F449889

General Info

Members Datasets Scaffolds Average Seq Length
467 201 934 326

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0688147|Ga0453684_0688147_29_1054
Length 341
Sequence MNTQMQMPERVQIEETADESHGRFILQPLEQGYGVTIGNSFRRVLLSSIPGAAIIGLKVSDVLHEFQTIPGVIEDVSEIILNLKEVRMKVLDKKQQRIVFHLKGPHTWTAKDLQDASPQVEVLDPDHFIATLADDAEFDVELRIGRGKGYVPAEEQPIVDYPIGMLPLDAIYTPIKNVVYYIEPYRVGQKTDYEKLILDVRTDGTITAQESVHYAAKILSDHVKFFVNFEEQEEDHPQPDLVEEEVKEAERNRLRKILLTPVDELELSVRAHNCLKAANIKSLSELVQLQESELLKFRNFGRKSLAELGEVVHQYGLEFGMSVEKYLKPDPPKASELLDSF

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
99 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
100 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
101 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
162 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
163 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
192 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
193 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
194 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
195 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
196 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
197 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
198 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
199 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
200 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
201 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.95
Metatranscriptomes 25.7
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0
Rhizoplane 0.86
Rhizosphere 88.65
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0688147 3300044712 Unclassified 1112
2 MBSR1b_contig_2043368 2162886012 Bacteria 2296
3 JGI24741J21665_1003251 3300001915 Bacteria 3929
4 Ga0006759J45824_1057866 3300003163 Bacteria 1444
5 Ga0006758J48902_1022741 3300003300 Bacteria 1596
6 rootH1_10004424 3300003316 Bacteria 24003
7 rootH2_10080702 3300003320 Bacteria 2852
8 rootH2_10128829 3300003320 Bacteria 4184
9 rootL2_10010167 3300003322 Bacteria 22542
10 rootL2_10023239 3300003322 Bacteria 4007
11 rootL2_10328105 3300003322 Bacteria 3344
12 rootH1_10006036 3300003323 Bacteria 32132
13 rootH1_10006988 3300003323 Bacteria 47616
14 rootH1_10021543 3300003323 Bacteria 2993
15 Ga0007410J51695_1088580 3300003574 Bacteria 2388
16 Ga0007409J51694_1063312 3300003575 Bacteria 2513
17 Ga0055536_1001261 3300003781 Bacteria 15585
18 Ga0055531_10000409 3300003794 Bacteria 41322
19 Ga0058859_11687935 3300004798 Bacteria 1934
20 Ga0058862_12107835 3300004803 Bacteria 1685
21 Ga0065165_1000131 3300005262 Bacteria 128880
22 Ga0065165_1000831 3300005262 Bacteria 40595
23 Ga0065704_10082979 3300005289 Bacteria 3525
24 Ga0065704_10121135 3300005289 Bacteria 1764
25 Ga0065715_10088958 3300005293 Bacteria 20336
26 Ga0070689_100262635 3300005340 Bacteria 1427
27 Ga0068856_100021492 3300005614 Bacteria 6272
28 Ga0068859_100474726 3300005617 Bacteria 1346
29 Ga0068860_100263863 3300005843 Bacteria 1679
30 Ga0068860_100433847 3300005843 Bacteria 1304
31 Ga0075428_100022554 3300006844 Bacteria 6969
32 Ga0097620_100474691 3300006931 Bacteria 1346
33 Ga0111539_10001098 3300009094 Bacteria 35755
34 Ga0105245_10141516 3300009098 Bacteria 2266
35 Ga0105249_10092720 3300009553 Bacteria 2828
36 Ga0157371_10213584 3300013102 Bacteria 1385
37 Ga0157370_10133990 3300013104 Bacteria 2310
38 Ga0157378_10357268 3300013297 Bacteria 1429
39 Ga0163162_10163197 3300013306 Bacteria 2351
40 Ga0157372_10411270 3300013307 Bacteria 1576
41 Ga0157380_10000051 3300014326 Bacteria 68466
42 Ga0163161_10009312 3300017792 Bacteria 6794
43 Ga0206356_11345452 3300020070 Bacteria 2362
44 Ga0224712_10000155 3300022467 Bacteria 11497
45 Ga0209455_1006502 3300025272 Bacteria 3439
46 Ga0209676_1000332 3300025292 Bacteria 90798
47 Ga0209050_1002964 3300025298 Bacteria 13262
48 Ga0209050_1018624 3300025298 Bacteria 2685
49 Ga0209257_1000007 3300025304 Bacteria 1564415
50 Ga0209257_1027714 3300025304 Bacteria 1880
51 Ga0209968_1001995 3300027526 Bacteria 3102
52 Ga0209968_1008919 3300027526 Bacteria 1532
53 Ga0207428_10019856 3300027907 Bacteria 5724
54 Ga0207428_10027425 3300027907 Bacteria 4740
55 Ga0268266_10228309 3300028379 Bacteria 1714
56 Ga0265337_1000075 3300028556 Bacteria 46795
57 Ga0265337_1028473 3300028556 Bacteria 1677
58 Ga0265326_10000273 3300028558 Bacteria 23789
59 Ga0265326_10002298 3300028558 Bacteria 6458
60 Ga0265319_1000077 3300028563 Bacteria 75962
61 Ga0265319_1000371 3300028563 Bacteria 32428
62 Ga0265334_10002366 3300028573 Bacteria 8880
63 Ga0265334_10021468 3300028573 Bacteria 2636
64 Ga0265334_10028741 3300028573 Bacteria 2231
65 Ga0265318_10000750 3300028577 Bacteria 21621
66 Ga0265318_10004338 3300028577 Bacteria 6890
67 Ga0265318_10010226 3300028577 Bacteria 4098
68 Ga0265323_10000040 3300028653 Bacteria 70373
69 Ga0265323_10000600 3300028653 Bacteria 19805
