3300048925 Bacteria 92779
360 Ga0496122_0046398 3300048925 Bacteria 3365
361 Ga0496123_0005301 3300048926 Bacteria 13057
362 Ga0496123_0017462 3300048926 Bacteria 5769
363 Ga0496124_0030783 3300048927 Bacteria 4756
364 Ga0496124_0038361 3300048927 Bacteria 4161
365 Ga0496124_0121507 3300048927 Bacteria 2086
366 Ga0496124_0132859 3300048927 Bacteria 1975
367 Ga0496124_0288195 3300048927 Bacteria 1193
368 Ga0496125_0000007 3300048928 Bacteria 715355
369 Ga0496125_0000189 3300048928 Bacteria 133541
370 Ga0496125_0015714 3300048928 Bacteria 7301
371 Ga0496126_0010307 3300048929 Bacteria 9812
372 Ga0496126_0019255 3300048929 Bacteria 6726
373 Ga0496126_0118538 3300048929 Bacteria 2298
374 Ga0501031_0000216 3300049568 Bacteria 32978
375 Ga0501032_0002789 3300049569 Bacteria 13599
376 Ga0501033_0000004 3300049570 Bacteria 441310
377 Ga0501034_0000359 3300049571 Bacteria 77578
378 Ga0501034_0170134 3300049571 Bacteria 2146
379 Ga0501038_0005364 3300049574 Bacteria 11908
380 Ga0501039_0008766 3300049575 Bacteria 7705
381 Ga0501043_0000596 3300049579 Bacteria 31978
382 Ga0501047_0088586 3300049581 Bacteria 2972
383 Ga0501238_000001 3300049671 Bacteria 53504
384 Ga0501249_000002 3300049679 Bacteria 262756
385 Ga0501249_001698 3300049679 Bacteria 4487
386 Ga0501241_003934 3300049758 Bacteria 2795
387 Ga0501241_019816 3300049758 Bacteria 1236
388 Ga0501266_000003 3300049763 Bacteria 388836
389 Ga0501266_011723 3300049763 Bacteria 1125
390 Ga0501269_003942 3300049766 Bacteria 1787
391 Ga0501280_000229 3300049776 Bacteria 14118
392 Ga0501035_0005909 3300049822 Bacteria 11524
393 Ga0501044_0000468 3300049823 Bacteria 49110
394 Ga0501045_0000002 3300049824 Bacteria 94022
395 nmdc:mga0k408_313648_c1 3300050493 Bacteria 936
396 Ga0500646_0000601 3300053090 Bacteria 10362
397 Ga0500651_0001319 3300053093 Bacteria 12389
398 Ga0500651_0003645 3300053093 Bacteria 8464
399 Ga0500641_0000004 3300053096 Bacteria 263911
400 Ga0500641_0000057 3300053096 Bacteria 48444
401 Ga0500641_0011444 3300053096 Bacteria 3220
402 Ga0500618_000003 3300053125 Bacteria 338706
403 Ga0500658_0000001 3300053134 Bacteria 592738
404 Ga0587080_004681 3300059503 Bacteria 1795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10000601 Ga0157373_100006014 259
2 3300050493 nmdc:mga0k408_313648_c1 nmdc:mga0k408_313648_c1_117_899 259
3 3300046528 Ga0495642_0107479 Ga0495642_0107479_14_820 260
4 3300042876 Ga0451577_0110868 Ga0451577_0110868_26_841 266
5 3300013104 Ga0157370_10000166 Ga0157370_1000016676 283
6 3300014497 Ga0182008_10095434 Ga0182008_100954341 283
7 3300053096 Ga0500641_0000057 Ga0500641_0000057_38560_39510 283
8 3300048928 Ga0496125_0000189 Ga0496125_0000189_93588_94532 284
9 3300048929 Ga0496126_0010307 Ga0496126_0010307_1924_2868 284
10 3300048918 Ga0496115_0008736 Ga0496115_0008736_2798_3763 285
11 3300011119 Ga0105246_10000127 Ga0105246_100001279 288
12 3300005530 Ga0070679_100464730 Ga0070679_1004647301 291
13 3300044719 Ga0466971_0007139 Ga0466971_0007139_49_990 293
14 3300044765 Ga0466970_0157766 Ga0466970_0157766_139_1080 293
15 3300045049 Ga0466959_0197808 Ga0466959_0197808_374_1315 293
16 3300045836 Ga0466958_0065867 Ga0466958_0065867_41_982 293
17 3300046507 Ga0495606_0036031 Ga0495606_0036031_631_1566 293
18 3300046520 Ga0495637_0080202 Ga0495637_0080202_45_929 294
19 3300049571 Ga0501034_0170134 Ga0501034_0170134_396_1346 303
20 3300035398 Ga0316574_0094878 Ga0316574_0094878_422_1384 304
21 3300046660 Ga0495625_0064158 Ga0495625_0064158_75_1094 304
22 3300025904 Ga0207647_10107612 Ga0207647_101076122 305
23 3300031507 Ga0307509_10073552 Ga0307509_100735521 305
24 3300044712 Ga0453684_0148382 Ga0453684_0148382_723_1652 305
25 iso_pu_bacteria 3003233435 3003237309 305
26 iso_pu_bacteria 2887375801 2887379589 306
27 iso_pu_bacteria 2890737413 2890738441 306
28 iso_pu_bacteria 2896344016 2896347136 306
29 iso_pu_bacteria 2898713307 2898713881 306
30 iso_pu_bacteria 8055588893 8055590312 306
31 3300001990 JGI24737J22298_10000406 JGI24737J22298_1000040611 307
32 3300002737 JGI25162J39368_1000130 JGI25162J39368_100013053 307
33 3300003322 rootL2_10035926 rootL2_100359264 307
34 3300005719 Ga0068861_100176378 Ga0068861_1001763781 307
35 3300009545 Ga0105237_10061570 Ga0105237_100615703 307
