F449898

General Info

Members Datasets Scaffolds Average Seq Length
467 235 934 379

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0024328|Ga0495584_0024328_1664_2896
Length 410
Sequence MKIVIAPDSYKESLSAMQVATEIEAGFREVFPDAEYVKVPVADGGEGTVQAMIEATAGRRVERAVSGPLGEPVQAFYGLTGGDPVAVIEMAAASGLELVPPERRNPMITTSYGTGELIRAALDAGARRFVLGVGGSATNDGGAGMLQALGVRLLDAQGAELGPGGGELARLARIDVARLDPRVHDSVFDVACDVTNPLVGPRGASAVFGPQKGASPEVVRQLDDNLRHYAQVIGRDLGREVADIAGAGXXXXIAAAMLVFLDGRLRPGSEIVTDAIGLDAAVRDADLVVTGEGRIDSQTVNGKTPVGVSRVAQRHGKPVIGIGGCLARDAAAVHGHGIDAIFSTVSRPCTVREALDEAAFNLRTAARNIAATLKLGAQVLAQRQPVQPIPAQLLDDGSAPSDASELVNLG

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
78 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
90 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 2547132181 Kosakonia sacchari SP1 Isolate Stem
177 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
178 2561511199 Enterobacter sp. R4-368 Isolate Nodule
179 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
180 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
181 2636415599 Klebsiella variicola DX120E Isolate Unclassified
182 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
183 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
184 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
185 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
186 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
187 2738541297 Duganella sp. GV083 Isolate Unclassified
188 2738541357 Duganella sp. GV053 Isolate Unclassified
189 2738543003 Duganella sp. GV066 Isolate Unclassified
190 2738543026 Duganella sp. GV089 Isolate Unclassified
191 2738543029 Duganella sp. GV039 Isolate Unclassified
192 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
193 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
194 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
195 2775507074 Klebsiella sp. D5A Isolate Unclassified
196 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
197 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
198 2821131069 Duganella sp. 1224 Isolate Unclassified
199 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
200 2842711865 Duganella sp. R-73148 Isolate Unclassified
201 2857558681 Duganella sp. R-74565 Isolate Unclassified
202 2857564685 Duganella sp. R-74599 Isolate Unclassified
203 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
204 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
205 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
206 2904424332 Duganella sp. 1411 Isolate Rhizosphere
207 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
208 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
209 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
210 2919476304 Duganella sp. 3397 Isolate Unclassified
211 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
212 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
213 2937967321 Serratia sp. YC16 Isolate Unclassified
214 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
215 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
216 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
217 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
218 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
219 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
220 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
221 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
222 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
223 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
224 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
225 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
226 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
227 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
228 8018221730 Enterobacter sp. CM29 Isolate Unclassified
229 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
230 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
231 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
