F449877

General Info

Members Datasets Scaffolds Average Seq Length
467 261 934 164

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10191839|Ga0265327_101918392
Length 174
Sequence MTRDLSHYRPNVGVVLFHPDGRVWLGRRANTSGPHNWQFPQGGVDPGEDLEAAARRELAEETGATRASLLSRTHDWVAYDFPPGHGGAKALRGWKGQKQVWFALRFEGEDSDFNLAAHGPPEFDAWRWAYLTEAAELIVPFKREAYERVVAAFGTFAAPRAQDGAQCSGRTEPA

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
124 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
125 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
126 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
127 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
203 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
229 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
239 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
242 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
243 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
244 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
245 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
246 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
247 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
248 2643221583 Caulobacter sp. Root655 Isolate Unclassified
249 2643221584 Caulobacter sp. Root656 Isolate Unclassified
250 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
251 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
252 2643221640 Caulobacter sp. Root342 Isolate Unclassified
253 2643221642 Caulobacter sp. Root343 Isolate Unclassified
254 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
255 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
256 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
257 2818991435 Caulobacter henricii 536 Isolate Unclassified
258 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
259 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
260 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
261 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0
Isolates 4.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.27
Nodule 0
Rhizoplane 5.35
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10191839 3300031251 Bacteria 929
2 JGI25157J39369_1007310 3300002741 Bacteria 1602
3 JGI25153J46596_10024213 3300003215 Bacteria 2193
4 Ga0055537_1010976 3300003773 Bacteria 1870
5 Ga0055537_1017926 3300003773 Bacteria 1148
6 Ga0055524_1008359 3300003775 Bacteria 4305
7 Ga0055524_1044452 3300003775 Bacteria 1079
8 Ga0055536_1004775 3300003781 Bacteria 6799
9 Ga0055536_1006298 3300003781 Bacteria 5581
10 Ga0055528_1029207 3300003790 Bacteria 1499
11 Ga0055530_10005997 3300003791 Bacteria 5578
12 Ga0055530_10007660 3300003791 Bacteria 4499
13 Ga0055530_10010666 3300003791 Bacteria 3370
14 Ga0055531_10000528 3300003794 Bacteria 34315
15 Ga0055531_10005057 3300003794 Bacteria 7814
16 Ga0055531_10031737 3300003794 Bacteria 1742
17 Ga0055543_1016202 3300004625 Bacteria 1421
18 Ga0065165_1000554 3300005262 Bacteria 56028
19 Ga0065165_1027189 3300005262 Bacteria 1870
20 Ga0070658_10018098 3300005327 Bacteria 5636
21 Ga0070658_10205260 3300005327 Bacteria 1664
22 Ga0070658_10462389 3300005327 Bacteria 1094
23 Ga0070658_10518068 3300005327 Bacteria 1031
24 Ga0070670_100810201 3300005331 Bacteria 846
25 Ga0070666_10459559 3300005335 Bacteria 920
26 Ga0070680_100001019 3300005336 Bacteria 20015
27 Ga0070680_100025991 3300005336 Bacteria 4682
28 Ga0070660_100005603 3300005339 Bacteria 8705
29 Ga0070660_100427251 3300005339 Bacteria 1097
30 Ga0070691_10016419 3300005341 Bacteria 3400
31 Ga0070661_100825365 3300005344 Bacteria 762
32 Ga0070661_101131949 3300005344 Bacteria 653
33 Ga0070669_100526414 3300005353 Bacteria 983
34 Ga0070669_100569116 3300005353 Bacteria 946
35 Ga0070671_100017977 3300005355 Bacteria 5735
36 Ga0070671_100119378 3300005355 Bacteria 2219
37 Ga0070671_100797413 3300005355 Bacteria 822
38 Ga0070659_100000399 3300005366 Bacteria 32898
39 Ga0070659_100019649 3300005366 Bacteria 5124
40 Ga0070667_100424017 3300005367 Bacteria 1213
41 Ga0070678_100506338 3300005456 Bacteria 1066
42 Ga0070681_10030836 3300005458 Bacteria 5382
43 Ga0070681_10061447 3300005458 Bacteria 3731
44 Ga0070681_10184968 3300005458 Bacteria 2004
45 Ga0070679_100011485 3300005530 Bacteria 8440
46 Ga0070679_100054681 3300005530 Bacteria 3975
47 Ga0070679_100494102 3300005530 Bacteria 1168
48 Ga0068853_100021697 3300005539 Bacteria 5358
49 Ga0068853_100024558 3300005539 Bacteria 5054
50 Ga0068853_100077326 3300005539 Bacteria 2907
