F449888

General Info

Members Datasets Scaffolds Average Seq Length
467 348 285 155

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0093798|Ga0466961_0093798_611_1159
Length 182
Sequence MPLAVRYRTVHGTSRKGNEGADRMSKKADGKVLAQNKKASHDYFIEDTYECGMVLTGTEIKSLRQGRANISDAFATIRNGEAFVHNLHITPFEQGNRHNPSDATRARKLLLKKYEIDKLLGLSKQEGYTLVPLKIYVRNGYAKLLLGLGKGKKQYDKRDAAAKRDAQREIQRALREKQKIAR

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
5 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
7 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
8 2554235283 Bacillus safensis VK Isolate Rhizosphere
9 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
10 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
11 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
12 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
13 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
14 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
15 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
16 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
17 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
18 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
19 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
20 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
21 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
22 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
23 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
24 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
25 2643221729 Bacillus sp. Root11 Isolate Unclassified
26 2643221730 Bacillus sp. Root131 Isolate Unclassified
27 2643221731 Bacillus sp. Root147 Isolate Unclassified
28 2643221732 Bacillus sp. Root239 Isolate Unclassified
29 2643221735 Bacillus sp. Root920 Isolate Unclassified
30 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
31 2671180694 Paenibacillus sp. A3 Isolate Unclassified
32 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
33 2684622632 Bacillus cereus 905 Isolate Unclassified
34 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
35 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
36 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
37 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
38 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
39 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
40 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
41 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
42 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
43 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
44 2738541358 Bacillus sp. OV752 Isolate Unclassified
45 2738543006 Bacillus sp. OK077 Isolate Unclassified
46 2738543010 Bacillus sp. YR335 Isolate Unclassified
47 2738543017 Bacillus sp. OV186 Isolate Unclassified
48 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
49 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
50 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
51 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
52 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
53 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
54 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
55 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
56 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
57 2811994870 Bacillus sp. JB4 Isolate Unclassified
58 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
59 2818991441 Niallia circulans 3243 Isolate Rhizosphere
60 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
61 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
62 2818991459 Paenibacillus sp. 597 Isolate Unclassified
63 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
64 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
65 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
66 2842882022 Bacillus sp. R-71893 Isolate Unclassified
67 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
68 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
69 2857472729 Cohnella sp. R-74144 Isolate Unclassified
70 2857586860 Bacillus sp. R-71935 Isolate Unclassified
71 2860837431 Bacillus sp. WR11 Isolate Unclassified
72 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
73 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
74 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
75 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
76 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
77 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
78 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
79 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
80 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
81 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
82 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
83 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
84 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
85 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
86 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
87 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
88 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
89 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
90 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
91 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
92 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
93 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
94 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
95 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
96 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
97 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
98 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
99 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
100 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
101 2919720352 Priestia megaterium 4340 Isolate Unclassified
102 2919726948 Bacillus pumilus 4489 Isolate Unclassified
103 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
104 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
105 2929004312 Priestia megaterium 1104 Isolate Unclassified
106 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
107 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
108 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
109 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
110 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
111 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
112 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
113 2938917290 Bacillus sp. CR71 Isolate Unclassified
114 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