70 Ga0265323_10004199 3300028653 Bacteria 6233
71 Ga0265323_10063093 3300028653 Bacteria 1283
72 Ga0265322_10000054 3300028654 Bacteria 58196
73 Ga0265322_10000133 3300028654 Bacteria 34563
74 Ga0265322_10014430 3300028654 Unclassified 2282
75 Ga0265322_10027781 3300028654 Unclassified 1617
76 Ga0265336_10000066 3300028666 Bacteria 95677
77 Ga0307515_10000009 3300028794 Bacteria 653206
78 Ga0307515_10112100 3300028794 Bacteria 3175
79 Ga0265338_10000388 3300028800 Bacteria 78700
80 Ga0265338_10000637 3300028800 Bacteria 60746
81 Ga0265338_10001162 3300028800 Bacteria 43495
82 Ga0265338_10001855 3300028800 Bacteria 33207
83 Ga0265338_10001977 3300028800 Bacteria 31927
84 Ga0265338_10009697 3300028800 Bacteria 11419
85 Ga0265324_10000662 3300029957 Bacteria 23249
86 Ga0265324_10001155 3300029957 Bacteria 15753
87 Ga0265324_10009310 3300029957 Unclassified 3842
88 Ga0265324_10014323 3300029957 Bacteria 2937
89 Ga0265330_10000067 3300031235 Bacteria 91033
90 Ga0265332_10004142 3300031238 Bacteria 6868
91 Ga0265332_10008374 3300031238 Bacteria 4648
92 Ga0265328_10001017 3300031239 Bacteria 12897
93 Ga0265320_10000783 3300031240 Bacteria 24291
94 Ga0265320_10016903 3300031240 Bacteria 4069
95 Ga0265325_10010282 3300031241 Bacteria 5427
96 Ga0265329_10004263 3300031242 Bacteria 6003
97 Ga0265329_10005896 3300031242 Bacteria 4912
98 Ga0265340_10005977 3300031247 Bacteria 6724
99 Ga0265340_10006941 3300031247 Bacteria 6182
100 Ga0265339_10008063 3300031249 Bacteria 6732
101 Ga0265339_10012208 3300031249 Bacteria 5253
102 Ga0265339_10027023 3300031249 Bacteria 3282
103 Ga0265339_10113789 3300031249 Bacteria 1397
104 Ga0265331_10000271 3300031250 Bacteria 57462
105 Ga0265327_10000370 3300031251 Bacteria 84921
106 Ga0265327_10004316 3300031251 Bacteria 12681
107 Ga0265327_10068253 3300031251 Bacteria 1789
108 Ga0265316_10000486 3300031344 Bacteria 45040
109 Ga0265316_10000631 3300031344 Bacteria 39272
110 Ga0265316_10004409 3300031344 Bacteria 14019
111 Ga0265316_10004585 3300031344 Bacteria 13715
112 Ga0265316_10005804 3300031344 Bacteria 11909
113 Ga0265316_10005991 3300031344 Bacteria 11698
114 Ga0265316_10007082 3300031344 Bacteria 10613
115 Ga0265316_10065971 3300031344 Bacteria 2802
116 Ga0265316_10104119 3300031344 Bacteria 2154
117 Ga0265316_10219150 3300031344 Bacteria 1405
118 Ga0265316_10297875 3300031344 Bacteria 1175
119 Ga0307513_10045434 3300031456 Bacteria 4801
120 Ga0307513_10045488 3300031456 Bacteria 4797
121 Ga0307513_10059713 3300031456 Bacteria 4047
122 Ga0307509_10150687 3300031507 Bacteria 2242
123 Ga0307408_100003845 3300031548 Bacteria 10216
124 Ga0307408_100197442 3300031548 Bacteria 1626
125 Ga0265313_10000713 3300031595 Bacteria 34315
126 Ga0265313_10009067 3300031595 Bacteria 6512
127 Ga0307514_10019601 3300031649 Bacteria 5534
128 Ga0265314_10002064 3300031711 Bacteria 21207
129 Ga0265314_10040807 3300031711 Bacteria 3327
130 Ga0265314_10064309 3300031711 Unclassified 2485
131 Ga0265342_10001480 3300031712 Bacteria 21791
132 Ga0265342_10002732 3300031712 Bacteria 15011
133 Ga0265342_10003312 3300031712 Bacteria 13303
134 Ga0265342_10185397 3300031712 Bacteria 1138
135 Ga0316576_10017698 3300031727 Bacteria 4849
136 Ga0316576_10039513 3300031727 Bacteria 3387
137 Ga0316576_10056989 3300031727 Bacteria 2855
138 Ga0316576_10060515 3300031727 Bacteria 2774
139 Ga0316576_10085558 3300031727 Bacteria 2344
140 Ga0316576_10153290 3300031727 Bacteria 1737
141 Ga0316578_10004394 3300031728 Bacteria 6652
142 Ga0316578_10027877 3300031728 Bacteria 3195
143 Ga0316578_10040793 3300031728 Bacteria 2686
144 Ga0316578_10087593 3300031728 Unclassified 1857
145 Ga0316578_10095071 3300031728 Bacteria 1783
146 Ga0307405_10015203 3300031731 Bacteria 4161
147 Ga0307405_10066822 3300031731 Bacteria 2294
148 Ga0316577_10018495 3300031733 Bacteria 3855
149 Ga0316577_10090884 3300031733 Bacteria 1709
150 Ga0307413_10170538 3300031824 Bacteria 1540
151 Ga0307413_10299403 3300031824 Bacteria 1219
152 Ga0307410_10125542 3300031852 Bacteria 1878
153 Ga0307412_10249197 3300031911 Bacteria 1378
154 Ga0307409_100145713 3300031995 Bacteria 2048
155 Ga0307409_100184640 3300031995 Bacteria 1850
156 Ga0307416_100000249 3300032002 Bacteria 28628
157 Ga0307416_100533293 3300032002 Bacteria 1244
158 Ga0307414_10000927 3300032004 Bacteria 15015
159 Ga0307414_10081437 3300032004 Bacteria 2370
160 Ga0307414_10155393 3300032004 Bacteria 1810
161 Ga0307411_10065726 3300032005 Bacteria 2434
162 Ga0307415_100002166 3300032126 Bacteria 9736
163 Ga0316583_10039922 3300032133 Bacteria 1662
164 Ga0316585_10003939 3300032137 Bacteria 4109
165 Ga0316593_10003117 3300032168 Bacteria 4063
166 Ga0316593_10003954 3300032168 Bacteria 3746
167 Ga0316593_10007819 3300032168 Bacteria 2952
168 Ga0316593_10013476 3300032168 Bacteria 2421
169 Ga0316593_10014872 3300032168 Bacteria 2331