36 3300009545 Ga0105237_10092015 Ga0105237_100920153 307
37 3300010375 Ga0105239_10000690 Ga0105239_1000069023 307
38 3300010375 Ga0105239_10001435 Ga0105239_1000143518 307
39 3300013102 Ga0157371_10024550 Ga0157371_100245502 307
40 3300013306 Ga0163162_10043680 Ga0163162_100436802 307
41 3300017792 Ga0163161_10008855 Ga0163161_100088552 307
42 3300025233 Ga0209437_100089 Ga0209437_10008924 307
43 3300025914 Ga0207671_10004438 Ga0207671_100044383 307
44 3300025914 Ga0207671_10052210 Ga0207671_100522101 307
45 3300042876 Ga0451577_0156229 Ga0451577_0156229_190_1128 307
46 3300044712 Ga0453684_0000370 Ga0453684_0000370_9645_10583 307
47 3300044712 Ga0453684_0006212 Ga0453684_0006212_18565_19506 307
48 3300046471 Ga0495650_0000003 Ga0495650_0000003_618366_619364 307
49 3300046492 Ga0495585_0002110 Ga0495585_0002110_9504_10502 307
50 3300046507 Ga0495606_0000163 Ga0495606_0000163_87373_88371 307
51 3300046507 Ga0495606_0151264 Ga0495606_0151264_116_1057 307
52 3300046512 Ga0495610_0005169 Ga0495610_0005169_7904_8902 307
53 3300046520 Ga0495637_0033516 Ga0495637_0033516_735_1733 307
54 3300046538 Ga0495609_0036667 Ga0495609_0036667_241_1239 307
55 3300046558 Ga0495633_0030732 Ga0495633_0030732_996_1994 307
56 3300046616 Ga0495668_0061729 Ga0495668_0061729_519_1517 307
57 3300046660 Ga0495625_0000005 Ga0495625_0000005_554550_555548 307
58 3300046665 Ga0495661_0002680 Ga0495661_0002680_11231_12229 307
59 3300046694 Ga0495649_0000003 Ga0495649_0000003_735309_736307 307
60 3300044712 Ga0453684_0178225 Ga0453684_0178225_32_979 308
61 3300045051 Ga0451576_0007647 Ga0451576_0007647_11020_11973 308
62 iso_pu_bacteria 2519899754 2520880622 308
63 iso_pu_bacteria 2643221600 2644011983 308
64 iso_pu_bacteria 2643221667 2644371414 308
65 iso_pu_bacteria 2643221725 2644682604 308
66 iso_pu_bacteria 2738541279 2738733765 308
67 iso_pu_bacteria 2738541285 2738766278 308
68 iso_pu_bacteria 2738543007 2739215346 308
69 iso_pu_bacteria 2739367857 2740000221 308
70 iso_pu_bacteria 2739367858 2740005037 308
71 iso_pu_bacteria 2802428842 2802651380 308
72 iso_pu_bacteria 2816332280 2817414267 308
73 iso_pu_bacteria 2857613821 2857618186 308
74 iso_pu_bacteria 2857618242 2857621531 308
75 iso_pu_bacteria 2881247448 2881248762 308
76 iso_pu_bacteria 2881359912 2881361548 308
77 iso_pu_bacteria 2903895155 2903895351 308
78 iso_pu_bacteria 2904419702 2904420255 308
79 iso_pu_bacteria 2904555929 2904557892 308
80 iso_pu_bacteria 2919191525 2919192540 308
81 iso_pu_bacteria 2919509842 2919510688 308
82 iso_pu_bacteria 2919683626 2919684038 308
83 iso_pu_bacteria 2929150217 2929151426 308
84 iso_pu_bacteria 2958458903 2958459688 308
85 iso_pu_bacteria 2965320100 2965321321 308
86 iso_pu_bacteria 2977268062 2977268119 308
87 iso_pu_bacteria 8054307821 8054309353 308
88 iso_pu_bacteria 8055419101 8055419973 308
89 iso_pu_bacteria 8055592153 8055596866 308
90 iso_pu_bacteria 8056440228 8056444324 308
91 3300030732 Ga0316176_1217528 Ga0316176_12175283 309
92 3300030742 Ga0316183_1126062 Ga0316183_11260622 309
93 3300030744 Ga0316181_1121975 Ga0316181_112197519 309
94 3300046457 Ga0495590_0013581 Ga0495590_0013581_1643_2596 309
95 3300046463 Ga0495653_0020513 Ga0495653_0020513_2688_3641 309
96 3300046472 Ga0495580_0009317 Ga0495580_0009317_4161_5114 309
97 3300046473 Ga0495582_0011545 Ga0495582_0011545_2211_3164 309
98 3300046499 Ga0495594_0042218 Ga0495594_0042218_1424_2377 309
99 3300046507 Ga0495606_0065637 Ga0495606_0065637_473_1426 309
100 3300046517 Ga0495630_0068702 Ga0495630_0068702_800_1753 309
101 3300046529 Ga0495652_0047594 Ga0495652_0047594_382_1335 309
102 3300046531 Ga0495665_0003619 Ga0495665_0003619_3806_4759 309
103 3300046535 Ga0495586_0018668 Ga0495586_0018668_1785_2738 309
104 3300046536 Ga0495587_0171936 Ga0495587_0171936_249_1202 309
105 3300046557 Ga0495622_0053052 Ga0495622_0053052_494_1447 309
106 3300046642 Ga0495634_0007098 Ga0495634_0007098_5305_6258 309
107 3300046679 Ga0495623_0015422 Ga0495623_0015422_2438_3391 309
108 3300046680 Ga0495646_0105680 Ga0495646_0105680_416_1369 309
109 3300046809 Ga0495600_0031380 Ga0495600_0031380_1929_2882 309
110 3300047317 Ga0495604_0021685 Ga0495604_0021685_680_1633 309
111 3300047322 Ga0495680_0029119 Ga0495680_0029119_569_1522 309
112 3300047472 Ga0495686_0000146 Ga0495686_0000146_140385_141344 309