51 Ga0068853_100297473 3300005539 Bacteria 1491
52 Ga0068853_100318651 3300005539 Bacteria 1441
53 Ga0070695_101118116 3300005545 Bacteria 645
54 Ga0070665_100000418 3300005548 Bacteria 62048
55 Ga0070665_100020455 3300005548 Bacteria 6647
56 Ga0070665_100327971 3300005548 Bacteria 1535
57 Ga0068855_100041023 3300005563 Bacteria 5488
58 Ga0068855_100151958 3300005563 Bacteria 2632
59 Ga0068855_100225932 3300005563 Bacteria 2098
60 Ga0068855_100390403 3300005563 Bacteria 1527
61 Ga0070664_100200076 3300005564 Bacteria 1783
62 Ga0068857_100071006 3300005577 Bacteria 3102
63 Ga0068856_100180801 3300005614 Bacteria 2122
64 Ga0068856_100741804 3300005614 Bacteria 1002
65 Ga0068864_100000993 3300005618 Bacteria 23722
66 Ga0068864_100075655 3300005618 Bacteria 2940
67 Ga0068864_100082886 3300005618 Bacteria 2815
68 Ga0068851_10215763 3300005834 Bacteria 1076
69 Ga0068863_100000066 3300005841 Bacteria 117816
70 Ga0068863_100177741 3300005841 Bacteria 2043
71 Ga0068863_101836107 3300005841 Bacteria 616
72 Ga0068858_100002124 3300005842 Bacteria 20089
73 Ga0068858_100678694 3300005842 Bacteria 1002
74 Ga0068860_101211825 3300005843 Bacteria 775
75 Ga0070717_10203489 3300006028 Bacteria 1735
76 Ga0075368_10010296 3300006042 Bacteria 3378
77 Ga0075364_10002819 3300006051 Bacteria 9788
78 Ga0075367_10012466 3300006178 Bacteria 4535
79 Ga0075369_10008315 3300006186 Bacteria 3991
80 Ga0075369_10118882 3300006186 Bacteria 1195
81 Ga0075366_10019491 3300006195 Bacteria 3926
82 Ga0075366_10078928 3300006195 Bacteria 1964
83 Ga0075370_10101272 3300006353 Bacteria 1667
84 Ga0075370_10114990 3300006353 Bacteria 1564
85 Ga0075370_10205487 3300006353 Bacteria 1162
86 Ga0075370_10313424 3300006353 Bacteria 934
87 Ga0075370_10455920 3300006353 Bacteria 770
88 Ga0068865_100003519 3300006881 Bacteria 9387
89 Ga0068865_100364571 3300006881 Bacteria 1174
90 Ga0105251_10122758 3300009011 Bacteria 1179
91 Ga0105250_10005952 3300009092 Bacteria 5390
92 Ga0105240_10003732 3300009093 Bacteria 23537
93 Ga0105240_10246852 3300009093 Bacteria 2067
94 Ga0105240_10296749 3300009093 Bacteria 1850
95 Ga0105240_10300674 3300009093 Bacteria 1836
96 Ga0105240_10916603 3300009093 Bacteria 942
97 Ga0105240_11244343 3300009093 Bacteria 787
98 Ga0105247_10453757 3300009101 Bacteria 925
99 Ga0105241_10335502 3300009174 Bacteria 1308
100 Ga0105248_10003646 3300009177 Bacteria 17096
101 Ga0105248_10017964 3300009177 Bacteria 7806
102 Ga0105248_10077036 3300009177 Bacteria 3748
103 Ga0105248_10186177 3300009177 Bacteria 2339
104 Ga0105237_11320464 3300009545 Bacteria 728
105 Ga0105238_10023706 3300009551 Bacteria 6254
106 Ga0105238_10026036 3300009551 Bacteria 5962
107 Ga0105238_10177985 3300009551 Bacteria 2104
108 Ga0105239_10036093 3300010375 Bacteria 5428
109 Ga0105239_10304635 3300010375 Bacteria 1794
110 Ga0105239_10312298 3300010375 Bacteria 1772
111 Ga0105239_10757150 3300010375 Bacteria 1112
112 Ga0105239_11338907 3300010375 Bacteria 826
113 Ga0105239_11703361 3300010375 Bacteria 730
114 Ga0157369_10310106 3300013105 Bacteria 1641
115 Ga0163162_10479558 3300013306 Bacteria 1375
116 Ga0157375_10277651 3300013308 Bacteria 1838
117 Ga0163163_10403688 3300014325 Bacteria 1425
118 Ga0163163_10552153 3300014325 Bacteria 1214
119 Ga0157379_10037451 3300014968 Bacteria 4325
120 Ga0157379_10678062 3300014968 Bacteria 966
121 Ga0182007_10030889 3300015262 Bacteria 1828
122 Ga0209026_1001029 3300025250 Bacteria 13706
123 Ga0209565_1000149 3300025263 Bacteria 96195
124 Ga0209673_1024934 3300025273 Bacteria 1999
125 Ga0209675_1045973 3300025291 Bacteria 925
126 Ga0209676_1000295 3300025292 Bacteria 100711
127 Ga0209676_1000414 3300025292 Bacteria 76877
128 Ga0209564_1002321 3300025295 Bacteria 15414
129 Ga0209564_1023106 3300025295 Bacteria 2172
130 Ga0209564_1038423 3300025295 Bacteria 1332
131 Ga0209758_1000936 3300025297 Bacteria 39430
132 Ga0209758_1002036 3300025297 Bacteria 21701
133 Ga0209758_1005596 3300025297 Bacteria 9558
134 Ga0209050_1000245 3300025298 Bacteria 116929
135 Ga0209050_1000362 3300025298 Bacteria 87030
136 Ga0209050_1005917 3300025298 Bacteria 7457
137 Ga0209050_1021187 3300025298 Bacteria 2380
138 Ga0209256_1004236 3300025299 Bacteria 9195
139 Ga0209256_1005495 3300025299 Bacteria 7253
140 Ga0209256_1014605 3300025299 Bacteria 2811
141 Ga0209051_1039949 3300025303 Bacteria 1688
142 Ga0209257_1000036 3300025304 Bacteria 616006
143 Ga0209257_1000282 3300025304 Bacteria 113789
144 Ga0209257_1001133 3300025304 Bacteria 34214