170 Ga0316593_10052184 3300032168 Bacteria 1384
171 Ga0316593_10073996 3300032168 Bacteria 1181
172 Ga0316592_1000331 3300033524 Bacteria 6138
173 Ga0316592_1000945 3300033524 Bacteria 4451
174 Ga0316592_1001036 3300033524 Bacteria 4325
175 Ga0316592_1012760 3300033524 Bacteria 1726
176 Ga0316592_1013074 3300033524 Bacteria 1708
177 Ga0316592_1024971 3300033524 Bacteria 1287
178 Ga0316592_1027573 3300033524 Bacteria 1228
179 Ga0316588_1001461 3300033528 Bacteria 3879
180 Ga0316588_1001571 3300033528 Bacteria 3795
181 Ga0316588_1014412 3300033528 Bacteria 1730
182 Ga0316588_1018500 3300033528 Bacteria 1561
183 Ga0316596_1000348 3300033541 Bacteria 7561
184 Ga0316596_1000575 3300033541 Bacteria 6430
185 Ga0316596_1002512 3300033541 Bacteria 3927
186 Ga0316596_1003747 3300033541 Bacteria 3360
187 Ga0316596_1003898 3300033541 Bacteria 3305
188 Ga0316596_1006680 3300033541 Bacteria 2693
189 Ga0316596_1007610 3300033541 Bacteria 2565
190 Ga0316596_1009403 3300033541 Bacteria 2345
191 Ga0316596_1015598 3300033541 Bacteria 1896
192 Ga0316574_0129381 3300035398 Bacteria 1624
193 Ga0316582_0036309 3300036647 Bacteria 3049
194 Ga0316582_0048716 3300036647 Bacteria 2679
195 Ga0316582_0093165 3300036647 Bacteria 1986
196 Ga0316582_0101451 3300036647 Bacteria 1906
197 Ga0316584_0007005 3300036712 Bacteria 7674
198 Ga0316584_0011287 3300036712 Bacteria 6271
199 Ga0316584_0021141 3300036712 Bacteria 4725
200 Ga0316584_0048368 3300036712 Bacteria 3177
201 Ga0316584_0140595 3300036712 Bacteria 1801
202 Ga0316584_0205482 3300036712 Bacteria 1452
203 Ga0395899_0000673 3300037312 Bacteria 34566
204 Ga0395905_0000376 3300037471 Bacteria 63695
205 Ga0395901_0003122 3300038443 Bacteria 16635
206 Ga0395901_0010513 3300038443 Bacteria 9373
207 Ga0400483_035362 3300039062 Bacteria 41412
208 Ga0400483_136248 3300039062 Bacteria 1774
209 Ga0400489_00932 3300039093 Bacteria 9350
210 Ga0451794_35967 3300041446 Bacteria 1131
211 Ga0451795_0101213 3300041456 Bacteria 3091
212 Ga0451805_059623 3300041461 Bacteria 1455
213 Ga0451807_1046355 3300041486 Bacteria 2311
214 Ga0451852_13332 3300041508 Bacteria 9060
215 Ga0451855_0808132 3300041511 Bacteria 1108
216 Ga0451855_0833356 3300041511 Bacteria 4755
217 Ga0439445_0003220 3300042004 Bacteria 3659
218 Ga0439457_055609 3300042014 Bacteria 892
219 Ga0451577_0000092 3300042876 Bacteria 198898
220 Ga0451577_0000255 3300042876 Bacteria 105353
221 Ga0451577_0000404 3300042876 Bacteria 78335
222 Ga0451577_0000433 3300042876 Bacteria 74789
223 Ga0451577_0000461 3300042876 Bacteria 70795
224 Ga0451577_0000690 3300042876 Bacteria 52905
225 Ga0451577_0005144 3300042876 Bacteria 13458
226 Ga0451577_0009644 3300042876 Bacteria 9267
227 Ga0451577_0013367 3300042876 Bacteria 7685
228 Ga0451577_0022022 3300042876 Bacteria 5823
229 Ga0451577_0023389 3300042876 Bacteria 5637
230 Ga0451577_0024955 3300042876 Bacteria 5429
231 Ga0451577_0025303 3300042876 Bacteria 5388
232 Ga0451577_0028546 3300042876 Bacteria 5045
233 Ga0451577_0039585 3300042876 Bacteria 4236
234 Ga0451577_0047949 3300042876 Bacteria 3818
235 Ga0451577_0066417 3300042876 Bacteria 3217
236 Ga0451577_0124481 3300042876 Bacteria 2310
237 Ga0451577_0192372 3300042876 Bacteria 1840
238 Ga0451577_0349475 3300042876 Bacteria 1341
239 Ga0451577_0351159 3300042876 Bacteria 1338
240 Ga0451577_0400622 3300042876 Bacteria 1245
241 Ga0466972_0061578 3300044658 Bacteria 1799
242 Ga0453683_0000055 3300044673 Bacteria 192588
243 Ga0453683_0000066 3300044673 Bacteria 164788
244 Ga0453683_0000522 3300044673 Bacteria 43145
245 Ga0453683_0003372 3300044673 Bacteria 11797
246 Ga0453683_0005928 3300044673 Bacteria 8435
247 Ga0453683_0006727 3300044673 Bacteria 7859
248 Ga0453683_0015630 3300044673 Bacteria 4912
249 Ga0453683_0054898 3300044673 Bacteria 2493
250 Ga0453683_0057968 3300044673 Bacteria 2423
251 Ga0453683_0109358 3300044673 Bacteria 1738
252 Ga0453683_0124990 3300044673 Bacteria 1619
253 Ga0453683_0243979 3300044673 Unclassified 1144
254 Ga0453683_0291249 3300044673 Bacteria 1043
255 Ga0453684_0000024 3300044712 Bacteria 819351
256 Ga0453684_0000334 3300044712 Bacteria 196444
257 Ga0453684_0000413 3300044712 Bacteria 174924
258 Ga0453684_0000440 3300044712 Bacteria 169397
259 Ga0453684_0000506 3300044712 Bacteria 152143
260 Ga0453684_0001121 3300044712 Bacteria 83919
261 Ga0453684_0001193 3300044712 Bacteria 80343
262 Ga0453684_0001382 3300044712 Bacteria 70292
263 Ga0453684_0001549 3300044712 Bacteria 64220
264 Ga0453684_0002895 3300044712 Bacteria 40244
265 Ga0453684_0004169 3300044712 Bacteria 31186
266 Ga0453684_0004492 3300044712 Bacteria 29332
267 Ga0453684_0005656 3300044712 Bacteria 24561
268 Ga0453684_0008189 3300044712 Bacteria 18851
269 Ga0453684_0012002 3300044712 Bacteria 14406
270 Ga0453684_0012437 3300044712 Bacteria 14033
271 Ga0453684_0012544 3300044712 Bacteria 13952
272 Ga0453684_0012598 3300044712 Bacteria 13911