113 3300048088 Ga0495602_0052132 Ga0495602_0052132_564_1517 309
114 3300048091 Ga0495626_0000027 Ga0495626_0000027_34313_35278 309
115 iso_pu_bacteria 2833640130 2833641997 309
116 iso_pu_bacteria 8036736890 8036739440 309
117 3300003322 rootL2_10137384 rootL2_101373842 310
118 3300005327 Ga0070658_10034425 Ga0070658_100344252 310
119 3300005366 Ga0070659_100186346 Ga0070659_1001863462 310
120 3300005563 Ga0068855_100019577 Ga0068855_1000195776 310
121 3300005564 Ga0070664_100405251 Ga0070664_1004052512 310
122 3300005834 Ga0068851_10000199 Ga0068851_1000019920 310
123 3300006175 Ga0070712_100096467 Ga0070712_1000964673 310
124 3300006237 Ga0097621_100252054 Ga0097621_1002520542 310
125 3300009036 Ga0105244_10083364 Ga0105244_100833641 310
126 3300009148 Ga0105243_10000003 Ga0105243_10000003147 310
127 3300009148 Ga0105243_10074449 Ga0105243_100744492 310
128 3300009176 Ga0105242_10090919 Ga0105242_100909192 310
129 3300009551 Ga0105238_10645606 Ga0105238_106456061 310
130 3300014326 Ga0157380_10087582 Ga0157380_100875822 310
131 3300020077 Ga0206351_10787581 Ga0206351_107875812 310
132 3300020080 Ga0206350_10940938 Ga0206350_109409382 310
133 3300025321 Ga0207656_10000320 Ga0207656_1000032011 310
134 3300025909 Ga0207705_10003593 Ga0207705_100035935 310
135 3300025911 Ga0207654_10322804 Ga0207654_103228041 310
136 3300025913 Ga0207695_10457793 Ga0207695_104577931 310
137 3300025919 Ga0207657_10059625 Ga0207657_100596252 310
138 3300025934 Ga0207686_10035491 Ga0207686_100354912 310
139 3300025935 Ga0207709_10000008 Ga0207709_10000008425 310
140 3300025935 Ga0207709_10102247 Ga0207709_101022472 310
141 3300025945 Ga0207679_10111953 Ga0207679_101119532 310
142 3300025949 Ga0207667_10028156 Ga0207667_100281564 310
143 3300026089 Ga0207648_10355632 Ga0207648_103556322 310
144 3300026142 Ga0207698_10395471 Ga0207698_103954712 310
145 3300037312 Ga0395899_0003633 Ga0395899_0003633_9549_10511 310
146 3300037312 Ga0395899_0009347 Ga0395899_0009347_6436_7398 310
147 3300037418 Ga0395900_0015815 Ga0395900_0015815_3751_4713 310
148 3300037418 Ga0395900_0068446 Ga0395900_0068446_283_1245 310
149 3300038443 Ga0395901_0002993 Ga0395901_0002993_14376_15338 310
150 3300038443 Ga0395901_0082767 Ga0395901_0082767_230_1192 310
151 3300038443 Ga0395901_0091596 Ga0395901_0091596_1204_2166 310
152 3300042005 Ga0439448_0000942 Ga0439448_0000942_5135_6097 310
153 3300044656 Ga0466969_0048424 Ga0466969_0048424_505_1467 310
154 3300044658 Ga0466972_0000549 Ga0466972_0000549_367_1329 310
155 3300044683 Ga0466965_0010665 Ga0466965_0010665_1933_2895 310
156 3300044683 Ga0466965_0010964 Ga0466965_0010964_657_1619 310
157 3300044683 Ga0466965_0093362 Ga0466965_0093362_76_1038 310
158 3300044684 Ga0466966_0040892 Ga0466966_0040892_1950_2912 310
159 3300044693 Ga0466961_0033309 Ga0466961_0033309_981_1943 310
160 3300044693 Ga0466961_0148220 Ga0466961_0148220_236_1198 310
161 3300044694 Ga0466963_0004918 Ga0466963_0004918_5141_6103 310
162 3300044706 Ga0466964_0007587 Ga0466964_0007587_1323_2285 310
163 3300044706 Ga0466964_0080733 Ga0466964_0080733_423_1385 310
164 3300044719 Ga0466971_0094836 Ga0466971_0094836_104_1066 310
165 3300044719 Ga0466971_0114814 Ga0466971_0114814_60_1022 310
166 3300044735 Ga0466968_0013957 Ga0466968_0013957_1981_2943 310
167 3300044842 Ga0466957_0000081 Ga0466957_0000081_25495_26457 310
168 3300045976 Ga0466967_0139945 Ga0466967_0139945_740_1702 310
169 3300046491 Ga0495584_0000001 Ga0495584_0000001_9971_10948 310
170 3300046491 Ga0495584_0020970 Ga0495584_0020970_1754_2716 310
171 3300046492 Ga0495585_0018479 Ga0495585_0018479_1140_2102 310
172 3300046499 Ga0495594_0006151 Ga0495594_0006151_4954_5916 310
173 3300046526 Ga0495666_0000465 Ga0495666_0000465_15699_16655 310
174 3300046533 Ga0495640_0138610 Ga0495640_0138610_343_1299 310
175 3300046535 Ga0495586_0080938 Ga0495586_0080938_230_1195 310
176 3300046557 Ga0495622_0014572 Ga0495622_0014572_66_1028 310
177 3300046648 Ga0495611_0026879 Ga0495611_0026879_1472_2434 310
178 3300046665 Ga0495661_0003022 Ga0495661_0003022_9071_10033 310
179 3300046665 Ga0495661_0041779 Ga0495661_0041779_410_1372 310
180 3300046674 Ga0495588_0000041 Ga0495588_0000041_23156_24118 310
181 3300046674 Ga0495588_0011194 Ga0495588_0011194_1886_2851 310