145 Ga0209257_1002271 3300025304 Bacteria 19599
146 Ga0209257_1005655 3300025304 Bacteria 8636
147 Ga0207710_10200566 3300025900 Bacteria 985
148 Ga0207680_10196613 3300025903 Bacteria 1372
149 Ga0207705_10002027 3300025909 Bacteria 15769
150 Ga0207705_10218341 3300025909 Bacteria 1447
151 Ga0207705_10285151 3300025909 Bacteria 1265
152 Ga0207654_10440548 3300025911 Bacteria 912
153 Ga0207707_10124352 3300025912 Bacteria 2256
154 Ga0207707_10147627 3300025912 Bacteria 2056
155 Ga0207695_10000837 3300025913 Bacteria 56634
156 Ga0207695_10007867 3300025913 Bacteria 13459
157 Ga0207695_10070511 3300025913 Bacteria 3572
158 Ga0207695_10217797 3300025913 Bacteria 1817
159 Ga0207695_10339878 3300025913 Bacteria 1389
160 Ga0207695_10406722 3300025913 Bacteria 1245
161 Ga0207671_10418603 3300025914 Bacteria 1066
162 Ga0207660_10007742 3300025917 Bacteria 6956
163 Ga0207660_10248832 3300025917 Bacteria 1403
164 Ga0207657_10017426 3300025919 Bacteria 6887
165 Ga0207657_10031047 3300025919 Bacteria 4844
166 Ga0207657_10031417 3300025919 Bacteria 4810
167 Ga0207649_10424762 3300025920 Bacteria 999
168 Ga0207649_10640944 3300025920 Bacteria 820
169 Ga0207652_10001554 3300025921 Bacteria 20200
170 Ga0207652_10048861 3300025921 Bacteria 3618
171 Ga0207652_10323755 3300025921 Bacteria 1392
172 Ga0207681_10531224 3300025923 Bacteria 966
173 Ga0207694_10155813 3300025924 Bacteria 1842
174 Ga0207694_10547185 3300025924 Bacteria 971
175 Ga0207644_10053491 3300025931 Bacteria 2905
176 Ga0207644_10087214 3300025931 Bacteria 2319
177 Ga0207644_10498551 3300025931 Bacteria 1004
178 Ga0207644_10714303 3300025931 Bacteria 836
179 Ga0207644_11501646 3300025931 Bacteria 565
180 Ga0207690_10000898 3300025932 Bacteria 18981
181 Ga0207690_10424663 3300025932 Bacteria 1064
182 Ga0207706_10727610 3300025933 Bacteria 846
183 Ga0207704_10002243 3300025938 Bacteria 8675
184 Ga0207711_10001468 3300025941 Bacteria 21987
185 Ga0207711_10031054 3300025941 Bacteria 4508
186 Ga0207711_10072257 3300025941 Bacteria 2997
187 Ga0207711_10353218 3300025941 Bacteria 1361
188 Ga0207711_10454912 3300025941 Bacteria 1192
189 Ga0207679_10314017 3300025945 Bacteria 1355
190 Ga0207667_10004404 3300025949 Bacteria 17251
191 Ga0207667_10034966 3300025949 Bacteria 5393
192 Ga0207667_10248508 3300025949 Bacteria 1820
193 Ga0207640_10629312 3300025981 Bacteria 912
194 Ga0207658_10394516 3300025986 Bacteria 1215
195 Ga0207677_11609049 3300026023 Bacteria 601
196 Ga0207703_10000065 3300026035 Bacteria 126087
197 Ga0207703_11174053 3300026035 Bacteria 738
198 Ga0207639_10027411 3300026041 Bacteria 4151
199 Ga0207639_10043924 3300026041 Bacteria 3358
200 Ga0207639_10256352 3300026041 Bacteria 1528
201 Ga0207639_10930017 3300026041 Bacteria 813
202 Ga0207678_10200869 3300026067 Bacteria 1704
203 Ga0207702_10590607 3300026078 Bacteria 1089
204 Ga0207702_10603078 3300026078 Bacteria 1077
205 Ga0207641_10000011 3300026088 Bacteria 384362
206 Ga0207641_10148183 3300026088 Bacteria 2124
207 Ga0207676_10007791 3300026095 Bacteria 7616
208 Ga0207676_10072958 3300026095 Bacteria 2761
209 Ga0207676_10503367 3300026095 Bacteria 1150
210 Ga0207676_11400195 3300026095 Bacteria 695
211 Ga0207683_10061054 3300026121 Bacteria 3316
212 Ga0209813_10111574 3300027866 Bacteria 943
213 Ga0268266_10000003 3300028379 Bacteria 1701703
214 Ga0268266_10022099 3300028379 Bacteria 5423
215 Ga0268266_10135188 3300028379 Bacteria 2208
216 Ga0268266_10310568 3300028379 Bacteria 1473
217 Ga0307517_10051053 3300028786 Bacteria 4186
218 Ga0307515_10018388 3300028794 Bacteria 12655
219 Ga0307515_10494507 3300028794 Bacteria 834
220 Ga0307513_10007022 3300031456 Bacteria 14647
221 Ga0307513_10010412 3300031456 Bacteria 11657
222 Ga0307408_101508285 3300031548 Bacteria 636
223 Ga0307508_10246600 3300031616 Bacteria 1383
224 Ga0307413_11411633 3300031824 Bacteria 613
225 Ga0307414_10314628 3300032004 Bacteria 1330
226 Ga0307414_10347727 3300032004 Bacteria 1271
227 Ga0307510_10017521 3300033180 Bacteria 8445
228 Ga0307510_10133511 3300033180 Bacteria 2147
229 Ga0373941_0171434 3300035115 Bacteria 809
230 Ga0373935_0573895 3300035692 Bacteria 823
231 Ga0395899_0000052 3300037312 Bacteria 221643
232 Ga0395899_0165759 3300037312 Bacteria 1559
233 Ga0395899_0299904 3300037312 Bacteria 1088
234 Ga0395899_0797915 3300037312 Bacteria 584
235 Ga0395900_0000002 3300037418 Bacteria 671103
236 Ga0395900_0021999 3300037418 Bacteria 6520
237 Ga0395900_0397166 3300037418 Bacteria 1344
238 Ga0395898_0016641 3300037466 Bacteria 7516