115 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
116 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
117 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
118 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
119 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
120 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
121 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
122 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
123 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
124 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
125 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
126 2965761152 Bacillus sp. COPE52 Isolate Unclassified
127 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
128 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
129 2969141011 Bacillus velezensis MH25 Isolate Unclassified
130 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
131 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
132 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
133 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
134 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
135 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
136 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
137 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
138 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
139 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
140 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
141 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
142 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
143 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
144 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
145 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
146 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
147 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
148 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
149 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
150 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
151 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
152 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
153 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
154 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
155 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
156 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
157 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
158 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
159 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
160 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
161 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
162 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
163 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
164 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
165 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
166 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
167 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
168 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
169 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
170 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
171 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
175 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
176 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
177 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
182 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
183 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
184 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
185 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
186 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
187 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
188 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
189 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
194 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
197 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
202 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
203 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
204 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
205 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
207 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
211 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
218 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
237 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
238 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
239 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
256 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
257 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
323 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
327 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
328 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
329 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
330 8022653035 Bacillus sp. Rc4 Isolate Unclassified
331 8022792930 Bacillus sp. Xin Isolate Rhizosphere
332 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
333 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
334 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
335 8023438354 Bacillus sp. BH2 Isolate Unclassified
336 8023444577 Bacillus sp. BH32 Isolate Unclassified
337 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
338 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
339 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
340 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
341 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
342 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
343 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
344 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
345 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
346 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
347 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
348 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 54.39
Metatranscriptomes 6.64
Isolates 38.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 13.06
Nodule 0.21
Rhizoplane 5.14
Rhizosphere 52.03
Stem 0
Stem Tuber 0
Unclassified 29.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1037342 3300002987 Bacteria 730
2 JGI25151J46595_10000011 3300003187 Bacteria 264206
3 JGI25151J46595_10002559 3300003187 Bacteria 10769
4 JGI25151J46595_10010666 3300003187 Bacteria 4254
5 JGI25151J46595_10010737 3300003187 Bacteria 4238
6 JGI25151J46595_10016063 3300003187 Bacteria 3281
7 JGI25151J46595_10065714 3300003187 Bacteria 1128