182 3300046691 Ga0495670_0012613 Ga0495670_0012613_1933_2895 310
183 3300047315 Ga0495581_0052639 Ga0495581_0052639_1227_2192 310
184 3300047317 Ga0495604_0144009 Ga0495604_0144009_660_1616 310
185 3300047318 Ga0495636_0001256 Ga0495636_0001256_6835_7797 310
186 3300047322 Ga0495680_0117096 Ga0495680_0117096_797_1762 310
187 3300047444 Ga0495675_0147071 Ga0495675_0147071_297_1262 310
188 3300047470 Ga0495681_0001529 Ga0495681_0001529_15748_16704 310
189 3300047673 Ga0495593_0021374 Ga0495593_0021374_1980_2945 310
190 3300048089 Ga0495614_0038753 Ga0495614_0038753_491_1456 310
191 3300048907 Ga0496104_0091566 Ga0496104_0091566_252_1214 310
192 3300048920 Ga0496117_0001212 Ga0496117_0001212_8678_9625 310
193 3300048921 Ga0496118_0073186 Ga0496118_0073186_1069_2016 310
194 3300048925 Ga0496122_0046398 Ga0496122_0046398_642_1589 310
195 3300048926 Ga0496123_0017462 Ga0496123_0017462_4049_4996 310
196 3300048927 Ga0496124_0038361 Ga0496124_0038361_962_1924 310
197 iso_pu_bacteria 2585427687 2586206237 310
198 iso_pu_bacteria 2738541284 2738764113 310
199 iso_pu_bacteria 2738541302 2738855472 310
200 iso_pu_bacteria 2738543023 2739302864 310
201 iso_pu_bacteria 2739367651 2739588234 310
202 iso_pu_bacteria 2739367656 2739613988 310
203 iso_pu_bacteria 2739367663 2739648482 310
204 iso_pu_bacteria 2775506987 2776616494 310
205 iso_pu_bacteria 2818991437 2819546201 310
206 iso_pu_bacteria 2842722452 2842723962 310
207 iso_pu_bacteria 2842909656 2842912306 310
208 iso_pu_bacteria 2857627736 2857629356 310
209 iso_pu_bacteria 2902048731 2902052431 310
210 iso_pu_bacteria 2904445276 2904446482 310
211 iso_pu_bacteria 2919186247 2919191236 310
212 iso_pu_bacteria 2939664404 2939669515 310
213 iso_pu_bacteria 2945997725 2945999290 310
214 iso_pu_bacteria 2954016120 2954021682 310
215 3300005366 Ga0070659_100004699 Ga0070659_1000046992 311
216 3300005614 Ga0068856_100121808 Ga0068856_1001218082 311
217 3300013104 Ga0157370_10134997 Ga0157370_101349972 311
218 3300025932 Ga0207690_10146098 Ga0207690_101460982 311
219 3300026078 Ga0207702_10028112 Ga0207702_100281122 311
220 3300026078 Ga0207702_10042272 Ga0207702_100422722 311
221 3300036647 Ga0316582_0085982 Ga0316582_0085982_360_1304 311
222 3300037471 Ga0395905_0000001 Ga0395905_0000001_866570_867514 311
223 3300048916 Ga0496113_0021155 Ga0496113_0021155_1351_2322 311
224 3300049568 Ga0501031_0000216 Ga0501031_0000216_19953_20918 311
225 3300049569 Ga0501032_0002789 Ga0501032_0002789_3365_4330 311
226 3300049570 Ga0501033_0000004 Ga0501033_0000004_307451_308416 311
227 3300049571 Ga0501034_0000359 Ga0501034_0000359_17027_17992 311
228 3300049574 Ga0501038_0005364 Ga0501038_0005364_4265_5230 311
229 3300049575 Ga0501039_0008766 Ga0501039_0008766_4158_5123 311
230 3300049579 Ga0501043_0000596 Ga0501043_0000596_18589_19554 311
231 3300049822 Ga0501035_0005909 Ga0501035_0005909_306_1271 311
232 3300049823 Ga0501044_0000468 Ga0501044_0000468_37555_38520 311
233 3300049824 Ga0501045_0000002 Ga0501045_0000002_46976_47941 311
234 3300059503 Ga0587080_004681 Ga0587080_004681_225_1202 311
235 iso_pu_bacteria 2738541284 2738764222 311
236 iso_pu_bacteria 2775506987 2776611956 311
237 iso_pu_bacteria 2852627209 2852631820 311
238 2209111006 2214800792 2213830304 312
239 3300003323 rootH1_10138582 rootH1_101385821 312
240 3300005288 Ga0065714_10003842 Ga0065714_100038423 312
241 3300005293 Ga0065715_10010416 Ga0065715_100104162 312
242 3300005293 Ga0065715_10179655 Ga0065715_101796552 312
243 3300006237 Ga0097621_100000235 Ga0097621_10000023515 312
244 3300006358 Ga0068871_100004160 Ga0068871_1000041607 312
245 3300006942 Ga0099824_1000074 Ga0099824_100007413 312
246 3300006946 Ga0079104_1000570 Ga0079104_10005702 312
247 3300006948 Ga0099826_10000224 Ga0099826_100002249 312
248 3300013100 Ga0157373_10000003 Ga0157373_1000000363 312
249 3300013102 Ga0157371_10047997 Ga0157371_100479972 312
250 3300013104 Ga0157370_10001184 Ga0157370_1000118413 312
251 3300013104 Ga0157370_10006405 Ga0157370_100064053 312
252 3300013104 Ga0157370_10062648 Ga0157370_100626482 312
253 3300013105 Ga0157369_10065570 Ga0157369_100655702 312
254 3300015261 Ga0182006_1002116 Ga0182006_10021164 312
255 3300017792 Ga0163161_10000033 Ga0163161_1000003345 312