273 Ga0453684_0015794 3300044712 Bacteria 11879
274 Ga0453684_0016252 3300044712 Bacteria 11656
275 Ga0453684_0024288 3300044712 Bacteria 8867
276 Ga0453684_0028318 3300044712 Bacteria 7999
277 Ga0453684_0035092 3300044712 Bacteria 6941
278 Ga0453684_0042224 3300044712 Bacteria 6151
279 Ga0453684_0049674 3300044712 Bacteria 5527
280 Ga0453684_0064505 3300044712 Bacteria 4678
281 Ga0453684_0076172 3300044712 Bacteria 4212
282 Ga0453684_0099672 3300044712 Bacteria 3558
283 Ga0453684_0104626 3300044712 Bacteria 3455
284 Ga0453684_0106316 3300044712 Bacteria 3420
285 Ga0453684_0113057 3300044712 Bacteria 3294
286 Ga0453684_0130685 3300044712 Bacteria 3013
287 Ga0453684_0141195 3300044712 Bacteria 2876
288 Ga0453684_0143337 3300044712 Bacteria 2849
289 Ga0453684_0165681 3300044712 Bacteria 2609
290 Ga0453684_0171057 3300044712 Bacteria 2560
291 Ga0453684_0182883 3300044712 Bacteria 2459
292 Ga0453684_0208192 3300044712 Bacteria 2275
293 Ga0453684_0229936 3300044712 Bacteria 2141
294 Ga0453684_0241341 3300044712 Bacteria 2080
295 Ga0453684_0242286 3300044712 Bacteria 2075
296 Ga0453684_0257001 3300044712 Bacteria 2003
297 Ga0453684_0290982 3300044712 Viruses 1860
298 Ga0453684_0337044 3300044712 Bacteria 1704
299 Ga0453684_0370850 3300044712 Bacteria 1609
300 Ga0453684_0394459 3300044712 Bacteria 1551
301 Ga0453684_0394665 3300044712 Bacteria 1551
302 Ga0453684_0394816 3300044712 Bacteria 1550
303 Ga0453684_0774694 3300044712 Bacteria 1037
304 Ga0453684_0827650 3300044712 Bacteria 996
305 Ga0466970_0066929 3300044765 Bacteria 1928
306 Ga0466960_0285149 3300044901 Bacteria 926
307 Ga0451576_0000113 3300045051 Bacteria 208644
308 Ga0451576_0000204 3300045051 Bacteria 149459
309 Ga0451576_0000689 3300045051 Bacteria 68784
310 Ga0451576_0000783 3300045051 Bacteria 62485
311 Ga0451576_0003461 3300045051 Bacteria 21644
312 Ga0451576_0003652 3300045051 Bacteria 20883
313 Ga0451576_0006119 3300045051 Bacteria 14829
314 Ga0451576_0011102 3300045051 Bacteria 10274
315 Ga0451576_0012395 3300045051 Bacteria 9577
316 Ga0451576_0013908 3300045051 Bacteria 8986
317 Ga0451576_0022652 3300045051 Bacteria 6807
318 Ga0451576_0025701 3300045051 Bacteria 6343
319 Ga0451576_0051961 3300045051 Bacteria 4295
320 Ga0451576_0083654 3300045051 Bacteria 3319
321 Ga0451576_0117083 3300045051 Bacteria 2774
322 Ga0451576_0129595 3300045051 Bacteria 2629
323 Ga0451576_0143234 3300045051 Bacteria 2492
324 Ga0451576_0165734 3300045051 Bacteria 2306
325 Ga0451576_0211260 3300045051 Bacteria 2026
326 Ga0451576_0365918 3300045051 Unclassified 1510
327 Ga0451576_0414115 3300045051 Bacteria 1414
328 Ga0451576_0536763 3300045051 Bacteria 1229
329 Ga0495638_0000040 3300046460 Bacteria 241883
330 Ga0495607_0043537 3300046501 Bacteria 2654
331 Ga0495606_0011558 3300046507 Bacteria 7186
332 Ga0495606_0086783 3300046507 Bacteria 1933
333 Ga0495606_0124892 3300046507 Bacteria 1536
334 Ga0495616_0035075 3300046513 Bacteria 2599
335 Ga0495643_0000294 3300046522 Bacteria 70329
336 Ga0495625_0001933 3300046660 Bacteria 23424
337 Ga0496125_0000031 3300048928 Bacteria 365156
338 Ga0496126_0053535 3300048929 Bacteria 3661
339 Ga0501306_000044 3300049127 Bacteria 6530
340 Ga0501306_002148 3300049127 Bacteria 1982
341 Ga0501306_003091 3300049127 Bacteria 1766
342 Ga0501306_008700 3300049127 Bacteria 1244
343 Ga0501306_012967 3300049127 Bacteria 1081
344 Ga0501308_000989 3300049128 Bacteria 2125
345 Ga0501308_001094 3300049128 Bacteria 2065
346 Ga0501308_001395 3300049128 Bacteria 1916
347 Ga0501308_002095 3300049128 Bacteria 1709
348 Ga0501309_000005 3300049129 Bacteria 11119
349 Ga0501310_000943 3300049130 Bacteria 2583
350 Ga0501343_000603 3300049132 Bacteria 2169
351 Ga0501344_01667 3300049133 Bacteria 1097
352 Ga0501345_00579 3300049134 Bacteria 1267
353 Ga0501305_000041 3300049161 Bacteria 7353
354 Ga0501305_000239 3300049161 Bacteria 4036
355 Ga0501305_002777 3300049161 Bacteria 1923
356 Ga0501305_003057 3300049161 Bacteria 1866
357 Ga0501305_003307 3300049161 Bacteria 1816
358 Ga0501305_003694 3300049161 Bacteria 1750
359 Ga0501307_000370 3300049162 Bacteria 2920
360 Ga0501307_001431 3300049162 Bacteria 2018
361 Ga0501307_004294 3300049162 Bacteria 1446
362 Ga0501307_007674 3300049162 Bacteria 1195
363 Ga0501307_010176 3300049162 Bacteria 1085
364 Ga0501307_010455 3300049162 Bacteria 1074
365 Ga0501311_011497 3300049527 Bacteria 1092
366 Ga0501312_000008 3300049528 Bacteria 9722
367 Ga0501312_001021 3300049528 Bacteria 2596
368 Ga0501312_003795 3300049528 Bacteria 1743
369 Ga0501313_000632 3300049529 Bacteria 2545
370 Ga0501313_002612 3300049529 Bacteria 1721
371 Ga0501313_005468 3300049529 Bacteria 1343
372 Ga0501314_000583 3300049530 Bacteria 2306
373 Ga0501314_000894 3300049530 Bacteria 2005
374 Ga0501314_003607 3300049530 Bacteria 1252
375 Ga0501315_000148 3300049531 Bacteria 3959
376 Ga0501315_000190 3300049531 Bacteria 3653