232 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
233 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
234 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
235 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.65
Metatranscriptomes 0.43
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 2.57
Nodule 2.36
Rhizoplane 2.78
Rhizosphere 76.02
Stem 0.21
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0024328 3300046491 Bacteria 3071
2 SwRhRL2b_contig_2888319 2162886007 Bacteria 3300
3 JGI25153J46596_10016510 3300003215 Bacteria 2952
4 rootL2_10064902 3300003322 Bacteria 3675
5 rootL2_10298934 3300003322 Bacteria 1536
6 Ga0006562J51391_1008382 3300003578 Bacteria 2777
7 Ga0055526_1000001 3300003771 Bacteria 669703
8 Ga0058692_1001128 3300003856 Bacteria 10343
9 Ga0065704_10000919 3300005289 Bacteria 10903
10 Ga0065715_10004065 3300005293 Bacteria 6278
11 Ga0070660_100007414 3300005339 Bacteria 7641
12 Ga0070692_10033060 3300005345 Bacteria 2606
13 Ga0070701_10037590 3300005438 Bacteria 2445
14 Ga0070708_100040573 3300005445 Bacteria 4076
15 Ga0070708_100413801 3300005445 Bacteria 1271
16 Ga0070706_100000008 3300005467 Bacteria 225667
17 Ga0070706_100000805 3300005467 Bacteria 34769
18 Ga0070706_100003138 3300005467 Bacteria 16343
19 Ga0070706_100171993 3300005467 Bacteria 2023
20 Ga0070707_100159959 3300005468 Bacteria 2194
21 Ga0070698_100088530 3300005471 Bacteria 3081
22 Ga0070698_100141934 3300005471 Bacteria 2353
23 Ga0070684_100070994 3300005535 Bacteria 3065
24 Ga0070697_100042083 3300005536 Bacteria 3697
25 Ga0070697_100058861 3300005536 Bacteria 3127
26 Ga0070697_100155607 3300005536 Bacteria 1929
27 Ga0070665_100000743 3300005548 Bacteria 43398
28 Ga0070665_100394597 3300005548 Bacteria 1391
29 Ga0068855_100005047 3300005563 Bacteria 16110
30 Ga0068857_100003577 3300005577 Bacteria 13001
31 Ga0068851_10018535 3300005834 Bacteria 3353
32 Ga0068862_100154637 3300005844 Bacteria 2043
33 Ga0081540_1011437 3300005983 Bacteria 5929
34 Ga0075364_10012505 3300006051 Bacteria 5195
35 Ga0075428_100009533 3300006844 Bacteria 10781
36 Ga0075428_100262777 3300006844 Bacteria 1858
37 Ga0075433_10024307 3300006852 Bacteria 5112
38 Ga0075433_10035613 3300006852 Bacteria 4282
39 Ga0075433_10119562 3300006852 Bacteria 2339
40 Ga0075433_10120094 3300006852 Bacteria 2333
41 Ga0075434_100072865 3300006871 Bacteria 3427
42 Ga0075434_100083592 3300006871 Bacteria 3190
43 Ga0075434_100084035 3300006871 Unclassified 3182
44 Ga0075429_100010469 3300006880 Bacteria 8024
45 Ga0075436_100048058 3300006914 Bacteria 2945
46 Ga0079104_1000495 3300006946 Bacteria 42708
47 Ga0079104_1001641 3300006946 Bacteria 14502
48 Ga0079104_1001726 3300006946 Bacteria 13922
49 Ga0079104_1010394 3300006946 Bacteria 3070
50 Ga0105251_10001434 3300009011 Bacteria 20536
51 Ga0105251_10003623 3300009011 Bacteria 11099
52 Ga0105251_10012692 3300009011 Bacteria 4752
53 Ga0105251_10052107 3300009011 Bacteria 1949
54 Ga0105251_10067406 3300009011 Bacteria 1672
55 Ga0105244_10002356 3300009036 Bacteria 14345
56 Ga0105244_10003019 3300009036 Bacteria 12349
57 Ga0105244_10010000 3300009036 Bacteria 5779
58 Ga0105250_10000602 3300009092 Bacteria 23453
59 Ga0111539_10007555 3300009094 Bacteria 13898
60 Ga0111539_10114088 3300009094 Bacteria 3169
61 Ga0114129_10001061 3300009147 Bacteria 36092
62 Ga0114129_10002869 3300009147 Bacteria 24122
63 Ga0114129_10055674 3300009147 Bacteria 5542
64 Ga0114129_10059311 3300009147 Bacteria 5351
65 Ga0114129_10098114 3300009147 Bacteria 4055
66 Ga0105243_10198737 3300009148 Bacteria 1757
67 Ga0105243_10297576 3300009148 Bacteria 1461
68 Ga0157373_10046784 3300013100 Bacteria 3087
69 Ga0157371_10000060 3300013102 Bacteria 170456
70 Ga0157371_10009635 3300013102 Bacteria 7596
71 Ga0157370_10175644 3300013104 Bacteria 1991
72 Ga0182006_1000008 3300015261 Bacteria 449652
73 Ga0182007_10020349 3300015262 Bacteria 2373
74 Ga0182005_1000008 3300015265 Bacteria 471394
75 Ga0163161_10205888 3300017792 Bacteria 1518