8 JGI25151J46595_10066317 3300003187 Bacteria 1118
9 JGI25151J46595_10104044 3300003187 Bacteria 758
10 rootH1_10013690 3300003316 Bacteria 30657
11 rootH2_10009450 3300003320 Bacteria 8806
12 rootL2_10016501 3300003322 Bacteria 51953
13 rootH1_10085546 3300003323 Bacteria 1572
14 Ga0007410J51695_1112272 3300003574 Bacteria 762
15 Ga0006562J51391_1000005 3300003578 Bacteria 6390
16 Ga0006562J51391_1000006 3300003578 Bacteria 14010
17 Ga0055538_1001723 3300003751 Bacteria 3824
18 Ga0055532_1000052 3300003758 Bacteria 164911
19 Ga0055535_1012078 3300003761 Bacteria 1334
20 Ga0055536_1013000 3300003781 Bacteria 3038
21 Ga0055536_1031799 3300003781 Bacteria 1376
22 Ga0055528_1001485 3300003790 Bacteria 14238
23 Ga0055541_1000809 3300003841 Bacteria 7723
24 Ga0055541_1002282 3300003841 Bacteria 3868
25 Ga0055541_1010123 3300003841 Bacteria 1431
26 Ga0058692_1030527 3300003856 Bacteria 1022
27 Ga0065704_10309180 3300005289 Bacteria 871
28 Ga0070670_100027574 3300005331 Bacteria 4886
29 Ga0070687_100030250 3300005343 Bacteria 2646
30 Ga0070675_100067208 3300005354 Bacteria 2966
31 Ga0070671_100038131 3300005355 Bacteria 3989
32 Ga0070674_100394293 3300005356 Bacteria 1129
33 Ga0068859_101400159 3300005617 Bacteria 771
34 Ga0068863_101073078 3300005841 Bacteria 809
35 Ga0070715_10465889 3300006163 Bacteria 716
36 Ga0070716_100430302 3300006173 Bacteria 957
37 Ga0075430_101495480 3300006846 Bacteria 555
38 Ga0075436_100322745 3300006914 Bacteria 1109
39 Ga0097620_101400617 3300006931 Bacteria 771
40 Ga0105244_10013670 3300009036 Bacteria 4730
41 Ga0105244_10036685 3300009036 Bacteria 2566
42 Ga0105244_10071251 3300009036 Bacteria 1733
43 Ga0105250_10170154 3300009092 Bacteria 912
44 Ga0105250_10225455 3300009092 Bacteria 796
45 Ga0111539_10009505 3300009094 Bacteria 12271
46 Ga0105245_10002785 3300009098 Bacteria 15726
47 Ga0105247_10003177 3300009101 Bacteria 10827
48 Ga0114129_10501427 3300009147 Bacteria 1585
49 Ga0105243_10002111 3300009148 Bacteria 16808
50 Ga0105242_10002349 3300009176 Bacteria 14931
51 Ga0105249_10047383 3300009553 Bacteria 3917
52 Ga0105239_10481393 3300010375 Bacteria 1410
53 Ga0105246_10000609 3300011119 Bacteria 19894
54 Ga0157371_10139093 3300013102 Bacteria 1729
55 Ga0157371_10245887 3300013102 Bacteria 1287
56 Ga0157369_11132575 3300013105 Bacteria 799
57 Ga0157374_10292440 3300013296 Bacteria 1610
58 Ga0157378_10002671 3300013297 Bacteria 15876
59 Ga0157372_10036485 3300013307 Bacteria 5418
60 Ga0157376_10251332 3300014969 Bacteria 1651
61 Ga0206350_10788394 3300020080 Bacteria 819
62 Ga0213875_10053316 3300021388 Unclassified 1894
63 Ga0209784_100179 3300025224 Bacteria 52867
64 Ga0209784_100260 3300025224 Bacteria 32509
65 Ga0209784_102061 3300025224 Bacteria 2210
66 Ga0209784_105938 3300025224 Bacteria 711
67 Ga0209566_100086 3300025225 Bacteria 148250
68 Ga0209566_100249 3300025225 Bacteria 51510
69 Ga0209566_100305 3300025225 Bacteria 44437
70 Ga0209566_103107 3300025225 Bacteria 2694
71 Ga0209147_100028 3300025229 Bacteria 383994
72 Ga0209147_101060 3300025229 Bacteria 11624
73 Ga0209147_110531 3300025229 Bacteria 1056
74 Ga0209147_116999 3300025229 Bacteria 701
75 Ga0209437_100489 3300025233 Bacteria 29197
76 Ga0209258_101578 3300025242 Bacteria 7577
77 Ga0209673_1001521 3300025273 Bacteria 21244
78 Ga0209130_1009459 3300025284 Bacteria 2777
79 Ga0209675_1021559 3300025291 Bacteria 1715
80 Ga0209675_1027424 3300025291 Bacteria 1401
81 Ga0209675_1028328 3300025291 Bacteria 1362
82 Ga0209676_1000768 3300025292 Bacteria 43022
83 Ga0209676_1006542 3300025292 Bacteria 5722
84 Ga0209676_1007041 3300025292 Bacteria 5395
85 Ga0209025_1000011 3300025294 Bacteria 976387
86 Ga0209025_1000095 3300025294 Bacteria 240057
87 Ga0209025_1000642 3300025294 Bacteria 61658
88 Ga0209025_1002919 3300025294 Bacteria 17032
89 Ga0209025_1003495 3300025294 Bacteria 14799
90 Ga0209025_1008543 3300025294 Bacteria 7350
91 Ga0209025_1012144 3300025294 Bacteria 5564
92 Ga0209025_1012205 3300025294 Bacteria 5539
93 Ga0209025_1013040 3300025294 Bacteria 5259
94 Ga0209025_1014805 3300025294 Bacteria 4762
95 Ga0209025_1015573 3300025294 Bacteria 4569
96 Ga0209025_1018339 3300025294 Bacteria 3975
97 Ga0209025_1022178 3300025294 Bacteria 3381
98 Ga0209025_1022334 3300025294 Bacteria 3361
99 Ga0209025_1022552 3300025294 Bacteria 3332
100 Ga0209025_1057428 3300025294 Bacteria 1487
101 Ga0209025_1091709 3300025294 Bacteria 991
102 Ga0209025_1096045 3300025294 Bacteria 953
103 Ga0209025_1142185 3300025294 Bacteria 677
104 Ga0207426_1005950 3300025302 Bacteria 5414
105 Ga0207696_1001111 3300025711 Bacteria 15675
106 Ga0207696_1001753 3300025711 Bacteria 11225
107 Ga0207696_1025616 3300025711 Bacteria 1836
108 Ga0207655_1001115 3300025728 Bacteria 26233
109 Ga0207655_1011871 3300025728 Bacteria 5142
110 Ga0207655_1074620 3300025728 Bacteria 1247
111 Ga0207713_1001493 3300025735 Bacteria 18477
112 Ga0207713_1003276 3300025735 Bacteria 11137
113 Ga0207710_10212596 3300025900 Bacteria 958
114 Ga0207662_10042254 3300025918 Bacteria 2686
115 Ga0207681_10328913 3300025923 Bacteria 1218
116 Ga0207659_10238306 3300025926 Bacteria 1470
117 Ga0207687_10049025 3300025927 Bacteria 2935
118 Ga0207644_10116266 3300025931 Bacteria 2029
119 Ga0207686_10007902 3300025934 Bacteria 5735
120 Ga0207709_10011471 3300025935 Bacteria 4888
121 Ga0207670_10705460 3300025936 Bacteria 835
122 Ga0209973_1001839 3300027252 Bacteria 1907
123 Ga0209371_1010609 3300027312 Bacteria 2813
124 Ga0209969_1014719 3300027360 Bacteria 1140
125 Ga0209982_1080614 3300027552 Bacteria 536
126 Ga0209974_10012955 3300027876 Bacteria 2783
127 Ga0207428_10013924 3300027907 Bacteria 7006
128 Ga0265326_10007712 3300028558 Bacteria 3283
129 Ga0265319_1001474 3300028563 Bacteria 14051
130 Ga0265334_10027846 3300028573 Unclassified 2274
131 Ga0265318_10000552 3300028577 Bacteria 26525
132 Ga0265338_10008856 3300028800 Bacteria 12134
133 Ga0265324_10207263 3300029957 Unclassified 666
134 Ga0268256_1002179 3300030500 Bacteria 10368
135 Ga0265327_10016871 3300031251 Bacteria 4612
136 Ga0265316_10239406 3300031344 Bacteria 1334
137 Ga0307408_100011432 3300031548 Bacteria 5866
138 Ga0307408_100100533 3300031548 Bacteria 2202
139 Ga0307408_100658434 3300031548 Bacteria 937
140 Ga0307405_10495702 3300031731 Bacteria 978
141 Ga0307416_100007832 3300032002 Bacteria 6830
142 Ga0307416_100103246 3300032002 Bacteria 2488
143 Ga0307416_101988948 3300032002 Bacteria 684
144 Ga0373942_0038435 3300035207 Unclassified 1298
145 Ga0373931_0007175 3300035691 Bacteria 5242
146 Ga0395899_0178628 3300037312 Bacteria 1491
147 Ga0395899_0299970 3300037312 Bacteria 1087
148 Ga0395899_0308720 3300037312 Bacteria 1068