256 3300017792 Ga0163161_10034596 Ga0163161_100345961 312
257 3300027111 Ga0209281_1000392 Ga0209281_100039213 312
258 3300027666 Ga0209282_1001017 Ga0209282_10010172 312
259 3300031251 Ga0265327_10000545 Ga0265327_1000054553 312
260 3300031548 Ga0307408_100006358 Ga0307408_1000063582 312
261 3300031731 Ga0307405_10012358 Ga0307405_100123583 312
262 3300031824 Ga0307413_10000014 Ga0307413_1000001412 312
263 3300031852 Ga0307410_10000127 Ga0307410_1000012722 312
264 3300031901 Ga0307406_10000042 Ga0307406_1000004247 312
265 3300032002 Ga0307416_100000411 Ga0307416_1000004114 312
266 3300032004 Ga0307414_10000022 Ga0307414_10000022187 312
267 3300032004 Ga0307414_10039923 Ga0307414_100399232 312
268 3300032005 Ga0307411_10000003 Ga0307411_10000003137 312
269 3300032005 Ga0307411_10033297 Ga0307411_100332973 312
270 3300035398 Ga0316574_0276821 Ga0316574_0276821_30_992 312
271 3300037312 Ga0395899_0031883 Ga0395899_0031883_2304_3257 312
272 3300041411 Ga0439466_0001094 Ga0439466_0001094_3097_4035 312
273 3300046501 Ga0495607_0025710 Ga0495607_0025710_1766_2713 312
274 3300046522 Ga0495643_0000987 Ga0495643_0000987_16693_17640 312
275 3300046660 Ga0495625_0032879 Ga0495625_0032879_957_1904 312
276 3300047472 Ga0495686_0005080 Ga0495686_0005080_5742_6734 312
277 3300048919 Ga0496116_0000002 Ga0496116_0000002_708695_709633 312
278 3300048920 Ga0496117_0096131 Ga0496117_0096131_360_1298 312
279 3300048921 Ga0496118_0117452 Ga0496118_0117452_746_1684 312
280 3300048924 Ga0496121_0005787 Ga0496121_0005787_4530_5468 312
281 3300048927 Ga0496124_0030783 Ga0496124_0030783_1726_2664 312
282 3300048927 Ga0496124_0132859 Ga0496124_0132859_726_1664 312
283 3300048928 Ga0496125_0000007 Ga0496125_0000007_707871_708809 312
284 3300048929 Ga0496126_0019255 Ga0496126_0019255_4578_5516 312
285 3300048929 Ga0496126_0118538 Ga0496126_0118538_503_1441 312
286 3300049671 Ga0501238_000001 Ga0501238_000001_5836_6774 312
287 3300049679 Ga0501249_000002 Ga0501249_000002_184678_185616 312
288 3300049679 Ga0501249_001698 Ga0501249_001698_3375_4313 312
289 3300049758 Ga0501241_019816 Ga0501241_019816_49_987 312
290 3300049763 Ga0501266_000003 Ga0501266_000003_32127_33065 312
291 3300049763 Ga0501266_011723 Ga0501266_011723_71_1009 312
292 3300049766 Ga0501269_003942 Ga0501269_003942_335_1273 312
293 3300049776 Ga0501280_000229 Ga0501280_000229_51_989 312
294 3300053090 Ga0500646_0000601 Ga0500646_0000601_6157_7095 312
295 3300053096 Ga0500641_0000004 Ga0500641_0000004_214849_215787 312
296 3300053096 Ga0500641_0011444 Ga0500641_0011444_1966_2904 312
297 3300053134 Ga0500658_0000001 Ga0500658_0000001_538217_539155 312
298 iso_pu_bacteria 2513020052 2513235037 312
299 iso_pu_bacteria 2643221716 2644641265 312
300 iso_pu_bacteria 2958512119 2958515669 312
301 2162886007 SwRhRL2b_contig_2963908 SwRhRL2b_0565.00004530 313
302 2162886007 SwRhRL2b_contig_3539523 SwRhRL2b_0288.00001830 313
303 3300002773 JGI25152J39213_1000143 JGI25152J39213_10001436 313
304 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001514 313
305 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001288 313
306 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001177 313
307 3300003323 rootH1_10040582 rootH1_100405824 313
308 3300005288 Ga0065714_10002572 Ga0065714_100025724 313
309 3300005288 Ga0065714_10003280 Ga0065714_1000328019 313
310 3300005288 Ga0065714_10104906 Ga0065714_101049062 313
311 3300005289 Ga0065704_10070251 Ga0065704_1007025122 313
312 3300005289 Ga0065704_10085810 Ga0065704_100858101 313
313 3300005289 Ga0065704_10125123 Ga0065704_101251232 313
314 3300005614 Ga0068856_100000021 Ga0068856_100000021118 313
315 3300009036 Ga0105244_10000065 Ga0105244_1000006547 313
316 3300009551 Ga0105238_10426167 Ga0105238_104261671 313
317 3300013102 Ga0157371_10000486 Ga0157371_1000048621 313
318 3300013102 Ga0157371_10001175 Ga0157371_1000117522 313
319 3300013104 Ga0157370_10001842 Ga0157370_100018424 313
320 3300013104 Ga0157370_10017747 Ga0157370_100177474 313
321 3300013104 Ga0157370_10022458 Ga0157370_100224584 313
322 3300013308 Ga0157375_10038421 Ga0157375_100384212 313
323 3300014497 Ga0182008_10000014 Ga0182008_10000014181 313
324 3300015261 Ga0182006_1010374 Ga0182006_10103743 313