377 Ga0501315_003701 3300049531 Bacteria 1547
378 Ga0501315_006502 3300049531 Bacteria 1303
379 Ga0501315_010937 3300049531 Bacteria 1100
380 Ga0501316_000885 3300049532 Bacteria 2327
381 Ga0501316_009454 3300049532 Bacteria 1093
382 Ga0501317_000701 3300049533 Bacteria 2521
383 Ga0501317_002414 3300049533 Bacteria 1762
384 Ga0501318_000434 3300049534 Bacteria 2620
385 Ga0501319_000002 3300049535 Bacteria 13675
386 Ga0501319_001064 3300049535 Bacteria 1508
387 Ga0501320_002314 3300049536 Bacteria 1513
388 Ga0501321_001814 3300049537 Bacteria 1770
389 Ga0501321_001913 3300049537 Bacteria 1737
390 Ga0501321_002486 3300049537 Bacteria 1602
391 Ga0501322_002583 3300049538 Bacteria 1121
392 Ga0501323_000041 3300049539 Bacteria 6045
393 Ga0501323_004270 3300049539 Bacteria 1504
394 Ga0501324_003810 3300049540 Bacteria 1174
395 Ga0501325_000243 3300049541 Bacteria 2299
396 Ga0501325_000565 3300049541 Bacteria 1849
397 Ga0501330_000111 3300049546 Bacteria 2593
398 Ga0501330_000520 3300049546 Bacteria 1670
399 Ga0501332_00491 3300049548 Bacteria 1740
400 Ga0501333_000402 3300049549 Bacteria 1947
401 Ga0501335_000838 3300049551 Bacteria 2167
402 Ga0501335_006279 3300049551 Bacteria 1079
403 Ga0501336_000198 3300049552 Bacteria 2598
404 Ga0501336_001954 3300049552 Bacteria 1289
405 Ga0501340_001606 3300049556 Bacteria 1240
406 Ga0501340_002419 3300049556 Bacteria 1078
407 Ga0501032_0007271 3300049569 Bacteria 8100
408 Ga0501033_0000011 3300049570 Bacteria 259130
409 Ga0501033_0018215 3300049570 Bacteria 5306
410 Ga0501034_0001265 3300049571 Bacteria 34324
411 Ga0501036_0019659 3300049572 Bacteria 5670
412 Ga0501038_0002395 3300049574 Bacteria 17463
413 Ga0501038_0018280 3300049574 Bacteria 6328
414 Ga0501039_0023075 3300049575 Bacteria 4773
415 Ga0501040_0030029 3300049576 Bacteria 3670
416 Ga0501043_0024223 3300049579 Bacteria 4762
417 Ga0501046_0000192 3300049580 Bacteria 62674
418 Ga0501070_0122292 3300049586 Bacteria 2151
419 Ga0501222_005326 3300049662 Bacteria 1738
420 Ga0501227_029688 3300049665 Bacteria 1305
421 Ga0501236_000829 3300049670 Bacteria 3459
422 Ga0501257_000897 3300049686 Bacteria 6014
423 Ga0501257_006878 3300049686 Bacteria 2532
424 Ga0501241_001391 3300049758 Bacteria 4970
425 Ga0501035_0004622 3300049822 Bacteria 13050
426 Ga0501044_0023913 3300049823 Bacteria 6493
427 Ga0501044_0202112 3300049823 Bacteria 1945
428 Ga0501044_0602103 3300049823 Bacteria 992
429 Ga0501045_0000053 3300049824 Bacteria 51403
430 nmdc:mga0k408_124358_c1 3300050493 Bacteria 1529
431 nmdc:mga08y16_19020_c1 3300050511 Bacteria 7234
432 nmdc:mga08y16_21751_c1 3300050511 Bacteria 6769
433 Ga0500641_0000168 3300053096 Bacteria 24462
434 Ga0500556_0027899 3300053104 Bacteria 1890
435 Ga0500562_024884 3300053108 Bacteria 1565
436 Ga0500655_002499 3300053133 Bacteria 3350
437 Ga0500604_0043911 3300053151 Bacteria 1359
438 Ga0500616_0000013 3300053153 Bacteria 674172
439 Ga0500622_0000416 3300053156 Bacteria 40603
440 Ga0500622_0000433 3300053156 Bacteria 39766
441 Ga0500622_0015510 3300053156 Bacteria 4079
442 Ga0500622_0080715 3300053156 Bacteria 1629
443 Ga0587066_004162 3300059490 Unclassified 1757
444 Ga0587070_004636 3300059491 Bacteria 1750
445 Ga0587077_012823 3300059493 Bacteria 1348
446 Ga0587082_005077 3300059504 Bacteria 1693
447 Ga0587083_0010110 3300059505 Unclassified 1521
448 Ga0587086_002547 3300059507 Bacteria 1739
449 Ga0587090_001259 3300059510 Bacteria 2524
450 Ga0587094_002495 3300059513 Bacteria 1909
451 Ga0587062_000739 3300059639 Bacteria 2487
452 Ga0587062_000870 3300059639 Bacteria 2359
453 Ga0587076_009677 3300059645 Bacteria 1374
454 Ga0587079_012219 3300059647 Bacteria 1399
455 Ga0587061_00611 3300060244 Bacteria 1253
456 Ga0587111_0013898 3300060346 Unclassified 1446
457 2522549440 2522125168 Bacteria 7376607
458 2740031477 2739367866 Bacteria 4215900
459 2839990101 2839989709 Bacteria 3773432
460 2881247596 2881247448 Bacteria 3717788
461 2884637357 2884634485 Bacteria 3928637
462 2890807138 2890804823 Bacteria 3717572
463 2910249734 2910245624 Bacteria 6935613
464 2911143804 2911138879 Bacteria 5811561
465 2919697479 2919692658 Bacteria 5943958
466 2958514519 2958512119 Bacteria 4528530
467 2993481949 2993480792 Bacteria 4022225
468 Ga0453684_0688147
469 MBSR1b_contig_2043368
470 JGI24741J21665_1003251
471 Ga0006759J45824_1057866
472 Ga0006758J48902_1022741
473 rootH1_10004424
474 rootH2_10080702
475 rootH2_10128829
476 rootL2_10010167
477 rootL2_10023239
478 rootL2_10328105
479 rootH1_10006036
480 rootH1_10006988
481 rootH1_10021543
482 Ga0007410J51695_1088580
483 Ga0007409J51694_1063312
484 Ga0055536_1001261
485 Ga0055531_10000409
486 Ga0058859_11687935
487 Ga0058862_12107835
488 Ga0065165_1000131
489 Ga0065165_1000831
490 Ga0065704_10082979
491 Ga0065704_10121135
492 Ga0065715_10088958
493 Ga0070689_100262635
494 Ga0068856_100021492