149 Ga0395898_0510049 3300037466 Bacteria 1144
150 Ga0436364_0524014 3300037853 Unclassified 2170
151 Ga0237819_01516 3300038705 Bacteria 5919
152 Ga0237819_01695 3300038705 Bacteria 5353
153 Ga0400489_75614 3300039093 Bacteria 1893
154 Ga0451855_0363658 3300041511 Bacteria 2851
155 Ga0439449_0005341 3300042007 Bacteria 4920
156 Ga0439457_036522 3300042014 Bacteria 1093
157 Ga0439462_0022858 3300042015 Bacteria 1637
158 Ga0466969_0013723 3300044656 Bacteria 4265
159 Ga0466961_0093798 3300044693 Bacteria 1894
160 Ga0466963_0568554 3300044694 Bacteria 801
161 Ga0453684_0289267 3300044712 Bacteria 1866
162 Ga0466968_0039307 3300044735 Bacteria 1991
163 Ga0466970_0442836 3300044765 Bacteria 744
164 Ga0451576_0704571 3300045051 Bacteria 1061
165 Ga0466967_0005089 3300045976 Bacteria 9025
166 Ga0495627_068875 3300046453 Bacteria 1036
167 Ga0495603_0062485 3300046455 Bacteria 2198
168 Ga0495590_0005864 3300046457 Bacteria 4824
169 Ga0495590_0116049 3300046457 Bacteria 958
170 Ga0495605_0192797 3300046474 Bacteria 891
171 Ga0495584_0020626 3300046491 Bacteria 3347
172 Ga0495585_0020071 3300046492 Bacteria 3845
173 Ga0495607_0104543 3300046501 Bacteria 1511
174 Ga0495631_0170661 3300046518 Bacteria 933
175 Ga0495637_0093704 3300046520 Bacteria 1181
176 Ga0495622_0012122 3300046557 Bacteria 3988
177 Ga0495633_0040592 3300046558 Bacteria 2216
178 Ga0495611_0071339 3300046648 Bacteria 1588
179 Ga0495661_0035158 3300046665 Bacteria 3147
180 Ga0495661_0119708 3300046665 Bacteria 1456
181 Ga0495589_0045580 3300046794 Bacteria 2178
182 Ga0495589_0177228 3300046794 Bacteria 1012
183 Ga0495660_0008527 3300046810 Bacteria 5999
184 Ga0495676_0133201 3300047321 Bacteria 1791
185 Ga0495683_0040638 3300047323 Bacteria 2349
186 Ga0495626_0097203 3300048091 Bacteria 1288
187 Ga0496100_0004530 3300048903 Bacteria 7382
188 Ga0496100_0162709 3300048903 Bacteria 1601
189 Ga0496101_0059679 3300048904 Bacteria 2765
190 Ga0496102_0097660 3300048905 Bacteria 2724
191 Ga0496102_0144149 3300048905 Bacteria 2234
192 Ga0496102_0463293 3300048905 Bacteria 1188
193 Ga0496104_0000453 3300048907 Bacteria 35518
194 Ga0496104_1204757 3300048907 Bacteria 660
195 Ga0496105_0033025 3300048908 Bacteria 4248
196 Ga0496106_0000643 3300048909 Bacteria 25037
197 Ga0496107_0000172 3300048910 Bacteria 33695
198 Ga0496108_0000949 3300048911 Bacteria 22523
199 Ga0496109_0009261 3300048912 Bacteria 8387
200 Ga0496110_0305289 3300048913 Bacteria 1449
201 Ga0496110_1008506 3300048913 Bacteria 740
202 Ga0496111_0003249 3300048914 Bacteria 10036
203 Ga0496112_0138931 3300048915 Bacteria 2399
204 Ga0496113_0059779 3300048916 Bacteria 2871
205 Ga0496113_0172672 3300048916 Bacteria 1712
206 Ga0496115_0849161 3300048918 Unclassified 707
207 Ga0496116_0006796 3300048919 Bacteria 10289
208 Ga0496116_0007739 3300048919 Bacteria 9452
209 Ga0496116_0017146 3300048919 Bacteria 5637
210 Ga0496116_0022500 3300048919 Bacteria 4722
211 Ga0496116_0024877 3300048919 Bacteria 4415
212 Ga0496116_0034657 3300048919 Bacteria 3558
213 Ga0496116_0053524 3300048919 Bacteria 2665
214 Ga0496116_0111017 3300048919 Bacteria 1611
215 Ga0496116_0141723 3300048919 Bacteria 1351
216 Ga0496117_0007241 3300048920 Bacteria 10914
217 Ga0496117_0090970 3300048920 Bacteria 1964
218 Ga0496118_0087941 3300048921 Bacteria 2152
219 Ga0496119_0001074 3300048922 Bacteria 34593
220 Ga0496119_0006268 3300048922 Bacteria 11094
221 Ga0496119_0051059 3300048922 Bacteria 2544
222 Ga0496119_0087493 3300048922 Bacteria 1778
223 Ga0496119_0262934 3300048922 Bacteria 865
224 Ga0496120_0000625 3300048923 Bacteria 53008
225 Ga0496120_0081161 3300048923 Bacteria 1755
226 Ga0496121_0054995 3300048924 Bacteria 3320
227 Ga0496121_0219976 3300048924 Bacteria 1338
228 Ga0496121_0270297 3300048924 Bacteria 1169
229 Ga0496121_0270327 3300048924 Bacteria 1169
230 Ga0496121_0366353 3300048924 Bacteria 955
231 Ga0496121_0438916 3300048924 Bacteria 844
232 Ga0496122_0007888 3300048925 Bacteria 11682
233 Ga0496122_0013199 3300048925 Bacteria 8111
234 Ga0496122_0024156 3300048925 Bacteria 5327
235 Ga0496122_0053629 3300048925 Bacteria 3037
236 Ga0496122_0105043 3300048925 Bacteria 1875
237 Ga0496122_0147243 3300048925 Bacteria 1461
238 Ga0496122_0198064 3300048925 Bacteria 1177
239 Ga0496122_0205802 3300048925 Bacteria 1145
240 Ga0496123_0009169 3300048926 Bacteria 8947
241 Ga0496123_0136162 3300048926 Bacteria 1351
242 Ga0496123_0254245 3300048926 Bacteria 865
243 Ga0496123_0284620 3300048926 Bacteria 797
244 Ga0496124_0000062 3300048927 Bacteria 232676
245 Ga0496124_0002018 3300048927 Bacteria 27612
246 Ga0496124_0175303 3300048927 Bacteria 1656
247 Ga0496125_0002664 3300048928 Bacteria 22824
248 Ga0496125_0004095 3300048928 Bacteria 17059
249 Ga0496125_0006322 3300048928 Bacteria 12851
250 Ga0496126_0006153 3300048929 Bacteria 13441
251 Ga0496126_0010713 3300048929 Bacteria 9578
252 Ga0496126_0015421 3300048929 Bacteria 7688
253 Ga0496126_0521521 3300048929 Bacteria 947
254 Ga0501306_012892 3300049127 Bacteria 1083
255 Ga0501343_000351 3300049132 Bacteria 2638
256 Ga0501343_001506 3300049132 Bacteria 1589
257 Ga0501343_008513 3300049132 Bacteria 821
258 Ga0501343_010397 3300049132 Bacteria 759
259 Ga0501305_002177 3300049161 Bacteria 2073
260 Ga0501305_003222 3300049161 Bacteria 1835
261 Ga0501305_025957 3300049161 Bacteria 891
262 Ga0501311_046558 3300049527 Bacteria 670
263 Ga0501312_011300 3300049528 Bacteria 1211
264 Ga0501312_021245 3300049528 Bacteria 965
265 Ga0501312_046210 3300049528 Bacteria 724
266 Ga0501315_002419 3300049531 Bacteria 1752
267 Ga0501315_038750 3300049531 Bacteria 714
268 Ga0501316_014816 3300049532 Bacteria 933
269 Ga0501316_016865 3300049532 Bacteria 892
270 Ga0501316_017890 3300049532 Bacteria 872
271 Ga0501317_011291 3300049533 Bacteria 1083
272 Ga0501317_036222 3300049533 Bacteria 737
273 Ga0501318_008322 3300049534 Bacteria 1105
274 Ga0501318_018104 3300049534 Bacteria 867
275 Ga0501321_004607 3300049537 Bacteria 1325
276 Ga0501321_017394 3300049537 Bacteria 864
277 Ga0501321_023798 3300049537 Bacteria 779
278 Ga0501335_004269 3300049551 Bacteria 1243
279 Ga0501335_011044 3300049551 Bacteria 879
280 Ga0501340_000836 3300049556 Bacteria 1509
281 Ga0501208_019401 3300049655 Bacteria 1094
282 Ga0501217_004274 3300049661 Bacteria 2927
283 Ga0501217_009953 3300049661 Bacteria 2075
284 nmdc:mga08y16_92262_c1 3300050511 Bacteria 3156
285 Ga0500566_0001079 3300053094 Bacteria 15798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025284 Ga0209130_1009459 Ga0209130_10094593 130
2 3300048919 Ga0496116_0111017 Ga0496116_0111017_161_637 143
3 3300048919 Ga0496116_0141723 Ga0496116_0141723_372_854 145