325 3300017792 Ga0163161_10296214 Ga0163161_102962142 313
326 3300025245 Ga0207425_1000002 Ga0207425_1000002658 313
327 3300025250 Ga0209026_1002050 Ga0209026_10020509 313
328 3300025258 Ga0209129_1000002 Ga0209129_1000002658 313
329 3300025294 Ga0209025_1000004 Ga0209025_1000004532 313
330 3300025297 Ga0209758_1000006 Ga0209758_1000006532 313
331 3300025728 Ga0207655_1000003 Ga0207655_1000003393 313
332 3300026078 Ga0207702_10000515 Ga0207702_1000051537 313
333 3300027424 Ga0209984_1005057 Ga0209984_10050571 313
334 3300027617 Ga0210002_1006523 Ga0210002_10065232 313
335 3300031731 Ga0307405_10000001 Ga0307405_100000016 313
336 3300031901 Ga0307406_10013710 Ga0307406_100137103 313
337 3300031911 Ga0307412_10000043 Ga0307412_1000004329 313
338 3300031911 Ga0307412_10096839 Ga0307412_100968392 313
339 3300032004 Ga0307414_10002905 Ga0307414_100029055 313
340 3300032004 Ga0307414_10020005 Ga0307414_100200055 313
341 3300032004 Ga0307414_10023850 Ga0307414_100238502 313
342 3300046507 Ga0495606_0014484 Ga0495606_0014484_803_1774 313
343 3300046810 Ga0495660_0100867 Ga0495660_0100867_166_1137 313
344 3300049581 Ga0501047_0088586 Ga0501047_0088586_1381_2448 313
345 3300053093 Ga0500651_0001319 Ga0500651_0001319_8233_9186 313
346 3300053125 Ga0500618_000003 Ga0500618_000003_41011_41997 313
347 2162886007 SwRhRL2b_contig_2612864 SwRhRL2b_0227.00003020 314
348 3300002741 JGI25157J39369_1003942 JGI25157J39369_10039424 314
349 3300002773 JGI25152J39213_1000208 JGI25152J39213_100020828 314
350 3300002774 JGI25150J39212_1000014 JGI25150J39212_1000014120 314
351 3300003187 JGI25151J46595_10000042 JGI25151J46595_10000042120 314
352 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009120 314
353 3300003781 Ga0055536_1000019 Ga0055536_100001961 314
354 3300005288 Ga0065714_10002330 Ga0065714_100023303 314
355 3300005288 Ga0065714_10002519 Ga0065714_1000251923 314
356 3300005288 Ga0065714_10008294 Ga0065714_100082944 314
357 3300005288 Ga0065714_10072597 Ga0065714_100725971 314
358 3300005289 Ga0065704_10000253 Ga0065704_1000025330 314
359 3300005289 Ga0065704_10099909 Ga0065704_100999091 314
360 3300005336 Ga0070680_100150201 Ga0070680_1001502012 314
361 3300005458 Ga0070681_10100583 Ga0070681_101005832 314
362 3300005459 Ga0068867_100003170 Ga0068867_10000317010 314
363 3300005535 Ga0070684_100037966 Ga0070684_1000379662 314
364 3300005563 Ga0068855_100000049 Ga0068855_10000004938 314
365 3300005563 Ga0068855_100000342 Ga0068855_10000034228 314
366 3300005563 Ga0068855_100070045 Ga0068855_1000700452 314
367 3300005614 Ga0068856_100000056 Ga0068856_10000005613 314
368 3300005614 Ga0068856_100060342 Ga0068856_1000603423 314
369 3300005842 Ga0068858_100120418 Ga0068858_1001204183 314
370 3300009093 Ga0105240_10029147 Ga0105240_100291476 314
371 3300009093 Ga0105240_10594408 Ga0105240_105944081 314
372 3300009174 Ga0105241_10000852 Ga0105241_100008522 314
373 3300009174 Ga0105241_10004746 Ga0105241_100047469 314
374 3300009545 Ga0105237_10003774 Ga0105237_100037748 314
375 3300009553 Ga0105249_10330417 Ga0105249_103304171 314
376 3300013100 Ga0157373_10001710 Ga0157373_100017104 314
377 3300013100 Ga0157373_10002057 Ga0157373_100020572 314
378 3300013100 Ga0157373_10012353 Ga0157373_100123533 314
379 3300013100 Ga0157373_10044364 Ga0157373_100443642 314
380 3300013102 Ga0157371_10000220 Ga0157371_1000022025 314
381 3300013102 Ga0157371_10000978 Ga0157371_100009787 314
382 3300013102 Ga0157371_10023728 Ga0157371_100237284 314
383 3300013102 Ga0157371_10066415 Ga0157371_100664153 314
384 3300013104 Ga0157370_10001057 Ga0157370_1000105727 314
385 3300013104 Ga0157370_10005530 Ga0157370_100055302 314
386 3300013104 Ga0157370_10024548 Ga0157370_100245485 314
387 3300013104 Ga0157370_10030706 Ga0157370_100307063 314
388 3300013104 Ga0157370_10046327 Ga0157370_100463273 314
389 3300013104 Ga0157370_10047974 Ga0157370_100479742 314
390 3300013104 Ga0157370_10068910 Ga0157370_100689102 314
391 3300013104 Ga0157370_10081225 Ga0157370_100812251 314
392 3300013104 Ga0157370_10082314 Ga0157370_100823141 314
393 3300013104 Ga0157370_10126117 Ga0157370_101261173 314
394 3300013104 Ga0157370_10151781 Ga0157370_101517812 314
395 3300013105 Ga0157369_10000031 Ga0157369_1000003188 314
396 3300013105 Ga0157369_10006222 Ga0157369_100062226 314