239 Ga0395898_0065978 3300037466 Bacteria 3508
240 Ga0395905_0003587 3300037471 Bacteria 16515
241 Ga0395905_0030066 3300037471 Bacteria 5120
242 Ga0395905_0193514 3300037471 Bacteria 1907
243 Ga0395905_0290654 3300037471 Bacteria 1521
244 Ga0395905_0431073 3300037471 Bacteria 1215
245 Ga0395905_0932298 3300037471 Bacteria 771
246 Ga0395901_0000013 3300038443 Bacteria 375733
247 Ga0395901_0263638 3300038443 Bacteria 1793
248 Ga0436365_0656099 3300039437 Bacteria 4996
249 Ga0451795_1448789 3300041456 Bacteria 640
250 Ga0451849_1264467 3300041505 Bacteria 729
251 Ga0451853_0522904 3300041512 Bacteria 651
252 Ga0451853_1090863 3300041512 Bacteria 874
253 Ga0439437_021924 3300042000 Bacteria 776
254 Ga0439441_024682 3300042001 Bacteria 1130
255 Ga0439435_0008278 3300042436 Bacteria 2409
256 Ga0439459_0014759 3300042438 Bacteria 1424
257 Ga0450893_0012212 3300042532 Bacteria 1426
258 Ga0466966_0296641 3300044684 Bacteria 972
259 Ga0466964_0147613 3300044706 Bacteria 1087
260 Ga0453684_0371582 3300044712 Bacteria 1607
261 Ga0495627_000879 3300046453 Bacteria 21159
262 Ga0495629_0025481 3300046459 Bacteria 4203
263 Ga0495638_0001712 3300046460 Bacteria 19316
264 Ga0495638_0002843 3300046460 Bacteria 13873
265 Ga0495638_0003079 3300046460 Bacteria 13234
266 Ga0495638_0043752 3300046460 Bacteria 2823
267 Ga0495638_0291407 3300046460 Bacteria 883
268 Ga0495638_0291775 3300046460 Bacteria 882
269 Ga0495638_0439362 3300046460 Bacteria 668
270 Ga0495650_0000046 3300046471 Bacteria 342987
271 Ga0495580_0481675 3300046472 Bacteria 830
272 Ga0495585_0253622 3300046492 Bacteria 877
273 Ga0495607_0084419 3300046501 Bacteria 1737
274 Ga0495583_0000003 3300046506 Bacteria 709273
275 Ga0495583_0044584 3300046506 Bacteria 2056
276 Ga0495583_0140861 3300046506 Bacteria 1004
277 Ga0495583_0161898 3300046506 Bacteria 923
278 Ga0495606_0138636 3300046507 Bacteria 1438
279 Ga0495610_0006369 3300046512 Bacteria 8144
280 Ga0495616_0003030 3300046513 Bacteria 10891
281 Ga0495620_0015405 3300046515 Bacteria 3862
282 Ga0495620_0031642 3300046515 Bacteria 2422
283 Ga0495628_0305569 3300046516 Bacteria 1177
284 Ga0495628_0675873 3300046516 Bacteria 731
285 Ga0495631_0102411 3300046518 Bacteria 1232
286 Ga0495632_0201346 3300046519 Bacteria 906
287 Ga0495632_0235841 3300046519 Bacteria 824
288 Ga0495637_0002096 3300046520 Bacteria 11216
289 Ga0495643_0022556 3300046522 Bacteria 3591
290 Ga0495643_0218096 3300046522 Bacteria 906
291 Ga0495643_0221209 3300046522 Bacteria 898
292 Ga0495648_0070267 3300046524 Bacteria 2035
293 Ga0495648_0160648 3300046524 Bacteria 1162
294 Ga0495648_0269659 3300046524 Bacteria 812
295 Ga0495663_0159255 3300046525 Bacteria 774
296 Ga0495642_0002737 3300046528 Bacteria 7073
297 Ga0495654_0000039 3300046530 Bacteria 185363
298 Ga0495654_0051498 3300046530 Bacteria 2009
299 Ga0495609_0007443 3300046538 Bacteria 5468
300 Ga0495609_0242237 3300046538 Bacteria 744
301 Ga0495609_0287331 3300046538 Bacteria 672
302 Ga0495621_0224647 3300046539 Bacteria 761
303 Ga0495597_0025085 3300046542 Bacteria 2746
304 Ga0495597_0103535 3300046542 Bacteria 1198
305 Ga0495622_0014157 3300046557 Bacteria 3703
306 Ga0495633_0034208 3300046558 Bacteria 2445
307 Ga0495668_0000141 3300046616 Bacteria 108840
308 Ga0495668_0040182 3300046616 Bacteria 2609
309 Ga0495668_0074551 3300046616 Bacteria 1863
310 Ga0495668_0078391 3300046616 Bacteria 1814
311 Ga0495668_0080193 3300046616 Bacteria 1791
312 Ga0495668_0156107 3300046616 Bacteria 1250
313 Ga0495668_0179458 3300046616 Bacteria 1160
314 Ga0495668_0282844 3300046616 Bacteria 909
315 Ga0495668_0294350 3300046616 Bacteria 889
316 Ga0495668_0312689 3300046616 Bacteria 861
317 Ga0495668_0669645 3300046616 Bacteria 574
318 Ga0495611_0031395 3300046648 Bacteria 2338
319 Ga0495625_0000854 3300046660 Bacteria 41503
320 Ga0495625_0002619 3300046660 Bacteria 19256
321 Ga0495625_0007259 3300046660 Bacteria 9692
322 Ga0495625_0017757 3300046660 Bacteria 5563
323 Ga0495659_0035152 3300046664 Bacteria 1765
324 Ga0495659_0152166 3300046664 Bacteria 929
325 Ga0495588_0029606 3300046674 Bacteria 2748
326 Ga0495669_0000014 3300046684 Bacteria 140832
327 Ga0495669_0000081 3300046684 Bacteria 63806
328 Ga0495669_0013682 3300046684 Bacteria 3463
329 Ga0495669_0029160 3300046684 Bacteria 2419
330 Ga0495670_0403578 3300046691 Bacteria 738
331 Ga0495671_0575851 3300046692 Bacteria 536
332 Ga0495589_0030741 3300046794 Bacteria 2704
333 Ga0495660_0045926 3300046810 Bacteria 2396
334 Ga0495660_0139227 3300046810 Bacteria 1209