4 3300048925 Ga0496122_0105043 Ga0496122_0105043_831_1313 145
5 3300048926 Ga0496123_0254245 Ga0496123_0254245_299_781 145
6 3300025224 Ga0209784_100260 Ga0209784_1002602 146
7 3300048924 Ga0496121_0270327 Ga0496121_0270327_335_814 146
8 3300025229 Ga0209147_116999 Ga0209147_1169991 147
9 3300025233 Ga0209437_100489 Ga0209437_10048921 147
10 3300048919 Ga0496116_0022500 Ga0496116_0022500_3618_4100 147
11 3300048925 Ga0496122_0147243 Ga0496122_0147243_145_627 147
12 3300009036 Ga0105244_10071251 Ga0105244_100712512 148
13 3300025229 Ga0209147_110531 Ga0209147_1105311 148
14 3300025291 Ga0209675_1021559 Ga0209675_10215591 148
15 3300025294 Ga0209025_1003495 Ga0209025_10034956 148
16 3300025728 Ga0207655_1074620 Ga0207655_10746201 148
17 3300046665 Ga0495661_0119708 Ga0495661_0119708_213_695 148
18 3300048091 Ga0495626_0097203 Ga0495626_0097203_49_531 148
19 3300048924 Ga0496121_0270297 Ga0496121_0270297_195_677 148
20 3300003841 Ga0055541_1000809 Ga0055541_10008092 149
21 3300025224 Ga0209784_102061 Ga0209784_1020613 149
22 3300025225 Ga0209566_100305 Ga0209566_10030516 149
23 3300032002 Ga0307416_101988948 Ga0307416_1019889481 149
24 3300042007 Ga0439449_0005341 Ga0439449_0005341_3651_4172 149
25 3300042014 Ga0439457_036522 Ga0439457_036522_69_590 149
26 3300042015 Ga0439462_0022858 Ga0439462_0022858_201_722 149
27 3300045051 Ga0451576_0704571 Ga0451576_0704571_41_496 149
28 3300048919 Ga0496116_0007739 Ga0496116_0007739_3225_3704 149
29 3300048919 Ga0496116_0017146 Ga0496116_0017146_2028_2510 149
30 3300048919 Ga0496116_0024877 Ga0496116_0024877_2590_3069 149
31 3300048920 Ga0496117_0007241 Ga0496117_0007241_2605_3084 149
32 3300048922 Ga0496119_0001074 Ga0496119_0001074_24988_25467 149
33 3300048922 Ga0496119_0051059 Ga0496119_0051059_781_1260 149
34 3300048923 Ga0496120_0000625 Ga0496120_0000625_43755_44234 149
35 3300048923 Ga0496120_0081161 Ga0496120_0081161_154_633 149
36 3300048924 Ga0496121_0054995 Ga0496121_0054995_2404_2883 149
37 3300048924 Ga0496121_0438916 Ga0496121_0438916_54_533 149
38 3300048925 Ga0496122_0013199 Ga0496122_0013199_7519_7998 149
39 3300048925 Ga0496122_0024156 Ga0496122_0024156_1343_1825 149
40 3300048925 Ga0496122_0198064 Ga0496122_0198064_396_878 149
41 3300048926 Ga0496123_0009169 Ga0496123_0009169_92_574 149
42 3300048927 Ga0496124_0000062 Ga0496124_0000062_41283_41762 149
43 3300048927 Ga0496124_0002018 Ga0496124_0002018_507_989 149
44 3300048928 Ga0496125_0002664 Ga0496125_0002664_21074_21553 149
45 3300048928 Ga0496125_0006322 Ga0496125_0006322_11673_12155 149
46 3300048929 Ga0496126_0006153 Ga0496126_0006153_9848_10327 149
47 3300048929 Ga0496126_0015421 Ga0496126_0015421_1273_1752 149
48 3300049161 Ga0501305_025957 Ga0501305_025957_17_544 149
49 3300049527 Ga0501311_046558 Ga0501311_046558_55_582 149
50 3300049655 Ga0501208_019401 Ga0501208_019401_287_814 149
51 3300049661 Ga0501217_004274 Ga0501217_004274_888_1415 149
52 iso_pu_bacteria 2929297113 2929299644 149
53 3300013102 Ga0157371_10139093 Ga0157371_101390931 150
54 3300028558 Ga0265326_10007712 Ga0265326_100077123 150
55 3300028563 Ga0265319_1001474 Ga0265319_10014743 150
56 3300028573 Ga0265334_10027846 Ga0265334_100278462 150
57 3300028577 Ga0265318_10000552 Ga0265318_100005528 150
58 3300028800 Ga0265338_10008856 Ga0265338_100088569 150
59 3300029957 Ga0265324_10207263 Ga0265324_102072631 150
60 3300039093 Ga0400489_75614 Ga0400489_75614_1327_1788 150
61 3300041511 Ga0451855_0363658 Ga0451855_0363658_1542_1994 150
62 3300053094 Ga0500566_0001079 Ga0500566_0001079_10344_10799 150
63 iso_pu_bacteria 2599185353 2600198949 150
64 iso_pu_bacteria 2600254943 2600400568 150
65 iso_pu_bacteria 2857357740 2857367674 150
66 3300005343 Ga0070687_100030250 Ga0070687_1000302503 151
67 3300021388 Ga0213875_10053316 Ga0213875_100533162 151
68 3300025918 Ga0207662_10042254 Ga0207662_100422543 151
69 3300035207 Ga0373942_0038435 Ga0373942_0038435_579_1043 151
70 3300035691 Ga0373931_0007175 Ga0373931_0007175_850_1314 151
71 3300037853 Ga0436364_0524014 Ga0436364_0524014_190_669 151
72 3300044712 Ga0453684_0289267 Ga0453684_0289267_634_1092 151
73 iso_pu_bacteria 2511231119 2511701090 151
74 iso_pu_bacteria 2540341094 2540608275 151
75 iso_pu_bacteria 2545555800 2545559695 151
76 iso_pu_bacteria 2551306519 2553394413 151
77 iso_pu_bacteria 2554235283 2555468278 151
78 iso_pu_bacteria 2554235469 2556064803 151
79 iso_pu_bacteria 2576861599 2578930653 151
80 iso_pu_bacteria 2593339131 2595090551 151
81 iso_pu_bacteria 2630968484 2631983594 151
82 iso_pu_bacteria 2643221729 2644707310 151
83 iso_pu_bacteria 2643221730 2644714267 151
84 iso_pu_bacteria 2643221731 2644720326 151
85 iso_pu_bacteria 2643221732 2644726590 151
86 iso_pu_bacteria 2643221735 2644738906 151
87 iso_pu_bacteria 2648501850 2651530703 151
88 iso_pu_bacteria 2671180844 2674421971 151
89 iso_pu_bacteria 2684622632 2685153067 151
90 iso_pu_bacteria 2684623153 2686998426 151
91 iso_pu_bacteria 2687453109 2687499703 151
92 iso_pu_bacteria 2695420354 2695629041 151
93 iso_pu_bacteria 2695420987 2698320118 151
94 iso_pu_bacteria 2703719227 2705996991 151
95 iso_pu_bacteria 2711768088 2712197137 151
96 iso_pu_bacteria 2716884898 2717915258 151
97 iso_pu_bacteria 2718218445 2721508225 151
98 iso_pu_bacteria 2738541358 2739157156 151
99 iso_pu_bacteria 2738543006 2739209094 151
100 iso_pu_bacteria 2738543010 2739233476 151
101 iso_pu_bacteria 2738543017 2739269768 151
102 iso_pu_bacteria 2757320391 2757567303 151
103 iso_pu_bacteria 2775507177 2777761799 151
104 iso_pu_bacteria 2775507192 2777837707 151
105 iso_pu_bacteria 2788500588 2791215154 151
106 iso_pu_bacteria 2808606364 2808870170 151
107 iso_pu_bacteria 2808606399 2809053410 151
108 iso_pu_bacteria 2811994870 2812317564 151
109 iso_pu_bacteria 2816332295 2817481705 151
110 iso_pu_bacteria 2818991443 2819582433 151
111 iso_pu_bacteria 2818991451 2819628281 151
112 iso_pu_bacteria 2818991465 2819711174 151
113 iso_pu_bacteria 2818991468 2819722620 151
114 iso_pu_bacteria 2823526263 2823529534 151
115 iso_pu_bacteria 2842882022 2842886265 151
116 iso_pu_bacteria 2857472729 2857478043 151
117 iso_pu_bacteria 2857586860 2857589448 151
118 iso_pu_bacteria 2860837431 2860841073 151
119 iso_pu_bacteria 2864733723 2864737275 151
120 iso_pu_bacteria 2877768649 2877771975 151
121 iso_pu_bacteria 2880169592 2880172813 151
122 iso_pu_bacteria 2881644220 2881645949 151
123 iso_pu_bacteria 2889042446 2889042641 151
124 iso_pu_bacteria 2897109615 2897113093 151
125 iso_pu_bacteria 2904162308 2904167186 151
126 iso_pu_bacteria 2904490793 2904496548 151
127 iso_pu_bacteria 2904524088 2904528679 151
128 iso_pu_bacteria 2904560550 2904561412 151