397 3300013105 Ga0157369_10045120 Ga0157369_100451205 314
398 3300013105 Ga0157369_10072722 Ga0157369_100727223 314
399 3300013296 Ga0157374_10000125 Ga0157374_1000012546 314
400 3300013296 Ga0157374_10000550 Ga0157374_100005502 314
401 3300013306 Ga0163162_10000227 Ga0163162_1000022739 314
402 3300013306 Ga0163162_10073416 Ga0163162_100734162 314
403 3300013307 Ga0157372_10005103 Ga0157372_1000510313 314
404 3300013308 Ga0157375_10141723 Ga0157375_101417233 314
405 3300014497 Ga0182008_10000021 Ga0182008_10000021151 314
406 3300014497 Ga0182008_10000555 Ga0182008_100005553 314
407 3300014497 Ga0182008_10005283 Ga0182008_100052834 314
408 3300014497 Ga0182008_10022591 Ga0182008_100225913 314
409 3300014497 Ga0182008_10034959 Ga0182008_100349593 314
410 3300015261 Ga0182006_1000173 Ga0182006_100017323 314
411 3300015261 Ga0182006_1003188 Ga0182006_10031884 314
412 3300015261 Ga0182006_1004518 Ga0182006_10045184 314
413 3300015261 Ga0182006_1012418 Ga0182006_10124184 314
414 3300015262 Ga0182007_10000002 Ga0182007_10000002119 314
415 3300015262 Ga0182007_10007767 Ga0182007_100077675 314
416 3300015682 Ga0183373_1004 Ga0183373_1004359 314
417 3300017792 Ga0163161_10000445 Ga0163161_1000044523 314
418 3300017792 Ga0163161_10000465 Ga0163161_100004658 314
419 3300017792 Ga0163161_10053872 Ga0163161_100538721 314
420 3300025245 Ga0207425_1000023 Ga0207425_1000023119 314
421 3300025250 Ga0209026_1000310 Ga0209026_10003107 314
422 3300025258 Ga0209129_1000032 Ga0209129_1000032154 314
423 3300025292 Ga0209676_1000009 Ga0209676_1000009120 314
424 3300025294 Ga0209025_1000047 Ga0209025_1000047154 314
425 3300025297 Ga0209758_1000145 Ga0209758_1000145119 314
426 3300025298 Ga0209050_1000094 Ga0209050_1000094120 314
427 3300025911 Ga0207654_10038514 Ga0207654_100385143 314
428 3300025911 Ga0207654_10039137 Ga0207654_100391373 314
429 3300025913 Ga0207695_10002519 Ga0207695_100025193 314
430 3300025914 Ga0207671_10003754 Ga0207671_100037547 314
431 3300025917 Ga0207660_10008586 Ga0207660_100085865 314
432 3300025921 Ga0207652_10033090 Ga0207652_100330902 314
433 3300025933 Ga0207706_10000009 Ga0207706_1000000945 314
434 3300025942 Ga0207689_10437781 Ga0207689_104377811 314
435 3300025949 Ga0207667_10000015 Ga0207667_10000015288 314
436 3300025949 Ga0207667_10001910 Ga0207667_100019107 314
437 3300025949 Ga0207667_10154085 Ga0207667_101540852 314
438 3300026023 Ga0207677_10152853 Ga0207677_101528532 314
439 3300026078 Ga0207702_10043780 Ga0207702_100437802 314
440 3300028794 Ga0307515_10019786 Ga0307515_100197863 314
441 3300031548 Ga0307408_100001496 Ga0307408_10000149611 314
442 3300031548 Ga0307408_100033871 Ga0307408_1000338712 314
443 3300031731 Ga0307405_10000015 Ga0307405_1000001550 314
444 3300031903 Ga0307407_10000027 Ga0307407_1000002778 314
445 3300031911 Ga0307412_10000091 Ga0307412_100000913 314
446 3300031995 Ga0307409_100015011 Ga0307409_1000150113 314
447 3300032002 Ga0307416_100000002 Ga0307416_100000002104 314
448 3300032004 Ga0307414_10001947 Ga0307414_100019479 314
449 3300032004 Ga0307414_10012073 Ga0307414_100120734 314
450 3300032004 Ga0307414_10057180 Ga0307414_100571802 314
451 3300032004 Ga0307414_10124398 Ga0307414_101243982 314
452 3300046453 Ga0495627_033717 Ga0495627_033717_522_1466 314
453 3300046512 Ga0495610_0000232 Ga0495610_0000232_34410_35354 314
454 3300046512 Ga0495610_0002155 Ga0495610_0002155_15767_16711 314
455 3300046538 Ga0495609_0007309 Ga0495609_0007309_1179_2165 314
456 3300047323 Ga0495683_0031563 Ga0495683_0031563_1712_2662 314
457 3300047472 Ga0495686_0000783 Ga0495686_0000783_24817_25764 314
458 3300048921 Ga0496118_0090940 Ga0496118_0090940_882_1850 314
459 3300048925 Ga0496122_0000395 Ga0496122_0000395_55756_56706 314
460 3300048926 Ga0496123_0005301 Ga0496123_0005301_11807_12757 314
461 3300048927 Ga0496124_0121507 Ga0496124_0121507_701_1669 314
462 3300048927 Ga0496124_0288195 Ga0496124_0288195_221_1171 314
463 3300048928 Ga0496125_0015714 Ga0496125_0015714_2703_3653 314
464 3300049758 Ga0501241_003934 Ga0501241_003934_1758_2702 314
465 3300053093 Ga0500651_0003645 Ga0500651_0003645_2130_3074 314
466 iso_pu_bacteria 2738541283 2738758458 314
467 iso_pu_bacteria 2849281842 2849282739 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