76 Ga0207425_1000081 3300025245 Bacteria 97913
77 Ga0209646_1000023 3300025246 Bacteria 441100
78 Ga0209025_1001632 3300025294 Bacteria 27895
79 Ga0209564_1000002 3300025295 Bacteria 1636803
80 Ga0209758_1000640 3300025297 Bacteria 53312
81 Ga0207656_10022887 3300025321 Bacteria 2510
82 Ga0207696_1000821 3300025711 Bacteria 19936
83 Ga0207696_1004753 3300025711 Bacteria 5781
84 Ga0207696_1040089 3300025711 Bacteria 1373
85 Ga0207655_1000065 3300025728 Bacteria 252767
86 Ga0207655_1000956 3300025728 Bacteria 29855
87 Ga0207655_1001886 3300025728 Bacteria 18010
88 Ga0207655_1010206 3300025728 Bacteria 5721
89 Ga0207655_1038235 3300025728 Bacteria 2101
90 Ga0207713_1000019 3300025735 Bacteria 361225
91 Ga0207713_1000033 3300025735 Bacteria 273751
92 Ga0207713_1012900 3300025735 Bacteria 4437
93 Ga0207713_1027226 3300025735 Bacteria 2601
94 Ga0207713_1040076 3300025735 Bacteria 1970
95 Ga0207713_1044822 3300025735 Bacteria 1812
96 Ga0207684_10000029 3300025910 Bacteria 305483
97 Ga0207684_10000294 3300025910 Bacteria 71779
98 Ga0207684_10009779 3300025910 Bacteria 8459
99 Ga0207684_10012851 3300025910 Bacteria 7253
100 Ga0207684_10017936 3300025910 Bacteria 6067
101 Ga0207660_10014890 3300025917 Bacteria 5126
102 Ga0207662_10015574 3300025918 Bacteria 4281
103 Ga0207657_10038322 3300025919 Bacteria 4269
104 Ga0207646_10000004 3300025922 Bacteria 529176
105 Ga0207646_10137885 3300025922 Bacteria 2197
106 Ga0207667_10143379 3300025949 Bacteria 2459
107 Ga0207674_10007812 3300026116 Bacteria 12433
108 Ga0209281_1000025 3300027111 Bacteria 488275
109 Ga0209281_1000089 3300027111 Bacteria 243650
110 Ga0209281_1000559 3300027111 Bacteria 45161
111 Ga0209281_1000768 3300027111 Bacteria 30641
112 Ga0209281_1001450 3300027111 Bacteria 13935
113 Ga0209281_1003887 3300027111 Bacteria 4682
114 Ga0209371_1000701 3300027312 Bacteria 28374
115 Ga0209371_1001352 3300027312 Bacteria 16987
116 Ga0209371_1007752 3300027312 Bacteria 3680
117 Ga0209371_1013787 3300027312 Bacteria 2246
118 Ga0207428_10005246 3300027907 Bacteria 12109
119 Ga0268266_10000041 3300028379 Bacteria 322311
120 Ga0268266_10064513 3300028379 Bacteria 3164
121 Ga0268265_10088635 3300028380 Unclassified 2466
122 Ga0268256_1000709 3300030500 Bacteria 24859
123 Ga0268256_1000945 3300030500 Bacteria 19893
124 Ga0268256_1001840 3300030500 Bacteria 11849
125 Ga0268256_1007998 3300030500 Bacteria 3680
126 Ga0268256_1015288 3300030500 Bacteria 2246
127 Ga0316181_1128690 3300030744 Bacteria 5320
128 Ga0316576_10020246 3300031727 Bacteria 4574
129 Ga0316578_10000134 3300031728 Bacteria 18909
130 Ga0316578_10042339 3300031728 Unclassified 2640
131 Ga0316577_10012271 3300031733 Bacteria 4666
132 Ga0316585_10020839 3300032137 Unclassified 2010
133 Ga0316596_1001274 3300033541 Bacteria 4992
134 Ga0316584_0000268 3300036712 Bacteria 26369
135 Ga0395899_0000012 3300037312 Bacteria 517561
136 Ga0395899_0005008 3300037312 Bacteria 10309
137 Ga0395900_0004365 3300037418 Bacteria 14999
138 Ga0395900_0092922 3300037418 Bacteria 3099
139 Ga0395900_0104210 3300037418 Bacteria 2914
140 Ga0400483_093469 3300039062 Bacteria 1817
141 Ga0439438_000245 3300041405 Bacteria 24157
142 Ga0439448_0000435 3300042005 Bacteria 9600
143 Ga0439452_000272 3300042010 Bacteria 34192
144 Ga0439452_000415 3300042010 Bacteria 25018
145 Ga0439452_003757 3300042010 Bacteria 5229
146 Ga0450902_003953 3300042137 Bacteria 2191
147 Ga0439464_0001001 3300042439 Bacteria 6430
148 Ga0466972_0043046 3300044658 Bacteria 2194
149 Ga0466961_0120026 3300044693 Bacteria 1651
150 Ga0466957_0097320 3300044842 Bacteria 1851
151 Ga0466959_0063864 3300045049 Bacteria 2673
152 Ga0466959_0095848 3300045049 Unclassified 2128
153 Ga0495617_000018 3300046452 Bacteria 248300
154 Ga0495617_015023 3300046452 Bacteria 2628
155 Ga0495627_000001 3300046453 Bacteria 1104709
156 Ga0495627_009357 3300046453 Bacteria 3611
157 Ga0495603_0125970 3300046455 Bacteria 1493
158 Ga0495590_0000002 3300046457 Bacteria 485720
159 Ga0495591_022105 3300046458 Bacteria 2061