129 iso_pu_bacteria 2904606771 2904610368 151
130 iso_pu_bacteria 2908665501 2908666904 151
131 iso_pu_bacteria 2919093281 2919095082 151
132 iso_pu_bacteria 2919143609 2919148310 151
133 iso_pu_bacteria 2919160200 2919165706 151
134 iso_pu_bacteria 2919414237 2919416218 151
135 iso_pu_bacteria 2919517244 2919521923 151
136 iso_pu_bacteria 2919720352 2919725055 151
137 iso_pu_bacteria 2919726948 2919727655 151
138 iso_pu_bacteria 2928093941 2928098346 151
139 iso_pu_bacteria 2929004312 2929007777 151
140 iso_pu_bacteria 2929233124 2929238783 151
141 iso_pu_bacteria 2931384279 2931386066 151
142 iso_pu_bacteria 2936340661 2936344786 151
143 iso_pu_bacteria 2936361878 2936362515 151
144 iso_pu_bacteria 2938917290 2938922996 151
145 iso_pu_bacteria 2939593269 2939596036 151
146 iso_pu_bacteria 2939679117 2939684243 151
147 iso_pu_bacteria 2945991243 2945995324 151
148 iso_pu_bacteria 2946053406 2946058029 151
149 iso_pu_bacteria 2947426588 2947431867 151
150 iso_pu_bacteria 2954773129 2954776928 151
151 iso_pu_bacteria 2956897341 2956897468 151
152 iso_pu_bacteria 2960319331 2960321247 151
153 iso_pu_bacteria 2960375949 2960378518 151
154 iso_pu_bacteria 2962290636 2962294304 151
155 iso_pu_bacteria 2964375228 2964376360 151
156 iso_pu_bacteria 2965761152 2965766402 151
157 iso_pu_bacteria 2969136845 2969140279 151
158 iso_pu_bacteria 2969141011 2969144530 151
159 iso_pu_bacteria 2969765954 2969768945 151
160 iso_pu_bacteria 2969770375 2969771275 151
161 iso_pu_bacteria 2971893375 2971896650 151
162 iso_pu_bacteria 2979083700 2979088779 151
163 iso_pu_bacteria 2980492589 2980496065 151
164 iso_pu_bacteria 3001267043 3001269073 151
165 iso_pu_bacteria 3001272096 3001274512 151
166 iso_pu_bacteria 3006826541 3006826592 151
167 iso_pu_bacteria 3006858327 3006862137 151
168 iso_pu_bacteria 3006879489 3006882810 151
169 iso_pu_bacteria 3006973921 3006976544 151
170 iso_pu_bacteria 3006978542 3006980812 151
171 iso_pu_bacteria 3006984091 3006986958 151
172 iso_pu_bacteria 3006988479 3006991428 151
173 iso_pu_bacteria 8022621104 8022626578 151
174 iso_pu_bacteria 8022630665 8022633238 151
175 iso_pu_bacteria 8022653035 8022657098 151
176 iso_pu_bacteria 8022893055 8022894297 151
177 iso_pu_bacteria 8022914991 8022918592 151
178 iso_pu_bacteria 8022948649 8022953319 151
179 iso_pu_bacteria 8023438354 8023441213 151
180 iso_pu_bacteria 8023444577 8023448785 151
181 iso_pu_bacteria 8051952484 8051954408 151
182 iso_pu_bacteria 8052174270 8052175509 151
183 iso_pu_bacteria 8054280661 8054284869 151
184 iso_pu_bacteria 8055531788 8055536275 151
185 iso_pu_bacteria 8057582654 8057587519 151
186 3300025936 Ga0207670_10705460 Ga0207670_107054602 152
187 iso_pu_bacteria 2563366752 2563929119 152
188 iso_pu_bacteria 2571042143 2571532576 152
189 iso_pu_bacteria 2571042588 2573038957 152
190 iso_pu_bacteria 2576861424 2578334693 152
191 iso_pu_bacteria 2579778775 2580934766 152
192 iso_pu_bacteria 2600255286 2601640982 152
193 iso_pu_bacteria 2619619294 2621272720 152
194 iso_pu_bacteria 2671180694 2673820044 152
195 iso_pu_bacteria 2728369359 2730137673 152
196 iso_pu_bacteria 2751185905 2753811240 152
197 iso_pu_bacteria 2802428803 2802440459 152
198 iso_pu_bacteria 2864997549 2865001847 152
199 iso_pu_bacteria 2881636855 2881641424 152
200 iso_pu_bacteria 2888578766 2888579239 152
201 iso_pu_bacteria 2889049205 2889052226 152
202 iso_pu_bacteria 2889276214 2889277643 152
203 iso_pu_bacteria 2889295896 2889299496 152
204 iso_pu_bacteria 2904113452 2904119829 152
205 iso_pu_bacteria 2904595352 2904599924 152
206 iso_pu_bacteria 2925326138 2925333609 152
207 iso_pu_bacteria 2929206907 2929207218 152
208 iso_pu_bacteria 2938649242 2938651624 152
209 iso_pu_bacteria 2939702853 2939706203 152
210 iso_pu_bacteria 2968558590 2968564285 152
211 iso_pu_bacteria 2971403814 2971410102 152
212 iso_pu_bacteria 2971511577 2971513689 152
213 iso_pu_bacteria 2980125574 2980130505 152
214 iso_pu_bacteria 2980176882 2980178513 152
215 iso_pu_bacteria 2981284811 2981288597 152
216 iso_pu_bacteria 2981289755 2981293419 152
217 iso_pu_bacteria 2981980479 2981984342 152
218 iso_pu_bacteria 2981985349 2981989136 152
219 iso_pu_bacteria 2988225383 2988226654 152
220 iso_pu_bacteria 2996632988 2996639223 152
221 iso_pu_bacteria 2996706504 2996710459 152
222 iso_pu_bacteria 648028048 648168134 152
223 iso_pu_bacteria 8002317523 8002317920 152
224 iso_pu_bacteria 8022792930 8022797764 152
225 iso_pu_bacteria 8046991243 8046992832 152
226 iso_pu_bacteria 8054795415 8054801908 152
227 iso_pu_bacteria 8057733483 8057736014 152
228 iso_pu_bacteria 8057977335 8057980103 152
229 3300031251 Ga0265327_10016871 Ga0265327_100168712 153
230 iso_pu_bacteria 2512564039 2512729638 153
231 iso_pu_bacteria 2524023129 2524189809 153
232 iso_pu_bacteria 2585428059 2587741932 153
233 iso_pu_bacteria 2593339198 2595318769 153
234 iso_pu_bacteria 2643221676 2644422585 153
235 iso_pu_bacteria 2791355222 2793181852 153
236 iso_pu_bacteria 2818991459 2819675439 153
237 iso_pu_bacteria 2857453340 2857459659 153
238 iso_pu_bacteria 2865002811 2865006549 153
239 iso_pu_bacteria 2904755435 2904761679 153
240 iso_pu_bacteria 2907202186 2907208300 153
241 iso_pu_bacteria 2919425241 2919430038 153
242 iso_pu_bacteria 2971410472 2971412772 153
243 iso_pu_bacteria 2980182181 2980189367 153
244 iso_pu_bacteria 2984527788 2984532118 153
245 iso_pu_bacteria 2984532647 2984533373 153
246 iso_pu_bacteria 8055632911 8055636781 153
247 iso_pu_bacteria 8056533031 8056536170 153
248 3300003781 Ga0055536_1013000 Ga0055536_10130005 154
249 3300009036 Ga0105244_10036685 Ga0105244_100366853 154
250 3300009094 Ga0111539_10009505 Ga0111539_100095057 154
251 3300013102 Ga0157371_10245887 Ga0157371_102458871 154
252 3300020080 Ga0206350_10788394 Ga0206350_107883941 154
253 3300025292 Ga0209676_1006542 Ga0209676_10065426 154
254 3300025292 Ga0209676_1007041 Ga0209676_10070412 154
255 3300025294 Ga0209025_1014805 Ga0209025_10148053 154
256 3300025294 Ga0209025_1091709 Ga0209025_10917091 154
257 3300027907 Ga0207428_10013924 Ga0207428_100139245 154
258 3300049532 Ga0501316_014816 Ga0501316_014816_11_475 154
259 3300050511 nmdc:mga08y16_92262_c1 nmdc:mga08y16_92262_c1_114_587 154
260 3300002987 JGI25159J45721_1037342 JGI25159J45721_10373421 155
261 3300003187 JGI25151J46595_10000011 JGI25151J46595_10000011189 155
262 3300003187 JGI25151J46595_10002559 JGI25151J46595_100025592 155
263 3300003187 JGI25151J46595_10010666 JGI25151J46595_100106663 155
264 3300003187 JGI25151J46595_10010737 JGI25151J46595_100107374 155
265 3300003187 JGI25151J46595_10016063 JGI25151J46595_100160631 155
266 3300003187 JGI25151J46595_10065714 JGI25151J46595_100657143 155