53

217

0.89

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

56

191

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

55

293

0.85

PF07993

NAD_binding_4

Male sterility protein

105

273

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

56

222

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jyg-assembly1.cif.gz_F crystal structure of l-threonine dehydrogenase from phytophthora infestans 0.9779 3 313
4yra-assembly2.cif.gz_D mouse tdh in the apo form 0.9769 3 311
6jyg-assembly1.cif.gz_E crystal structure of l-threonine dehydrogenase from phytophthora infestans 0.9765 3 314
4yr9-assembly3.cif.gz_E mouse tdh with nad+ bound 0.9764 3 311
4yra-assembly1.cif.gz_H mouse tdh in the apo form 0.9764 3 310
ID Description Score Start End Superfamily
af_Q8IZJ6_42_212_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.977 3 162 3.40.50.720
4yraL00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9753 1 311 3.40.50.720
4yrbD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9745 3 310 3.40.50.720
4yrbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 3 304 3.40.50.720
5z75B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9623 4 312 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520CFP0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9891 101 313 GO:0006567
GO:0008743
AF-A0A0L8G4W9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9852 3 313 GO:0006567
GO:0008743
AF-C3ZUH8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9846 1 313 GO:0006567
GO:0008743
GO:0016020
AF-A0A553N9M9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.984 3 312 GO:0006567
GO:0008743
AF-A0A1L8GCF0-F1-model_v4 deleted 0.9839 3 313

Feature Viewer

pLDDT pTM Quality
94.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map