495 Ga0068859_100474726
496 Ga0068860_100263863
497 Ga0068860_100433847
498 Ga0075428_100022554
499 Ga0097620_100474691
500 Ga0111539_10001098
501 Ga0105245_10141516
502 Ga0105249_10092720
503 Ga0157371_10213584
504 Ga0157370_10133990
505 Ga0157378_10357268
506 Ga0163162_10163197
507 Ga0157372_10411270
508 Ga0157380_10000051
509 Ga0163161_10009312
510 Ga0206356_11345452
511 Ga0224712_10000155
512 Ga0209455_1006502
513 Ga0209676_1000332
514 Ga0209050_1002964
515 Ga0209050_1018624
516 Ga0209257_1000007
517 Ga0209257_1027714
518 Ga0209968_1001995
519 Ga0209968_1008919
520 Ga0207428_10019856
521 Ga0207428_10027425
522 Ga0268266_10228309
523 Ga0265337_1000075
524 Ga0265337_1028473
525 Ga0265326_10000273
526 Ga0265326_10002298
527 Ga0265319_1000077
528 Ga0265319_1000371
529 Ga0265334_10002366
530 Ga0265334_10021468
531 Ga0265334_10028741
532 Ga0265318_10000750
533 Ga0265318_10004338
534 Ga0265318_10010226
535 Ga0265323_10000040
536 Ga0265323_10000600
537 Ga0265323_10004199
538 Ga0265323_10063093
539 Ga0265322_10000054
540 Ga0265322_10000133
541 Ga0265322_10014430
542 Ga0265322_10027781
543 Ga0265336_10000066
544 Ga0307515_10000009
545 Ga0307515_10112100
546 Ga0265338_10000388
547 Ga0265338_10000637
548 Ga0265338_10001162
549 Ga0265338_10001855
550 Ga0265338_10001977
551 Ga0265338_10009697
552 Ga0265324_10000662
553 Ga0265324_10001155
554 Ga0265324_10009310
555 Ga0265324_10014323
556 Ga0265330_10000067
557 Ga0265332_10004142
558 Ga0265332_10008374
559 Ga0265328_10001017
560 Ga0265320_10000783
561 Ga0265320_10016903
562 Ga0265325_10010282
563 Ga0265329_10004263
564 Ga0265329_10005896
565 Ga0265340_10005977
566 Ga0265340_10006941
567 Ga0265339_10008063
568 Ga0265339_10012208
569 Ga0265339_10027023
570 Ga0265339_10113789
571 Ga0265331_10000271
572 Ga0265327_10000370
573 Ga0265327_10004316
574 Ga0265327_10068253
575 Ga0265316_10000486
576 Ga0265316_10000631
577 Ga0265316_10004409
578 Ga0265316_10004585
579 Ga0265316_10005804
580 Ga0265316_10005991
581 Ga0265316_10007082
582 Ga0265316_10065971
583 Ga0265316_10104119
584 Ga0265316_10219150
585 Ga0265316_10297875
586 Ga0307513_10045434
587 Ga0307513_10045488
588 Ga0307513_10059713
589 Ga0307509_10150687
590 Ga0307408_100003845
591 Ga0307408_100197442
592 Ga0265313_10000713
593 Ga0265313_10009067
594 Ga0307514_10019601
595 Ga0265314_10002064
596 Ga0265314_10040807
597 Ga0265314_10064309
598 Ga0265342_10001480
599 Ga0265342_10002732
600 Ga0265342_10003312
601 Ga0265342_10185397
602 Ga0316576_10017698
603 Ga0316576_10039513
604 Ga0316576_10056989
605 Ga0316576_10060515
606 Ga0316576_10085558
607 Ga0316576_10153290
608 Ga0316578_10004394
609 Ga0316578_10027877
610 Ga0316578_10040793
611 Ga0316578_10087593
612 Ga0316578_10095071
613 Ga0307405_10015203
614 Ga0307405_10066822
615 Ga0316577_10018495
616 Ga0316577_10090884
617 Ga0307413_10170538
618 Ga0307413_10299403
619 Ga0307410_10125542
620 Ga0307412_10249197
621 Ga0307409_100145713
622 Ga0307409_100184640
623 Ga0307416_100000249
624 Ga0307416_100533293
625 Ga0307414_10000927
626 Ga0307414_10081437
627 Ga0307414_10155393
628 Ga0307411_10065726
629 Ga0307415_100002166
630 Ga0316583_10039922
631 Ga0316585_10003939
632 Ga0316593_10003117
633 Ga0316593_10003954
634 Ga0316593_10007819
635 Ga0316593_10013476
636 Ga0316593_10014872
637 Ga0316593_10052184
638 Ga0316593_10073996
639 Ga0316592_1000331
640 Ga0316592_1000945
641 Ga0316592_1001036
642 Ga0316592_1012760
643 Ga0316592_1013074
644 Ga0316592_1024971
645 Ga0316592_1027573
646 Ga0316588_1001461
647 Ga0316588_1001571
648 Ga0316588_1014412
649 Ga0316588_1018500
650 Ga0316596_1000348
651 Ga0316596_1000575
652 Ga0316596_1002512
653 Ga0316596_1003747
654 Ga0316596_1003898
655 Ga0316596_1006680
656 Ga0316596_1007610
657 Ga0316596_1009403
658 Ga0316596_1015598
659 Ga0316574_0129381
660 Ga0316582_0036309
661 Ga0316582_0048716
662 Ga0316582_0093165
663 Ga0316582_0101451
664 Ga0316584_0007005
665 Ga0316584_0011287
666 Ga0316584_0021141
667 Ga0316584_0048368
668 Ga0316584_0140595
669 Ga0316584_0205482
670 Ga0395899_0000673
671 Ga0395905_0000376
672 Ga0395901_0003122
673 Ga0395901_0010513
674 Ga0400483_035362
675 Ga0400483_136248
676 Ga0400489_00932
677 Ga0451794_35967
678 Ga0451795_0101213
679 Ga0451805_059623
680 Ga0451807_1046355
681 Ga0451852_13332
682 Ga0451855_0808132
683 Ga0451855_0833356
684 Ga0439445_0003220
685 Ga0439457_055609
686 Ga0451577_0000092
687 Ga0451577_0000255
688 Ga0451577_0000404
689 Ga0451577_0000433
690 Ga0451577_0000461
691 Ga0451577_0000690
692 Ga0451577_0005144
693 Ga0451577_0009644
694 Ga0451577_0013367
695 Ga0451577_0022022
696 Ga0451577_0023389
697 Ga0451577_0024955
698 Ga0451577_0025303
699 Ga0451577_0028546
700 Ga0451577_0039585
701 Ga0451577_0047949
702 Ga0451577_0066417
703 Ga0451577_0124481
704 Ga0451577_0192372
705 Ga0451577_0349475
706 Ga0451577_0351159
707 Ga0451577_0400622
708 Ga0466972_0061578
709 Ga0453683_0000055