335 Ga0495636_0058432 3300047318 Bacteria 1626
336 Ga0495672_0006648 3300047320 Bacteria 8884
337 Ga0495672_0282875 3300047320 Bacteria 792
338 Ga0495683_0218075 3300047323 Bacteria 852
339 Ga0495687_038352 3300047443 Bacteria 2127
340 Ga0495677_0030910 3300047445 Bacteria 1949
341 Ga0495677_0062756 3300047445 Bacteria 1379
342 Ga0495677_0107685 3300047445 Bacteria 1058
343 Ga0495679_002625 3300047446 Bacteria 9023
344 Ga0495685_118899 3300047447 Bacteria 868
345 Ga0495681_0036503 3300047470 Bacteria 2429
346 Ga0495681_0243884 3300047470 Bacteria 712
347 Ga0495686_0009073 3300047472 Bacteria 7214
348 Ga0495686_0018149 3300047472 Bacteria 4726
349 Ga0495686_0135332 3300047472 Bacteria 1457
350 Ga0495686_0400882 3300047472 Bacteria 736
351 Ga0495602_0607602 3300048088 Bacteria 751
352 Ga0496100_0762107 3300048903 Bacteria 757
353 Ga0496102_0239731 3300048905 Bacteria 1710
354 Ga0496102_0331500 3300048905 Bacteria 1433
355 Ga0496103_0226534 3300048906 Bacteria 1202
356 Ga0496103_0346684 3300048906 Bacteria 955
357 Ga0496105_1096389 3300048908 Bacteria 591
358 Ga0496106_0009305 3300048909 Bacteria 7262
359 Ga0496107_0001541 3300048910 Bacteria 14314
360 Ga0496107_0115720 3300048910 Bacteria 1973
361 Ga0496108_0227007 3300048911 Bacteria 1623
362 Ga0496109_0143752 3300048912 Bacteria 2231
363 Ga0496110_1373854 3300048913 Bacteria 616
364 Ga0496111_0200943 3300048914 Bacteria 1482
365 Ga0496112_0017526 3300048915 Bacteria 6730
366 Ga0496112_0236290 3300048915 Bacteria 1781
367 Ga0496112_0273335 3300048915 Bacteria 1638
368 Ga0496113_0382773 3300048916 Bacteria 1129
369 Ga0496114_0924746 3300048917 Bacteria 754
370 Ga0496115_0000398 3300048918 Bacteria 35876
371 Ga0496115_0002868 3300048918 Bacteria 12420
372 Ga0496115_0016458 3300048918 Bacteria 5632
373 Ga0496115_0171223 3300048918 Bacteria 1796
374 Ga0496115_0471326 3300048918 Bacteria 1012
375 Ga0496115_0605548 3300048918 Bacteria 871
376 Ga0496117_0023814 3300048920 Bacteria 4863
377 Ga0496118_0064356 3300048921 Bacteria 2691
378 Ga0496119_0022659 3300048922 Bacteria 4487
379 Ga0496120_0121346 3300048923 Bacteria 1351
380 Ga0496121_0000035 3300048924 Bacteria 374316
381 Ga0496121_0001011 3300048924 Bacteria 50244
382 Ga0496121_0567876 3300048924 Bacteria 706
383 Ga0496124_0024169 3300048927 Bacteria 5531
384 Ga0496125_0058592 3300048928 Bacteria 3110
385 Ga0496125_0324733 3300048928 Bacteria 931
386 Ga0496126_0006901 3300048929 Bacteria 12578
387 Ga0496126_0414550 3300048929 Bacteria 1090
388 Ga0501033_0577329 3300049570 Bacteria 773
389 Ga0501047_0074385 3300049581 Bacteria 3271
390 Ga0501047_0176605 3300049581 Bacteria 2003
391 Ga0501047_0241684 3300049581 Bacteria 1656
392 Ga0501048_0051955 3300049582 Bacteria 2916
393 Ga0501238_002490 3300049671 Bacteria 2208
394 Ga0501270_155009 3300049767 Bacteria 525
395 Ga0501044_0023385 3300049823 Bacteria 6572
396 Ga0501044_0485937 3300049823 Bacteria 1137
397 nmdc:mga03683_210511_c1 3300050489 Bacteria 894
398 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
399 nmdc:mga0k408_442091_c1 3300050493 Bacteria 772
400 nmdc:mga0k408_79911_c1 3300050493 Bacteria 1914
401 nmdc:mga0k408_86891_c1 3300050493 Bacteria 1836
402 nmdc:mga07m45_110765_c1 3300050496 Bacteria 1581
403 nmdc:mga07m45_24930_c1 3300050496 Bacteria 3279
404 nmdc:mga07m45_73793_c1 3300050496 Bacteria 1943
405 nmdc:mga0sz30_7952_c1 3300050516 Bacteria 3991
406 Ga0500635_0002320 3300053080 Bacteria 4699
407 Ga0495655_0274291 3300053083 Bacteria 573
408 Ga0500647_0048756 3300053091 Bacteria 2036
409 Ga0500651_0092001 3300053093 Bacteria 1866
410 Ga0500554_018147 3300053102 Bacteria 1894
411 Ga0500555_034484 3300053103 Bacteria 1425
412 Ga0500556_0001380 3300053104 Bacteria 10608
413 Ga0500569_011330 3300053109 Bacteria 2126
414 Ga0500595_009155 3300053119 Bacteria 4010
415 Ga0500595_011477 3300053119 Bacteria 3468
416 Ga0500595_076701 3300053119 Bacteria 984
417 Ga0500607_021263 3300053121 Bacteria 3659
418 Ga0500607_051845 3300053121 Bacteria 2181
419 Ga0500608_034867 3300053122 Bacteria 2398
420 Ga0500614_025968 3300053123 Bacteria 1397
421 Ga0500618_000189 3300053125 Bacteria 50500
422 Ga0500642_0186204 3300053130 Bacteria 970
423 Ga0500655_037586 3300053133 Bacteria 944
424 Ga0500658_0034183 3300053134 Bacteria 2004
425 Ga0500658_0175160 3300053134 Bacteria 975
426 Ga0500559_0000221 3300053136 Bacteria 45774
427 Ga0500559_0007592 3300053136 Bacteria 4790
428 Ga0500559_0029052 3300053136 Bacteria 2365
429 Ga0500559_0120666 3300053136 Bacteria 1219