160 Ga0495638_0000030 3300046460 Bacteria 318183
161 Ga0495653_0000009 3300046463 Bacteria 304207
162 Ga0495653_0016567 3300046463 Bacteria 5999
163 Ga0495653_0023804 3300046463 Bacteria 4943
164 Ga0495650_0000040 3300046471 Bacteria 366254
165 Ga0495650_0000067 3300046471 Bacteria 269882
166 Ga0495650_0000170 3300046471 Bacteria 143177
167 Ga0495650_0000240 3300046471 Bacteria 109029
168 Ga0495650_0000882 3300046471 Bacteria 35550
169 Ga0495650_0003000 3300046471 Bacteria 12758
170 Ga0495650_0028964 3300046471 Bacteria 2531
171 Ga0495582_0167962 3300046473 Bacteria 1248
172 Ga0495605_0000023 3300046474 Bacteria 236732
173 Ga0495605_0000179 3300046474 Bacteria 80278
174 Ga0495605_0008579 3300046474 Bacteria 5776
175 Ga0495605_0020439 3300046474 Bacteria 3518
176 Ga0495584_0000001 3300046491 Bacteria 649329
177 Ga0495584_0000552 3300046491 Bacteria 25369
178 Ga0495584_0008798 3300046491 Bacteria 5221
179 Ga0495584_0084060 3300046491 Bacteria 1603
180 Ga0495585_0000003 3300046492 Bacteria 406344
181 Ga0495585_0000011 3300046492 Bacteria 210440
182 Ga0495585_0000261 3300046492 Bacteria 53904
183 Ga0495585_0000501 3300046492 Bacteria 37082
184 Ga0495585_0001969 3300046492 Bacteria 15299
185 Ga0495585_0016722 3300046492 Bacteria 4249
186 Ga0495585_0027027 3300046492 Bacteria 3276
187 Ga0495585_0088911 3300046492 Bacteria 1665
188 Ga0495594_0000553 3300046499 Bacteria 19140
189 Ga0495594_0025181 3300046499 Bacteria 3198
190 Ga0495596_0000923 3300046500 Bacteria 17523
191 Ga0495596_0001046 3300046500 Bacteria 16444
192 Ga0495596_0001421 3300046500 Bacteria 13733
193 Ga0495596_0069007 3300046500 Bacteria 1373
194 Ga0495607_0008000 3300046501 Bacteria 7263
195 Ga0495607_0018281 3300046501 Bacteria 4472
196 Ga0495607_0019244 3300046501 Bacteria 4339
197 Ga0495607_0027284 3300046501 Bacteria 3533
198 Ga0495607_0049062 3300046501 Bacteria 2464
199 Ga0495607_0067543 3300046501 Bacteria 2008
200 Ga0495583_0000048 3300046506 Bacteria 217130
201 Ga0495583_0000408 3300046506 Bacteria 65197
202 Ga0495583_0051319 3300046506 Bacteria 1881
203 Ga0495606_0000006 3300046507 Bacteria 357021
204 Ga0495606_0000397 3300046507 Bacteria 73368
205 Ga0495606_0000460 3300046507 Bacteria 66820
206 Ga0495606_0007089 3300046507 Bacteria 10137
207 Ga0495606_0133128 3300046507 Bacteria 1476
208 Ga0495610_0000012 3300046512 Bacteria 517442
209 Ga0495610_0004059 3300046512 Bacteria 10991
210 Ga0495610_0007300 3300046512 Bacteria 7393
211 Ga0495610_0013165 3300046512 Bacteria 4929
212 Ga0495610_0030497 3300046512 Bacteria 2825
213 Ga0495616_0000260 3300046513 Bacteria 42862
214 Ga0495616_0000426 3300046513 Bacteria 32236
215 Ga0495616_0029682 3300046513 Bacteria 2884
216 Ga0495616_0143036 3300046513 Bacteria 1087
217 Ga0495631_0010982 3300046518 Bacteria 4470
218 Ga0495631_0013259 3300046518 Bacteria 4004
219 Ga0495631_0019453 3300046518 Bacteria 3183
220 Ga0495632_0000044 3300046519 Bacteria 141051
221 Ga0495632_0013468 3300046519 Bacteria 4667
222 Ga0495637_0000144 3300046520 Bacteria 53773
223 Ga0495637_0003983 3300046520 Bacteria 7721
224 Ga0495643_0000051 3300046522 Bacteria 207804
225 Ga0495643_0000076 3300046522 Bacteria 166614
226 Ga0495643_0037841 3300046522 Bacteria 2644
227 Ga0495644_0005096 3300046523 Bacteria 5141
228 Ga0495644_0013126 3300046523 Bacteria 3183
229 Ga0495648_0000009 3300046524 Bacteria 317193
230 Ga0495648_0000011 3300046524 Bacteria 299518
231 Ga0495648_0001201 3300046524 Bacteria 25950
232 Ga0495648_0009253 3300046524 Bacteria 7658
233 Ga0495648_0012002 3300046524 Bacteria 6493
234 Ga0495648_0055585 3300046524 Bacteria 2385
235 Ga0495663_0007739 3300046525 Bacteria 2972
236 Ga0495666_0000230 3300046526 Bacteria 23874
237 Ga0495642_0000757 3300046528 Bacteria 15886
238 Ga0495642_0002893 3300046528 Bacteria 6848
239 Ga0495642_0006056 3300046528 Bacteria 4644
240 Ga0495642_0025818 3300046528 Bacteria 2330
241 Ga0495642_0049101 3300046528 Bacteria 1732
242 Ga0495654_0000011 3300046530 Bacteria 363172
243 Ga0495654_0041668 3300046530 Bacteria 2282