710 Ga0453683_0000066
711 Ga0453683_0000522
712 Ga0453683_0003372
713 Ga0453683_0005928
714 Ga0453683_0006727
715 Ga0453683_0015630
716 Ga0453683_0054898
717 Ga0453683_0057968
718 Ga0453683_0109358
719 Ga0453683_0124990
720 Ga0453683_0243979
721 Ga0453683_0291249
722 Ga0453684_0000024
723 Ga0453684_0000334
724 Ga0453684_0000413
725 Ga0453684_0000440
726 Ga0453684_0000506
727 Ga0453684_0001121
728 Ga0453684_0001193
729 Ga0453684_0001382
730 Ga0453684_0001549
731 Ga0453684_0002895
732 Ga0453684_0004169
733 Ga0453684_0004492
734 Ga0453684_0005656
735 Ga0453684_0008189
736 Ga0453684_0012002
737 Ga0453684_0012437
738 Ga0453684_0012544
739 Ga0453684_0012598
740 Ga0453684_0015794
741 Ga0453684_0016252
742 Ga0453684_0024288
743 Ga0453684_0028318
744 Ga0453684_0035092
745 Ga0453684_0042224
746 Ga0453684_0049674
747 Ga0453684_0064505
748 Ga0453684_0076172
749 Ga0453684_0099672
750 Ga0453684_0104626
751 Ga0453684_0106316
752 Ga0453684_0113057
753 Ga0453684_0130685
754 Ga0453684_0141195
755 Ga0453684_0143337
756 Ga0453684_0165681
757 Ga0453684_0171057
758 Ga0453684_0182883
759 Ga0453684_0208192
760 Ga0453684_0229936
761 Ga0453684_0241341
762 Ga0453684_0242286
763 Ga0453684_0257001
764 Ga0453684_0290982
765 Ga0453684_0337044
766 Ga0453684_0370850
767 Ga0453684_0394459
768 Ga0453684_0394665
769 Ga0453684_0394816
770 Ga0453684_0774694
771 Ga0453684_0827650
772 Ga0466970_0066929
773 Ga0466960_0285149
774 Ga0451576_0000113
775 Ga0451576_0000204
776 Ga0451576_0000689
777 Ga0451576_0000783
778 Ga0451576_0003461
779 Ga0451576_0003652
780 Ga0451576_0006119
781 Ga0451576_0011102
782 Ga0451576_0012395
783 Ga0451576_0013908
784 Ga0451576_0022652
785 Ga0451576_0025701
786 Ga0451576_0051961
787 Ga0451576_0083654
788 Ga0451576_0117083
789 Ga0451576_0129595
790 Ga0451576_0143234
791 Ga0451576_0165734
792 Ga0451576_0211260
793 Ga0451576_0365918
794 Ga0451576_0414115
795 Ga0451576_0536763
796 Ga0495638_0000040
797 Ga0495607_0043537
798 Ga0495606_0011558
799 Ga0495606_0086783
800 Ga0495606_0124892
801 Ga0495616_0035075
802 Ga0495643_0000294
803 Ga0495625_0001933
804 Ga0496125_0000031
805 Ga0496126_0053535
806 Ga0501306_000044
807 Ga0501306_002148
808 Ga0501306_003091
809 Ga0501306_008700
810 Ga0501306_012967
811 Ga0501308_000989
812 Ga0501308_001094
813 Ga0501308_001395
814 Ga0501308_002095
815 Ga0501309_000005
816 Ga0501310_000943
817 Ga0501343_000603
818 Ga0501344_01667
819 Ga0501345_00579
820 Ga0501305_000041
821 Ga0501305_000239
822 Ga0501305_002777
823 Ga0501305_003057
824 Ga0501305_003307
825 Ga0501305_003694
826 Ga0501307_000370
827 Ga0501307_001431
828 Ga0501307_004294
829 Ga0501307_007674
830 Ga0501307_010176
831 Ga0501307_010455
832 Ga0501311_011497
833 Ga0501312_000008
834 Ga0501312_001021
835 Ga0501312_003795
836 Ga0501313_000632
837 Ga0501313_002612
838 Ga0501313_005468
839 Ga0501314_000583
840 Ga0501314_000894
841 Ga0501314_003607
842 Ga0501315_000148
843 Ga0501315_000190
844 Ga0501315_003701
845 Ga0501315_006502
846 Ga0501315_010937
847 Ga0501316_000885
848 Ga0501316_009454
849 Ga0501317_000701
850 Ga0501317_002414
851 Ga0501318_000434
852 Ga0501319_000002
853 Ga0501319_001064
854 Ga0501320_002314
855 Ga0501321_001814
856 Ga0501321_001913
857 Ga0501321_002486
858 Ga0501322_002583
859 Ga0501323_000041
860 Ga0501323_004270
861 Ga0501324_003810
862 Ga0501325_000243
863 Ga0501325_000565
864 Ga0501330_000111
865 Ga0501330_000520
866 Ga0501332_00491
867 Ga0501333_000402
868 Ga0501335_000838
869 Ga0501335_006279
870 Ga0501336_000198
871 Ga0501336_001954
872 Ga0501340_001606
873 Ga0501340_002419
874 Ga0501032_0007271
875 Ga0501033_0000011
876 Ga0501033_0018215
877 Ga0501034_0001265
878 Ga0501036_0019659
879 Ga0501038_0002395
880 Ga0501038_0018280
881 Ga0501039_0023075
882 Ga0501040_0030029
883 Ga0501043_0024223
884 Ga0501046_0000192
885 Ga0501070_0122292
886 Ga0501222_005326
887 Ga0501227_029688
888 Ga0501236_000829
889 Ga0501257_000897
890 Ga0501257_006878
891 Ga0501241_001391
892 Ga0501035_0004622
893 Ga0501044_0023913
894 Ga0501044_0202112
895 Ga0501044_0602103
896 Ga0501045_0000053
897 nmdc:mga0k408_124358_c1
898 nmdc:mga08y16_19020_c1
899 nmdc:mga08y16_21751_c1
900 Ga0500641_0000168
901 Ga0500556_0027899
902 Ga0500562_024884
903 Ga0500655_002499
904 Ga0500604_0043911
905 Ga0500616_0000013
906 Ga0500622_0000416
907 Ga0500622_0000433
908 Ga0500622_0015510
909 Ga0500622_0080715
910 Ga0587066_004162
911 Ga0587070_004636
912 Ga0587077_012823
913 Ga0587082_005077
914 Ga0587083_0010110
915 Ga0587086_002547
916 Ga0587090_001259
917 Ga0587094_002495
918 Ga0587062_000739
919 Ga0587062_000870
920 Ga0587076_009677
921 Ga0587079_012219
922 Ga0587061_00611
923 Ga0587111_0013898
924 2522549440
925 2740031477
926 2839990101
927 2881247596
928 2884637357
929 2890807138
930 2910249734
931 2911143804
932 2919697479
933 2958514519
934 2993481949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01193