430 Ga0500577_0026301 3300053142 Bacteria 1980
431 Ga0500590_025425 3300053148 Bacteria 3075
432 Ga0500603_010535 3300053150 Bacteria 2090
433 Ga0500619_037981 3300053154 Bacteria 1507
434 Ga0500622_0179240 3300053156 Bacteria 980
435 Ga0500624_004418 3300053157 Unclassified 1851
436 Ga0500627_0112372 3300053158 Bacteria 1226
437 Ga0500638_101236 3300053162 Unclassified 1343
438 Ga0500639_252577 3300053163 Bacteria 705
439 Ga0500636_0016186 3300053177 Bacteria 4397
440 Ga0500637_0019922 3300053178 Bacteria 3625
441 Ga0500637_0054248 3300053178 Bacteria 2288
442 Ga0500576_222010 3300053725 Bacteria 619
443 Ga0500625_049621 3300053729 Bacteria 1944
444 Ga0500645_015649 3300053730 Bacteria 2400
445 Ga0500645_016287 3300053730 Bacteria 2342
446 Ga0500645_042933 3300053730 Bacteria 1332
447 Ga0500609_004607 3300053731 Bacteria 1901
448 2511123173 2510917020 Bacteria 5657507
449 2585153502 2582581280 Bacteria 5994497
450 2585196875 2582581293 Bacteria 5907401
451 2587919096 2585428106 Bacteria 5179711
452 2643748926 2643221545 Bacteria 5083237
453 2643783111 2643221552 Bacteria 5708754
454 2643927020 2643221583 Bacteria 5218014
455 2643930289 2643221584 Bacteria 5511711
456 2643998751 2643221598 Bacteria 4578346
457 2644087292 2643221614 Bacteria 4260023
458 2644227494 2643221640 Bacteria 5258820
459 2644236988 2643221642 Bacteria 5357871
460 2644344664 2643221661 Bacteria 4267604
461 2644366652 2643221666 Bacteria 4265935
462 2644509315 2643221691 Bacteria 5093099
463 2819537669 2818991435 Bacteria 5433759
464 2819647446 2818991454 Bacteria 5563326
465 2857508486 2857504554 Bacteria 5369913
466 2884961283 2884960567 Bacteria 5437054
467 2928531794 2928531327 Bacteria 5101314
468 Ga0265327_10191839
469 JGI25157J39369_1007310
470 JGI25153J46596_10024213
471 Ga0055537_1010976
472 Ga0055537_1017926
473 Ga0055524_1008359
474 Ga0055524_1044452
475 Ga0055536_1004775
476 Ga0055536_1006298
477 Ga0055528_1029207
478 Ga0055530_10005997
479 Ga0055530_10007660
480 Ga0055530_10010666
481 Ga0055531_10000528
482 Ga0055531_10005057
483 Ga0055531_10031737
484 Ga0055543_1016202
485 Ga0065165_1000554
486 Ga0065165_1027189
487 Ga0070658_10018098
488 Ga0070658_10205260
489 Ga0070658_10462389
490 Ga0070658_10518068
491 Ga0070670_100810201
492 Ga0070666_10459559
493 Ga0070680_100001019
494 Ga0070680_100025991
495 Ga0070660_100005603
496 Ga0070660_100427251
497 Ga0070691_10016419
498 Ga0070661_100825365
499 Ga0070661_101131949
500 Ga0070669_100526414
501 Ga0070669_100569116
502 Ga0070671_100017977
503 Ga0070671_100119378
504 Ga0070671_100797413
505 Ga0070659_100000399
506 Ga0070659_100019649
507 Ga0070667_100424017
508 Ga0070678_100506338
509 Ga0070681_10030836
510 Ga0070681_10061447
511 Ga0070681_10184968
512 Ga0070679_100011485
513 Ga0070679_100054681
514 Ga0070679_100494102
515 Ga0068853_100021697
516 Ga0068853_100024558
517 Ga0068853_100077326
518 Ga0068853_100297473
519 Ga0068853_100318651
520 Ga0070695_101118116
521 Ga0070665_100000418
522 Ga0070665_100020455
523 Ga0070665_100327971
524 Ga0068855_100041023
525 Ga0068855_100151958
526 Ga0068855_100225932
527 Ga0068855_100390403
528 Ga0070664_100200076
529 Ga0068857_100071006
530 Ga0068856_100180801
531 Ga0068856_100741804
532 Ga0068864_100000993
533 Ga0068864_100075655
534 Ga0068864_100082886
535 Ga0068851_10215763
536 Ga0068863_100000066
537 Ga0068863_100177741
538 Ga0068863_101836107
539 Ga0068858_100002124
540 Ga0068858_100678694
541 Ga0068860_101211825
542 Ga0070717_10203489
543 Ga0075368_10010296
544 Ga0075364_10002819
545 Ga0075367_10012466
546 Ga0075369_10008315
547 Ga0075369_10118882
548 Ga0075366_10019491
549 Ga0075366_10078928
550 Ga0075370_10101272
551 Ga0075370_10114990
552 Ga0075370_10205487
553 Ga0075370_10313424
554 Ga0075370_10455920
555 Ga0068865_100003519
556 Ga0068865_100364571
557 Ga0105251_10122758
558 Ga0105250_10005952
559 Ga0105240_10003732
560 Ga0105240_10246852
561 Ga0105240_10296749
562 Ga0105240_10300674
563 Ga0105240_10916603
564 Ga0105240_11244343
565 Ga0105247_10453757
566 Ga0105241_10335502
567 Ga0105248_10003646
568 Ga0105248_10017964
569 Ga0105248_10077036
570 Ga0105248_10186177
571 Ga0105237_11320464
572 Ga0105238_10023706
573 Ga0105238_10026036
574 Ga0105238_10177985
575 Ga0105239_10036093
576 Ga0105239_10304635
577 Ga0105239_10312298
578 Ga0105239_10757150
579 Ga0105239_11338907
580 Ga0105239_11703361
581 Ga0157369_10310106
582 Ga0163162_10479558
583 Ga0157375_10277651
584 Ga0163163_10403688
585 Ga0163163_10552153
586 Ga0157379_10037451