267 3300003187 JGI25151J46595_10066317 JGI25151J46595_100663172 155
268 3300003187 JGI25151J46595_10104044 JGI25151J46595_101040441 155
269 3300003316 rootH1_10013690 rootH1_1001369033 155
270 3300003320 rootH2_10009450 rootH2_100094502 155
271 3300003322 rootL2_10016501 rootL2_100165019 155
272 3300003323 rootH1_10085546 rootH1_100855461 155
273 3300003574 Ga0007410J51695_1112272 Ga0007410J51695_11122721 155
274 3300003578 Ga0006562J51391_1000005 Ga0006562J51391_10000058 155
275 3300003578 Ga0006562J51391_1000006 Ga0006562J51391_100000614 155
276 3300003751 Ga0055538_1001723 Ga0055538_10017231 155
277 3300003758 Ga0055532_1000052 Ga0055532_100005247 155
278 3300003761 Ga0055535_1012078 Ga0055535_10120782 155
279 3300003781 Ga0055536_1031799 Ga0055536_10317992 155
280 3300003790 Ga0055528_1001485 Ga0055528_10014854 155
281 3300003841 Ga0055541_1002282 Ga0055541_10022823 155
282 3300003841 Ga0055541_1010123 Ga0055541_10101232 155
283 3300003856 Ga0058692_1030527 Ga0058692_10305271 155
284 3300005289 Ga0065704_10309180 Ga0065704_103091802 155
285 3300005331 Ga0070670_100027574 Ga0070670_1000275744 155
286 3300005354 Ga0070675_100067208 Ga0070675_1000672081 155
287 3300005355 Ga0070671_100038131 Ga0070671_1000381315 155
288 3300005356 Ga0070674_100394293 Ga0070674_1003942932 155
289 3300005617 Ga0068859_101400159 Ga0068859_1014001592 155
290 3300005841 Ga0068863_101073078 Ga0068863_1010730781 155
291 3300006163 Ga0070715_10465889 Ga0070715_104658891 155
292 3300006173 Ga0070716_100430302 Ga0070716_1004303021 155
293 3300006846 Ga0075430_101495480 Ga0075430_1014954801 155
294 3300006914 Ga0075436_100322745 Ga0075436_1003227452 155
295 3300006931 Ga0097620_101400617 Ga0097620_1014006172 155
296 3300009036 Ga0105244_10013670 Ga0105244_100136701 155
297 3300009092 Ga0105250_10170154 Ga0105250_101701542 155
298 3300009092 Ga0105250_10225455 Ga0105250_102254551 155
299 3300009098 Ga0105245_10002785 Ga0105245_100027853 155
300 3300009101 Ga0105247_10003177 Ga0105247_100031779 155
301 3300009147 Ga0114129_10501427 Ga0114129_105014271 155
302 3300009148 Ga0105243_10002111 Ga0105243_1000211112 155
303 3300009176 Ga0105242_10002349 Ga0105242_100023493 155
304 3300009553 Ga0105249_10047383 Ga0105249_100473832 155
305 3300010375 Ga0105239_10481393 Ga0105239_104813932 155
306 3300011119 Ga0105246_10000609 Ga0105246_1000060912 155
307 3300013105 Ga0157369_11132575 Ga0157369_111325752 155
308 3300013296 Ga0157374_10292440 Ga0157374_102924401 155
309 3300013297 Ga0157378_10002671 Ga0157378_100026713 155
310 3300013307 Ga0157372_10036485 Ga0157372_100364855 155
311 3300014969 Ga0157376_10251332 Ga0157376_102513321 155
312 3300025224 Ga0209784_100179 Ga0209784_10017912 155
313 3300025224 Ga0209784_105938 Ga0209784_1059381 155
314 3300025225 Ga0209566_100086 Ga0209566_10008662 155
315 3300025225 Ga0209566_100249 Ga0209566_10024973 155
316 3300025225 Ga0209566_103107 Ga0209566_1031071 155
317 3300025229 Ga0209147_100028 Ga0209147_100028216 155
318 3300025229 Ga0209147_101060 Ga0209147_1010605 155
319 3300025242 Ga0209258_101578 Ga0209258_1015783 155
320 3300025273 Ga0209673_1001521 Ga0209673_100152121 155
321 3300025291 Ga0209675_1027424 Ga0209675_10274241 155
322 3300025291 Ga0209675_1028328 Ga0209675_10283281 155
323 3300025292 Ga0209676_1000768 Ga0209676_10007687 155
324 3300025294 Ga0209025_1000011 Ga0209025_1000011711 155
325 3300025294 Ga0209025_1000095 Ga0209025_100009592 155
326 3300025294 Ga0209025_1000642 Ga0209025_100064256 155
327 3300025294 Ga0209025_1002919 Ga0209025_100291916 155
328 3300025294 Ga0209025_1008543 Ga0209025_10085432 155
329 3300025294 Ga0209025_1012144 Ga0209025_10121441 155
330 3300025294 Ga0209025_1012205 Ga0209025_10122051 155
331 3300025294 Ga0209025_1013040 Ga0209025_10130401 155
332 3300025294 Ga0209025_1015573 Ga0209025_10155733 155
333 3300025294 Ga0209025_1018339 Ga0209025_10183393 155
334 3300025294 Ga0209025_1022178 Ga0209025_10221782 155
335 3300025294 Ga0209025_1022334 Ga0209025_10223344 155
336 3300025294 Ga0209025_1022552 Ga0209025_10225522 155
337 3300025294 Ga0209025_1057428 Ga0209025_10574282 155
338 3300025294 Ga0209025_1096045 Ga0209025_10960452 155
339 3300025294 Ga0209025_1142185 Ga0209025_11421851 155
340 3300025302 Ga0207426_1005950 Ga0207426_10059503 155
341 3300025711 Ga0207696_1001111 Ga0207696_100111112 155
342 3300025711 Ga0207696_1001753 Ga0207696_100175312 155
343 3300025711 Ga0207696_1025616 Ga0207696_10256161 155
344 3300025728 Ga0207655_1001115 Ga0207655_10011157 155
345 3300025728 Ga0207655_1011871 Ga0207655_10118714 155
346 3300025735 Ga0207713_1001493 Ga0207713_100149313 155
347 3300025735 Ga0207713_1003276 Ga0207713_100327611 155
348 3300025900 Ga0207710_10212596 Ga0207710_102125961 155
349 3300025923 Ga0207681_10328913 Ga0207681_103289131 155
350 3300025926 Ga0207659_10238306 Ga0207659_102383062 155
351 3300025927 Ga0207687_10049025 Ga0207687_100490253 155
352 3300025931 Ga0207644_10116266 Ga0207644_101162662 155
353 3300025934 Ga0207686_10007902 Ga0207686_100079025 155
354 3300025935 Ga0207709_10011471 Ga0207709_100114715 155
355 3300027252 Ga0209973_1001839 Ga0209973_10018392 155
356 3300027312 Ga0209371_1010609 Ga0209371_10106092 155
357 3300027360 Ga0209969_1014719 Ga0209969_10147191 155
358 3300027552 Ga0209982_1080614 Ga0209982_10806141 155
359 3300027876 Ga0209974_10012955 Ga0209974_100129552 155
360 3300030500 Ga0268256_1002179 Ga0268256_10021799 155
361 3300031344 Ga0265316_10239406 Ga0265316_102394062 155
362 3300031548 Ga0307408_100011432 Ga0307408_1000114322 155
363 3300031548 Ga0307408_100100533 Ga0307408_1001005331 155
364 3300031548 Ga0307408_100658434 Ga0307408_1006584341 155
365 3300031731 Ga0307405_10495702 Ga0307405_104957021 155
366 3300032002 Ga0307416_100007832 Ga0307416_1000078322 155
367 3300032002 Ga0307416_100103246 Ga0307416_1001032462 155
368 3300037312 Ga0395899_0178628 Ga0395899_0178628_112_591 155
369 3300037312 Ga0395899_0299970 Ga0395899_0299970_182_661 155
370 3300037312 Ga0395899_0308720 Ga0395899_0308720_516_995 155
371 3300037466 Ga0395898_0510049 Ga0395898_0510049_251_718 155
372 3300038705 Ga0237819_01516 Ga0237819_01516_3898_4365 155
373 3300038705 Ga0237819_01695 Ga0237819_01695_1211_1678 155
374 3300044656 Ga0466969_0013723 Ga0466969_0013723_817_1296 155
375 3300044693 Ga0466961_0093798 Ga0466961_0093798_611_1159 155
376 3300044694 Ga0466963_0568554 Ga0466963_0568554_34_513 155
377 3300044735 Ga0466968_0039307 Ga0466968_0039307_1203_1751 155
378 3300044765 Ga0466970_0442836 Ga0466970_0442836_50_598 155
379 3300045976 Ga0466967_0005089 Ga0466967_0005089_4770_5237 155
380 3300046453 Ga0495627_068875 Ga0495627_068875_394_873 155