244 Ga0495665_0027649 3300046531 Bacteria 3043
245 Ga0495609_0000001 3300046538 Bacteria 1060094
246 Ga0495609_0003703 3300046538 Bacteria 8640
247 Ga0495609_0006335 3300046538 Bacteria 6047
248 Ga0495609_0006907 3300046538 Bacteria 5730
249 Ga0495609_0051156 3300046538 Bacteria 1840
250 Ga0495597_0000212 3300046542 Bacteria 53210
251 Ga0495597_0001656 3300046542 Bacteria 15529
252 Ga0495597_0009125 3300046542 Bacteria 4923
253 Ga0495597_0021239 3300046542 Bacteria 3019
254 Ga0495622_0000279 3300046557 Bacteria 38964
255 Ga0495622_0014223 3300046557 Bacteria 3695
256 Ga0495633_0000093 3300046558 Bacteria 121394
257 Ga0495633_0000198 3300046558 Bacteria 76860
258 Ga0495633_0001843 3300046558 Bacteria 15579
259 Ga0495656_0006248 3300046615 Bacteria 4169
260 Ga0495656_0013647 3300046615 Bacteria 3027
261 Ga0495668_0000709 3300046616 Bacteria 40174
262 Ga0495668_0001092 3300046616 Bacteria 28176
263 Ga0495668_0004056 3300046616 Bacteria 10645
264 Ga0495668_0009015 3300046616 Bacteria 6160
265 Ga0495668_0050509 3300046616 Bacteria 2305
266 Ga0495611_0019498 3300046648 Bacteria 2913
267 Ga0495625_0000075 3300046660 Bacteria 163672
268 Ga0495625_0001667 3300046660 Bacteria 25992
269 Ga0495625_0013470 3300046660 Bacteria 6570
270 Ga0495625_0018693 3300046660 Bacteria 5399
271 Ga0495625_0070760 3300046660 Bacteria 2449
272 Ga0495661_0000206 3300046665 Bacteria 68072
273 Ga0495661_0000671 3300046665 Bacteria 34227
274 Ga0495661_0005374 3300046665 Bacteria 9105
275 Ga0495661_0025618 3300046665 Bacteria 3808
276 Ga0495661_0034697 3300046665 Bacteria 3172
277 Ga0495661_0037056 3300046665 Bacteria 3047
278 Ga0495588_0002836 3300046674 Bacteria 7456
279 Ga0495588_0019273 3300046674 Bacteria 3340
280 Ga0495588_0034775 3300046674 Bacteria 2550
281 Ga0495588_0106899 3300046674 Bacteria 1473
282 Ga0495623_0022569 3300046679 Bacteria 4065
283 Ga0495669_0000158 3300046684 Bacteria 43133
284 Ga0495613_0034992 3300046689 Bacteria 3729
285 Ga0495670_0000153 3300046691 Bacteria 30703
286 Ga0495670_0041651 3300046691 Bacteria 2291
287 Ga0495670_0082299 3300046691 Bacteria 1641
288 Ga0495671_0000006 3300046692 Bacteria 500471
289 Ga0495649_0010031 3300046694 Bacteria 5600
290 Ga0495649_0014191 3300046694 Bacteria 4575
291 Ga0495589_0000152 3300046794 Bacteria 64153
292 Ga0495589_0000250 3300046794 Bacteria 43941
293 Ga0495589_0028596 3300046794 Bacteria 2812
294 Ga0495660_0000280 3300046810 Bacteria 47709
295 Ga0495660_0000288 3300046810 Bacteria 46688
296 Ga0495660_0001773 3300046810 Bacteria 14279
297 Ga0495660_0007194 3300046810 Bacteria 6553
298 Ga0495660_0020787 3300046810 Bacteria 3763
299 Ga0495660_0032910 3300046810 Bacteria 2910
300 Ga0495636_0051435 3300047318 Bacteria 1727
301 Ga0495672_0000030 3300047320 Bacteria 305021
302 Ga0495672_0000362 3300047320 Bacteria 58046
303 Ga0495672_0093300 3300047320 Bacteria 1648
304 Ga0495676_0000168 3300047321 Bacteria 50798
305 Ga0495676_0085477 3300047321 Bacteria 2376
306 Ga0495683_0000128 3300047323 Bacteria 75740
307 Ga0495683_0005900 3300047323 Bacteria 6728
308 Ga0495683_0015656 3300047323 Bacteria 3941
309 Ga0495683_0018648 3300047323 Bacteria 3585
310 Ga0495683_0025954 3300047323 Bacteria 3000
311 Ga0495687_000027 3300047443 Bacteria 299689
312 Ga0495687_000576 3300047443 Bacteria 43087
313 Ga0495677_0000001 3300047445 Bacteria 715000
314 Ga0495677_0001392 3300047445 Bacteria 9683
315 Ga0495677_0007081 3300047445 Bacteria 4198
316 Ga0495677_0015460 3300047445 Bacteria 2772
317 Ga0495679_000125 3300047446 Bacteria 68330
318 Ga0495679_018164 3300047446 Bacteria 2501
319 Ga0495685_006853 3300047447 Bacteria 3748
320 Ga0495673_0000003 3300047469 Bacteria 1491337
321 Ga0495673_0000050 3300047469 Bacteria 262267
322 Ga0495673_0000055 3300047469 Bacteria 247894
323 Ga0495673_0000136 3300047469 Bacteria 134839
324 Ga0495673_0005180 3300047469 Bacteria 7936
325 Ga0495681_0011347 3300047470 Bacteria 5312
326 Ga0495614_0000667 3300048089 Bacteria 14431
327 Ga0495626_0000037 3300048091 Bacteria 178573