587 Ga0157379_10678062
588 Ga0182007_10030889
589 Ga0209026_1001029
590 Ga0209565_1000149
591 Ga0209673_1024934
592 Ga0209675_1045973
593 Ga0209676_1000295
594 Ga0209676_1000414
595 Ga0209564_1002321
596 Ga0209564_1023106
597 Ga0209564_1038423
598 Ga0209758_1000936
599 Ga0209758_1002036
600 Ga0209758_1005596
601 Ga0209050_1000245
602 Ga0209050_1000362
603 Ga0209050_1005917
604 Ga0209050_1021187
605 Ga0209256_1004236
606 Ga0209256_1005495
607 Ga0209256_1014605
608 Ga0209051_1039949
609 Ga0209257_1000036
610 Ga0209257_1000282
611 Ga0209257_1001133
612 Ga0209257_1002271
613 Ga0209257_1005655
614 Ga0207710_10200566
615 Ga0207680_10196613
616 Ga0207705_10002027
617 Ga0207705_10218341
618 Ga0207705_10285151
619 Ga0207654_10440548
620 Ga0207707_10124352
621 Ga0207707_10147627
622 Ga0207695_10000837
623 Ga0207695_10007867
624 Ga0207695_10070511
625 Ga0207695_10217797
626 Ga0207695_10339878
627 Ga0207695_10406722
628 Ga0207671_10418603
629 Ga0207660_10007742
630 Ga0207660_10248832
631 Ga0207657_10017426
632 Ga0207657_10031047
633 Ga0207657_10031417
634 Ga0207649_10424762
635 Ga0207649_10640944
636 Ga0207652_10001554
637 Ga0207652_10048861
638 Ga0207652_10323755
639 Ga0207681_10531224
640 Ga0207694_10155813
641 Ga0207694_10547185
642 Ga0207644_10053491
643 Ga0207644_10087214
644 Ga0207644_10498551
645 Ga0207644_10714303
646 Ga0207644_11501646
647 Ga0207690_10000898
648 Ga0207690_10424663
649 Ga0207706_10727610
650 Ga0207704_10002243
651 Ga0207711_10001468
652 Ga0207711_10031054
653 Ga0207711_10072257
654 Ga0207711_10353218
655 Ga0207711_10454912
656 Ga0207679_10314017
657 Ga0207667_10004404
658 Ga0207667_10034966
659 Ga0207667_10248508
660 Ga0207640_10629312
661 Ga0207658_10394516
662 Ga0207677_11609049
663 Ga0207703_10000065
664 Ga0207703_11174053
665 Ga0207639_10027411
666 Ga0207639_10043924
667 Ga0207639_10256352
668 Ga0207639_10930017
669 Ga0207678_10200869
670 Ga0207702_10590607
671 Ga0207702_10603078
672 Ga0207641_10000011
673 Ga0207641_10148183
674 Ga0207676_10007791
675 Ga0207676_10072958
676 Ga0207676_10503367
677 Ga0207676_11400195
678 Ga0207683_10061054
679 Ga0209813_10111574
680 Ga0268266_10000003
681 Ga0268266_10022099
682 Ga0268266_10135188
683 Ga0268266_10310568
684 Ga0307517_10051053
685 Ga0307515_10018388
686 Ga0307515_10494507
687 Ga0307513_10007022
688 Ga0307513_10010412
689 Ga0307408_101508285
690 Ga0307508_10246600
691 Ga0307413_11411633
692 Ga0307414_10314628
693 Ga0307414_10347727
694 Ga0307510_10017521
695 Ga0307510_10133511
696 Ga0373941_0171434
697 Ga0373935_0573895
698 Ga0395899_0000052
699 Ga0395899_0165759
700 Ga0395899_0299904
701 Ga0395899_0797915
702 Ga0395900_0000002
703 Ga0395900_0021999
704 Ga0395900_0397166
705 Ga0395898_0016641
706 Ga0395898_0065978
707 Ga0395905_0003587
708 Ga0395905_0030066
709 Ga0395905_0193514
710 Ga0395905_0290654
711 Ga0395905_0431073
712 Ga0395905_0932298
713 Ga0395901_0000013
714 Ga0395901_0263638
715 Ga0436365_0656099
716 Ga0451795_1448789
717 Ga0451849_1264467
718 Ga0451853_0522904
719 Ga0451853_1090863
720 Ga0439437_021924
721 Ga0439441_024682
722 Ga0439435_0008278
723 Ga0439459_0014759
724 Ga0450893_0012212
725 Ga0466966_0296641
726 Ga0466964_0147613
727 Ga0453684_0371582
728 Ga0495627_000879
729 Ga0495629_0025481
730 Ga0495638_0001712
731 Ga0495638_0002843
732 Ga0495638_0003079
733 Ga0495638_0043752
734 Ga0495638_0291407
735 Ga0495638_0291775
736 Ga0495638_0439362
737 Ga0495650_0000046
738 Ga0495580_0481675
739 Ga0495585_0253622
740 Ga0495607_0084419
741 Ga0495583_0000003
742 Ga0495583_0044584
743 Ga0495583_0140861
744 Ga0495583_0161898
745 Ga0495606_0138636
746 Ga0495610_0006369
747 Ga0495616_0003030
748 Ga0495620_0015405
749 Ga0495620_0031642
750 Ga0495628_0305569
751 Ga0495628_0675873
752 Ga0495631_0102411
753 Ga0495632_0201346
754 Ga0495632_0235841
755 Ga0495637_0002096
756 Ga0495643_0022556
757 Ga0495643_0218096
758 Ga0495643_0221209
759 Ga0495648_0070267
760 Ga0495648_0160648
761 Ga0495648_0269659
762 Ga0495663_0159255
763 Ga0495642_0002737
764 Ga0495654_0000039
765 Ga0495654_0051498
766 Ga0495609_0007443
767 Ga0495609_0242237
768 Ga0495609_0287331
769 Ga0495621_0224647
770 Ga0495597_0025085
771 Ga0495597_0103535
772 Ga0495622_0014157
773 Ga0495633_0034208
774 Ga0495668_0000141
775 Ga0495668_0040182
776 Ga0495668_0074551
777 Ga0495668_0078391
778 Ga0495668_0080193
779 Ga0495668_0156107
780 Ga0495668_0179458
781 Ga0495668_0282844
782 Ga0495668_0294350
783 Ga0495668_0312689
784 Ga0495668_0669645
785 Ga0495611_0031395
786 Ga0495625_0000854
787 Ga0495625_0002619