RNA_pol_L

RNA polymerase Rpb3/Rpb11 dimerisation domain

27

223

0.98

PF03118

RNA_pol_A_CTD

Bacterial RNA polymerase, alpha chain C terminal domain

248

314

0.93

PF01000

RNA_pol_A_bac

RNA polymerase Rpb3/RpoA insert domain

52

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z3e-assembly1.cif.gz_B crystal structure of spx in complex with the c-terminal domain of the rna polymerase alpha subunit 0.9773 254 317
7x76-assembly1.cif.gz_S cryo-em structure of streptomyces coelicolor rnap-promoter open complex with two zur dimers 0.9525 259 312
3ihq-assembly1.cif.gz_B crystal structure of reduced c10s spx in complex with the alpha c-terminal domain of rna polymeras 0.9517 254 317
3k4g-assembly8.cif.gz_H crystal structure of e. coli rna polymerase alpha subunit c-terminal domain 0.9515 255 320
3k4g-assembly4.cif.gz_D crystal structure of e. coli rna polymerase alpha subunit c-terminal domain 0.9513 254 320
ID Description Score Start End Superfamily
1z3eB00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9773 254 317 1.10.150.20
4zh4A03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9627 266 320 1.10.150.20
3n4mC00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9533 254 320 1.10.150.20
3ihqB00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9517 254 317 1.10.150.20
3n97C00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9471 255 320 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A538U3G8-F1-model_v4 DNA-directed RNA polymerase subunit alpha 0.9749 245 324 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A524PV49-F1-model_v4 DNA-directed RNA polymerase subunit alpha (EC 2.7.7.6) 0.9602 1 215 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
GO:0046983
AF-Q2L382-F1-model_v4 RNA polymerase alpha subunit 0.9542 34 225 GO:0000428
GO:0003677
GO:0003899
GO:0006351
GO:0046983
AF-A6CGQ3-F1-model_v4 deleted 0.9518 18 224
AF-A1IUY0-F1-model_v4 RNA polymerase alpha subunit 0.9503 24 233 GO:0000428
GO:0003677
GO:0003899
GO:0006351
GO:0046983

Map