328 Ga0495626_0000520 3300048091 Bacteria 38584
329 Ga0495626_0004492 3300048091 Bacteria 8547
330 Ga0496102_0000215 3300048905 Bacteria 76113
331 Ga0496103_0006822 3300048906 Bacteria 6815
332 Ga0496103_0061159 3300048906 Bacteria 2341
333 Ga0496109_0023615 3300048912 Bacteria 5459
334 Ga0496112_0138354 3300048915 Bacteria 2405
335 Ga0496113_0005748 3300048916 Bacteria 7771
336 Ga0496115_0026246 3300048918 Bacteria 4545
337 Ga0496115_0058343 3300048918 Bacteria 3106
338 Ga0496116_0047347 3300048919 Bacteria 2894
339 Ga0496116_0065179 3300048919 Bacteria 2338
340 Ga0496117_0000267 3300048920 Bacteria 98737
341 Ga0496117_0043194 3300048920 Bacteria 3280
342 Ga0496118_0000238 3300048921 Bacteria 96987
343 Ga0496118_0012638 3300048921 Bacteria 8078
344 Ga0496118_0027925 3300048921 Bacteria 4766
345 Ga0496119_0002626 3300048922 Bacteria 19506
346 Ga0496119_0006886 3300048922 Bacteria 10374
347 Ga0496120_0000374 3300048923 Bacteria 72781
348 Ga0496120_0000760 3300048923 Bacteria 46714
349 Ga0496120_0007007 3300048923 Bacteria 8477
350 Ga0496120_0018554 3300048923 Bacteria 4479
351 Ga0496120_0128478 3300048923 Bacteria 1301
352 Ga0496121_0001878 3300048924 Bacteria 33739
353 Ga0496121_0006182 3300048924 Bacteria 15016
354 Ga0496121_0007418 3300048924 Bacteria 13251
355 Ga0496122_0000016 3300048925 Bacteria 443353
356 Ga0496122_0000289 3300048925 Bacteria 111591
357 Ga0496122_0001749 3300048925 Bacteria 33464
358 Ga0496122_0011751 3300048925 Bacteria 8821
359 Ga0496122_0019444 3300048925 Bacteria 6202
360 Ga0496122_0032610 3300048925 Bacteria 4303
361 Ga0496122_0055313 3300048925 Bacteria 2970
362 Ga0496123_0000017 3300048926 Bacteria 415261
363 Ga0496123_0001412 3300048926 Bacteria 33573
364 Ga0496123_0003640 3300048926 Bacteria 17044
365 Ga0496123_0003952 3300048926 Bacteria 16068
366 Ga0496123_0006820 3300048926 Bacteria 10960
367 Ga0496123_0036775 3300048926 Bacteria 3464
368 Ga0496123_0053505 3300048926 Bacteria 2667
369 Ga0496124_0000039 3300048927 Bacteria 307831
370 Ga0496124_0002044 3300048927 Bacteria 27417
371 Ga0496124_0030024 3300048927 Bacteria 4833
372 Ga0496124_0079554 3300048927 Bacteria 2699
373 Ga0496124_0162300 3300048927 Bacteria 1740
374 Ga0496125_0002401 3300048928 Bacteria 24385
375 Ga0496125_0002537 3300048928 Bacteria 23538
376 Ga0496125_0120815 3300048928 Bacteria 1869
377 Ga0496126_0000342 3300048929 Bacteria 97993
378 Ga0496126_0002211 3300048929 Bacteria 26943
379 Ga0496126_0073691 3300048929 Bacteria 3034
380 Ga0495678_000002 3300049459 Bacteria 999613
381 Ga0495678_000040 3300049459 Bacteria 190664
382 Ga0495678_004713 3300049459 Bacteria 7792
383 Ga0501047_0100096 3300049581 Bacteria 2778
384 Ga0501269_000057 3300049766 Bacteria 34570
385 nmdc:mga00v17_143916_c1 3300050491 Bacteria 1530
386 nmdc:mga05p37_17406_c1 3300050507 Bacteria 8673
387 nmdc:mga05p37_291948_c1 3300050507 Bacteria 1941
388 nmdc:mga05p37_412067_c1 3300050507 Bacteria 1575
389 nmdc:mga09592_3521_c1 3300050508 Bacteria 12651
390 nmdc:mga09592_36634_c1 3300050508 Unclassified 4109
391 nmdc:mga08y16_6529_c1 3300050511 Bacteria 12228
392 nmdc:mga0rr50_66102_c1 3300050513 Bacteria 2742
393 nmdc:mga08x19_138471_c1 3300050514 Bacteria 1642
394 nmdc:mga0a205_31098_c2 3300050515 Bacteria 4434
395 nmdc:mga0a205_43270_c1 3300050515 Bacteria 4343
396 nmdc:mga0a205_61652_c1 3300050515 Bacteria 3623
397 nmdc:mga0a205_89014_c1 3300050515 Bacteria 2984
398 Ga0500594_0023239 3300053118 Bacteria 1570
399 Ga0500618_000030 3300053125 Bacteria 129574
400 Ga0500586_000942 3300053145 Bacteria 5987
401 Ga0500586_002383 3300053145 Bacteria 4228
402 Ga0466962_0040011 3300061719 Bacteria 2245
403 2547696050 2547132181 Bacteria 4945084
404 2555258840 2554235234 Bacteria 5762085
405 2562464569 2561511199 Bacteria 5155034
406 2603700856 2602042066 Bacteria 4423871
407 2603701203 2602042066 Bacteria 4423871
408 2603865656 2602042109 Bacteria 5152801
409 2637223209 2636415599 Bacteria 5718434
410 2649118589 2648501241 Bacteria 5312320
411 2649119057 2648501241 Bacteria 5312320