381 3300046455 Ga0495603_0062485 Ga0495603_0062485_962_1429 155
382 3300046457 Ga0495590_0005864 Ga0495590_0005864_627_1106 155
383 3300046457 Ga0495590_0116049 Ga0495590_0116049_350_817 155
384 3300046474 Ga0495605_0192797 Ga0495605_0192797_20_514 155
385 3300046491 Ga0495584_0020626 Ga0495584_0020626_1180_1647 155
386 3300046492 Ga0495585_0020071 Ga0495585_0020071_3074_3541 155
387 3300046501 Ga0495607_0104543 Ga0495607_0104543_865_1332 155
388 3300046518 Ga0495631_0170661 Ga0495631_0170661_23_490 155
389 3300046520 Ga0495637_0093704 Ga0495637_0093704_629_1108 155
390 3300046557 Ga0495622_0012122 Ga0495622_0012122_1915_2382 155
391 3300046558 Ga0495633_0040592 Ga0495633_0040592_952_1419 155
392 3300046648 Ga0495611_0071339 Ga0495611_0071339_554_1021 155
393 3300046665 Ga0495661_0035158 Ga0495661_0035158_674_1141 155
394 3300046794 Ga0495589_0045580 Ga0495589_0045580_1035_1502 155
395 3300046794 Ga0495589_0177228 Ga0495589_0177228_363_830 155
396 3300046810 Ga0495660_0008527 Ga0495660_0008527_587_1066 155
397 3300047321 Ga0495676_0133201 Ga0495676_0133201_267_734 155
398 3300047323 Ga0495683_0040638 Ga0495683_0040638_724_1191 155
399 3300048903 Ga0496100_0004530 Ga0496100_0004530_4469_4936 155
400 3300048903 Ga0496100_0162709 Ga0496100_0162709_111_578 155
401 3300048904 Ga0496101_0059679 Ga0496101_0059679_688_1155 155
402 3300048905 Ga0496102_0097660 Ga0496102_0097660_1449_1916 155
403 3300048905 Ga0496102_0144149 Ga0496102_0144149_870_1391 155
404 3300048905 Ga0496102_0463293 Ga0496102_0463293_177_698 155
405 3300048907 Ga0496104_0000453 Ga0496104_0000453_5884_6351 155
406 3300048907 Ga0496104_1204757 Ga0496104_1204757_73_594 155
407 3300048908 Ga0496105_0033025 Ga0496105_0033025_819_1286 155
408 3300048909 Ga0496106_0000643 Ga0496106_0000643_18815_19282 155
409 3300048910 Ga0496107_0000172 Ga0496107_0000172_19341_19808 155
410 3300048911 Ga0496108_0000949 Ga0496108_0000949_1089_1556 155
411 3300048912 Ga0496109_0009261 Ga0496109_0009261_688_1155 155
412 3300048913 Ga0496110_0305289 Ga0496110_0305289_207_674 155
413 3300048913 Ga0496110_1008506 Ga0496110_1008506_196_663 155
414 3300048914 Ga0496111_0003249 Ga0496111_0003249_809_1276 155
415 3300048915 Ga0496112_0138931 Ga0496112_0138931_596_1117 155
416 3300048916 Ga0496113_0059779 Ga0496113_0059779_956_1423 155
417 3300048916 Ga0496113_0172672 Ga0496113_0172672_1079_1600 155
418 3300048918 Ga0496115_0849161 Ga0496115_0849161_132_638 155
419 3300048919 Ga0496116_0006796 Ga0496116_0006796_8578_9045 155
420 3300048919 Ga0496116_0034657 Ga0496116_0034657_725_1207 155
421 3300048919 Ga0496116_0053524 Ga0496116_0053524_1229_1699 155
422 3300048920 Ga0496117_0090970 Ga0496117_0090970_645_1112 155
423 3300048921 Ga0496118_0087941 Ga0496118_0087941_942_1409 155
424 3300048922 Ga0496119_0006268 Ga0496119_0006268_10021_10488 155
425 3300048922 Ga0496119_0087493 Ga0496119_0087493_1203_1682 155
426 3300048922 Ga0496119_0262934 Ga0496119_0262934_53_550 155
427 3300048924 Ga0496121_0219976 Ga0496121_0219976_508_975 155
428 3300048924 Ga0496121_0366353 Ga0496121_0366353_314_793 155
429 3300048925 Ga0496122_0007888 Ga0496122_0007888_6015_6494 155
430 3300048925 Ga0496122_0053629 Ga0496122_0053629_2365_2832 155
431 3300048925 Ga0496122_0205802 Ga0496122_0205802_199_678 155
432 3300048926 Ga0496123_0136162 Ga0496123_0136162_412_879 155
433 3300048926 Ga0496123_0284620 Ga0496123_0284620_260_736 155
434 3300048927 Ga0496124_0175303 Ga0496124_0175303_249_716 155
435 3300048928 Ga0496125_0004095 Ga0496125_0004095_12042_12509 155
436 3300048929 Ga0496126_0010713 Ga0496126_0010713_5675_6142 155
437 3300048929 Ga0496126_0521521 Ga0496126_0521521_100_567 155
438 3300049127 Ga0501306_012892 Ga0501306_012892_465_935 155
439 3300049132 Ga0501343_000351 Ga0501343_000351_2025_2495 155
440 3300049132 Ga0501343_001506 Ga0501343_001506_44_511 155
441 3300049132 Ga0501343_008513 Ga0501343_008513_285_752 155
442 3300049132 Ga0501343_010397 Ga0501343_010397_281_748 155
443 3300049161 Ga0501305_002177 Ga0501305_002177_922_1392 155
444 3300049161 Ga0501305_003222 Ga0501305_003222_348_815 155
445 3300049528 Ga0501312_011300 Ga0501312_011300_614_1081 155
446 3300049528 Ga0501312_021245 Ga0501312_021245_231_701 155
447 3300049528 Ga0501312_046210 Ga0501312_046210_193_660 155
448 3300049531 Ga0501315_002419 Ga0501315_002419_166_705 155
449 3300049531 Ga0501315_038750 Ga0501315_038750_217_684 155
450 3300049532 Ga0501316_016865 Ga0501316_016865_268_735 155
451 3300049532 Ga0501316_017890 Ga0501316_017890_149_619 155
452 3300049533 Ga0501317_011291 Ga0501317_011291_77_544 155
453 3300049533 Ga0501317_036222 Ga0501317_036222_67_534 155
454 3300049534 Ga0501318_008322 Ga0501318_008322_613_1080 155
455 3300049534 Ga0501318_018104 Ga0501318_018104_254_796 155
456 3300049537 Ga0501321_004607 Ga0501321_004607_36_503 155
457 3300049537 Ga0501321_017394 Ga0501321_017394_20_487 155
458 3300049537 Ga0501321_023798 Ga0501321_023798_273_740 155
459 3300049551 Ga0501335_004269 Ga0501335_004269_60_527 155
460 3300049551 Ga0501335_011044 Ga0501335_011044_146_613 155
461 3300049556 Ga0501340_000836 Ga0501340_000836_133_600 155
462 3300049661 Ga0501217_009953 Ga0501217_009953_645_1112 155
463 iso_pu_bacteria 2548877040 2550899733 155
464 iso_pu_bacteria 2728368933 2728531992 155
465 iso_pu_bacteria 2818991441 2819571501 155
466 iso_pu_bacteria 3006969106 3006971500 155
467 iso_pu_bacteria 8054465665 8054472041 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

33

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.965 6 127
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9427 5 129
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9336 5 123
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9332 5 129
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.9205 11 127
ID Description Score Start End Superfamily
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9457 11 127 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9349 3 129 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9139 3 129 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9074 11 127 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7278 8 127 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A3C2AI62-F1-model_v4 SsrA-binding protein 0.985 7 129 GO:0003723
GO:0005829
AF-A0A2E0C8T3-F1-model_v4 deleted 0.9846 8 123
AF-A0A6G1V3L8-F1-model_v4 deleted 0.9836 11 129
AF-A0A661BPA3-F1-model_v4 SsrA-binding protein 0.9808 7 129 GO:0003723
GO:0005829
AF-B6V881-F1-model_v4 SmpB 0.9801 17 119 GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
87.82 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map