788 Ga0495625_0007259
789 Ga0495625_0017757
790 Ga0495659_0035152
791 Ga0495659_0152166
792 Ga0495588_0029606
793 Ga0495669_0000014
794 Ga0495669_0000081
795 Ga0495669_0013682
796 Ga0495669_0029160
797 Ga0495670_0403578
798 Ga0495671_0575851
799 Ga0495589_0030741
800 Ga0495660_0045926
801 Ga0495660_0139227
802 Ga0495636_0058432
803 Ga0495672_0006648
804 Ga0495672_0282875
805 Ga0495683_0218075
806 Ga0495687_038352
807 Ga0495677_0030910
808 Ga0495677_0062756
809 Ga0495677_0107685
810 Ga0495679_002625
811 Ga0495685_118899
812 Ga0495681_0036503
813 Ga0495681_0243884
814 Ga0495686_0009073
815 Ga0495686_0018149
816 Ga0495686_0135332
817 Ga0495686_0400882
818 Ga0495602_0607602
819 Ga0496100_0762107
820 Ga0496102_0239731
821 Ga0496102_0331500
822 Ga0496103_0226534
823 Ga0496103_0346684
824 Ga0496105_1096389
825 Ga0496106_0009305
826 Ga0496107_0001541
827 Ga0496107_0115720
828 Ga0496108_0227007
829 Ga0496109_0143752
830 Ga0496110_1373854
831 Ga0496111_0200943
832 Ga0496112_0017526
833 Ga0496112_0236290
834 Ga0496112_0273335
835 Ga0496113_0382773
836 Ga0496114_0924746
837 Ga0496115_0000398
838 Ga0496115_0002868
839 Ga0496115_0016458
840 Ga0496115_0171223
841 Ga0496115_0471326
842 Ga0496115_0605548
843 Ga0496117_0023814
844 Ga0496118_0064356
845 Ga0496119_0022659
846 Ga0496120_0121346
847 Ga0496121_0000035
848 Ga0496121_0001011
849 Ga0496121_0567876
850 Ga0496124_0024169
851 Ga0496125_0058592
852 Ga0496125_0324733
853 Ga0496126_0006901
854 Ga0496126_0414550
855 Ga0501033_0577329
856 Ga0501047_0074385
857 Ga0501047_0176605
858 Ga0501047_0241684
859 Ga0501048_0051955
860 Ga0501238_002490
861 Ga0501270_155009
862 Ga0501044_0023385
863 Ga0501044_0485937
864 nmdc:mga03683_210511_c1
865 nmdc:mga00v17_725_c1
866 nmdc:mga0k408_442091_c1
867 nmdc:mga0k408_79911_c1
868 nmdc:mga0k408_86891_c1
869 nmdc:mga07m45_110765_c1
870 nmdc:mga07m45_24930_c1
871 nmdc:mga07m45_73793_c1
872 nmdc:mga0sz30_7952_c1
873 Ga0500635_0002320
874 Ga0495655_0274291
875 Ga0500647_0048756
876 Ga0500651_0092001
877 Ga0500554_018147
878 Ga0500555_034484
879 Ga0500556_0001380
880 Ga0500569_011330
881 Ga0500595_009155
882 Ga0500595_011477
883 Ga0500595_076701
884 Ga0500607_021263
885 Ga0500607_051845
886 Ga0500608_034867
887 Ga0500614_025968
888 Ga0500618_000189
889 Ga0500642_0186204
890 Ga0500655_037586
891 Ga0500658_0034183
892 Ga0500658_0175160
893 Ga0500559_0000221
894 Ga0500559_0007592
895 Ga0500559_0029052
896 Ga0500559_0120666
897 Ga0500577_0026301
898 Ga0500590_025425
899 Ga0500603_010535
900 Ga0500619_037981
901 Ga0500622_0179240
902 Ga0500624_004418
903 Ga0500627_0112372
904 Ga0500638_101236
905 Ga0500639_252577
906 Ga0500636_0016186
907 Ga0500637_0019922
908 Ga0500637_0054248
909 Ga0500576_222010
910 Ga0500625_049621
911 Ga0500645_015649
912 Ga0500645_016287
913 Ga0500645_042933
914 Ga0500609_004607
915 2511123173
916 2585153502
917 2585196875
918 2587919096
919 2643748926
920 2643783111
921 2643927020
922 2643930289
923 2643998751
924 2644087292
925 2644227494
926 2644236988
927 2644344664
928 2644366652
929 2644509315
930 2819537669
931 2819647446
932 2857508486
933 2884961283
934 2928531794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

7

149

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9262 1 153
6vcn-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpg 0.9198 6 153
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9185 1 153
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9173 1 153
6vco-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpa 0.907 1 153
ID Description Score Start End Superfamily
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9251 1 154 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9185 1 153 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9122 21 154 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8915 1 154 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.873 1 153 3.90.79.10
ID Description Score Start End GO Terms
AF-B4RD52-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9852 1 158 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A258FPN9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9813 7 156 GO:0005975
GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A539D0F2-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.975 2 156 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-V4P1R3-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9704 1 153 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A3D5ZYZ9-F1-model_v4 deleted 0.9692 4 156

Map