412 2652973889 2651869818 Bacteria 5864031
413 2652975662 2651869818 Bacteria 5864031
414 2656275862 2654587920 Bacteria 5475511
415 2671104602 2667528172 Bacteria 5170840
416 2682008156 2681812869 Bacteria 5014465
417 2738828452 2738541297 Bacteria 6549566
418 2739152248 2738541357 Bacteria 6549408
419 2739193731 2738543003 Bacteria 6549560
420 2739320644 2738543026 Bacteria 6549408
421 2739338448 2738543029 Bacteria 6549249
422 2739350175 2738543031 Bacteria 5769731
423 2765590783 2765235842 Bacteria 4799256
424 2772437662 2772190666 Bacteria 5117644
425 2777019519 2775507074 Bacteria 5532402
426 2792312635 2791355010 Bacteria 4864581
427 2809143067 2808606418 Bacteria 6724496
428 2821132242 2821131069 Bacteria 6108407
429 2823376544 2823373977 Bacteria 4779415
430 2842712435 2842711865 Bacteria 7155354
431 2857562825 2857558681 Bacteria 6617694
432 2857569970 2857564685 Bacteria 6290584
433 2881645656 2881644220 Bacteria 5302661
434 2891671614 2891670763 Bacteria 4967099
435 2898907809 2898907183 Bacteria 4067722
436 2904425011 2904424332 Bacteria 7633521
437 2904517110 2904513164 Bacteria 5476410
438 2916975981 2916971899 Bacteria 4250608
439 2919113407 2919108558 Bacteria 5897419
440 2919477752 2919476304 Bacteria 5888696
441 2923636346 2923634449 Bacteria 4753480
442 2936365642 2936361878 Bacteria 5632809
443 2937969476 2937967321 Bacteria 5094075
444 2939572357 2939568625 Bacteria 4542555
445 2939604547 2939602548 Bacteria 4950493
446 2939610504 2939607340 Bacteria 4719256
447 2939645562 2939642701 Bacteria 4475280
448 2969080227 2969079654 Bacteria 5439582
449 2971821599 2971820967 Bacteria 5823634
450 2974314989 2974310843 Bacteria 4947816
451 2984562683 2984559226 Bacteria 5683096
452 2984577555 2984576629 Bacteria 4248407
453 2984600743 2984595703 Bacteria 5682994
454 2990259716 2990256926 Bacteria 4252839
455 2990280511 2990275345 Bacteria 4887158
456 3001896220 3001892409 Bacteria 6328293
457 3001896526 3001892409 Bacteria 6328293
458 3006987234 3006984091 Bacteria 4207523
459 8018224316 8018221730 Bacteria 4616064
460 8018225654 8018221730 Bacteria 4616064
461 8018407021 8018405270 Bacteria 4978981
462 8054848242 8054844752 Bacteria 4450330
463 8055089590 8055087960 Bacteria 4784273
464 8055095924 8055092621 Bacteria 4873875
465 8055101674 8055097453 Bacteria 4865496
466 8057306182 8057304971 Bacteria 4649742
467 8057636856 8057632132 Bacteria 4726859
468 Ga0495584_0024328
469 SwRhRL2b_contig_2888319
470 JGI25153J46596_10016510
471 rootL2_10064902
472 rootL2_10298934
473 Ga0006562J51391_1008382
474 Ga0055526_1000001
475 Ga0058692_1001128
476 Ga0065704_10000919
477 Ga0065715_10004065
478 Ga0070660_100007414
479 Ga0070692_10033060
480 Ga0070701_10037590
481 Ga0070708_100040573
482 Ga0070708_100413801
483 Ga0070706_100000008
484 Ga0070706_100000805
485 Ga0070706_100003138
486 Ga0070706_100171993
487 Ga0070707_100159959
488 Ga0070698_100088530
489 Ga0070698_100141934
490 Ga0070684_100070994
491 Ga0070697_100042083
492 Ga0070697_100058861
493 Ga0070697_100155607
494 Ga0070665_100000743
495 Ga0070665_100394597
496 Ga0068855_100005047
497 Ga0068857_100003577
498 Ga0068851_10018535
499 Ga0068862_100154637
500 Ga0081540_1011437
501 Ga0075364_10012505
502 Ga0075428_100009533
503 Ga0075428_100262777
504 Ga0075433_10024307
505 Ga0075433_10035613
506 Ga0075433_10119562
507 Ga0075433_10120094
508 Ga0075434_100072865
509 Ga0075434_100083592
510 Ga0075434_100084035
511 Ga0075429_100010469
512 Ga0075436_100048058
513 Ga0079104_1000495
514 Ga0079104_1001641
515 Ga0079104_1001726
516 Ga0079104_1010394
517 Ga0105251_10001434
518 Ga0105251_10003623
519 Ga0105251_10012692
520 Ga0105251_10052107
521 Ga0105251_10067406
522 Ga0105244_10002356
523 Ga0105244_10003019
524 Ga0105244_10010000
525 Ga0105250_10000602
526 Ga0111539_10007555
527 Ga0111539_10114088
528 Ga0114129_10001061
529 Ga0114129_10002869
530 Ga0114129_10055674
531 Ga0114129_10059311
532 Ga0114129_10098114
533 Ga0105243_10198737
534 Ga0105243_10297576
535 Ga0157373_10046784
536 Ga0157371_10000060
537 Ga0157371_10009635
538 Ga0157370_10175644
539 Ga0182006_1000008
540 Ga0182007_10020349
541 Ga0182005_1000008
542 Ga0163161_10205888
543 Ga0207425_1000081
544 Ga0209646_1000023
545 Ga0209025_1001632
546 Ga0209564_1000002
547 Ga0209758_1000640
548 Ga0207656_10022887
549 Ga0207696_1000821
550 Ga0207696_1004753
551 Ga0207696_1040089
552 Ga0207655_1000065
553 Ga0207655_1000956
554 Ga0207655_1001886
555 Ga0207655_1010206
556 Ga0207655_1038235
557 Ga0207713_1000019
558 Ga0207713_1000033
559 Ga0207713_1012900
560 Ga0207713_1027226
561 Ga0207713_1040076
562 Ga0207713_1044822
563 Ga0207684_10000029
564 Ga0207684_10000294
565 Ga0207684_10009779
566 Ga0207684_10012851
567 Ga0207684_10017936
568 Ga0207660_10014890
569 Ga0207662_10015574
570 Ga0207657_10038322
571 Ga0207646_10000004
572 Ga0207646_10137885
573 Ga0207667_10143379
574 Ga0207674_10007812
575 Ga0209281_1000025
576 Ga0209281_1000089
577 Ga0209281_1000559
578 Ga0209281_1000768
579 Ga0209281_1001450
580 Ga0209281_1003887
581 Ga0209371_1000701
582 Ga0209371_1001352
583 Ga0209371_1007752
584 Ga0209371_1013787
585 Ga0207428_10005246
586 Ga0268266_10000041
587 Ga0268266_10064513
588 Ga0268265_10088635
589 Ga0268256_1000709
590 Ga0268256_1000945
591 Ga0268256_1001840
592 Ga0268256_1007998
593 Ga0268256_1015288
594 Ga0316181_1128690
595 Ga0316576_10020246
596 Ga0316578_10000134
597 Ga0316578_10042339
598 Ga0316577_10012271
599 Ga0316585_10020839
600 Ga0316596_1001274
601 Ga0316584_0000268
602 Ga0395899_0000012
603 Ga0395899_0005008
604 Ga0395900_0004365
605 Ga0395900_0092922
606 Ga0395900_0104210
607 Ga0400483_093469
608 Ga0439438_000245
609 Ga0439448_0000435
610 Ga0439452_000272
611 Ga0439452_000415
612 Ga0439452_003757
613 Ga0450902_003953
614 Ga0439464_0001001
615 Ga0466972_0043046
616 Ga0466961_0120026
617 Ga0466957_0097320
618 Ga0466959_0063864
619 Ga0466959_0095848
620 Ga0495617_000018
621 Ga0495617_015023
622 Ga0495627_000001
623 Ga0495627_009357
624 Ga0495603_0125970
625 Ga0495590_0000002
626 Ga0495591_022105
627 Ga0495638_0000030
628 Ga0495653_0000009
629 Ga0495653_0016567
630 Ga0495653_0023804
631 Ga0495650_0000040
632 Ga0495650_0000067
633 Ga0495650_0000170
634 Ga0495650_0000240
635 Ga0495650_0000882
636 Ga0495650_0003000
637 Ga0495650_0028964
638 Ga0495582_0167962
639 Ga0495605_0000023
640 Ga0495605_0000179
641 Ga0495605_0008579
642 Ga0495605_0020439
643 Ga0495584_0000001
644 Ga0495584_0000552
645 Ga0495584_0008798
646 Ga0495584_0084060
647 Ga0495585_0000003
648 Ga0495585_0000011
649 Ga0495585_0000261
650 Ga0495585_0000501
651 Ga0495585_0001969
652 Ga0495585_0016722
653 Ga0495585_0027027
654 Ga0495585_0088911
655 Ga0495594_0000553
656 Ga0495594_0025181
657 Ga0495596_0000923
658 Ga0495596_0001046
659 Ga0495596_0001421
660 Ga0495596_0069007
661 Ga0495607_0008000
662 Ga0495607_0018281
663 Ga0495607_0019244
664 Ga0495607_0027284
665 Ga0495607_0049062
666 Ga0495607_0067543
667 Ga0495583_0000048
668 Ga0495583_0000408
669 Ga0495583_0051319
670 Ga0495606_0000006
671 Ga0495606_0000397
672 Ga0495606_0000460
673 Ga0495606_0007089
674 Ga0495606_0133128
675 Ga0495610_0000012
676 Ga0495610_0004059
677 Ga0495610_0007300
678 Ga0495610_0013165
679 Ga0495610_0030497
680 Ga0495616_0000260
681 Ga0495616_0000426
682 Ga0495616_0029682
683 Ga0495616_0143036
684 Ga0495631_0010982
685 Ga0495631_0013259
686 Ga0495631_0019453
687 Ga0495632_0000044
688 Ga0495632_0013468
689 Ga0495637_0000144
690 Ga0495637_0003983
691 Ga0495643_0000051
692 Ga0495643_0000076
693 Ga0495643_0037841
694 Ga0495644_0005096
695 Ga0495644_0013126
696 Ga0495648_0000009
697 Ga0495648_0000011
698 Ga0495648_0001201
699 Ga0495648_0009253
700 Ga0495648_0012002
701 Ga0495648_0055585
702 Ga0495663_0007739
703 Ga0495666_0000230
704 Ga0495642_0000757
705 Ga0495642_0002893
706 Ga0495642_0006056
707 Ga0495642_0025818
708 Ga0495642_0049101
709 Ga0495654_0000011
710 Ga0495654_0041668
711 Ga0495665_0027649
712 Ga0495609_0000001
713 Ga0495609_0003703
714 Ga0495609_0006335
715 Ga0495609_0006907
716 Ga0495609_0051156
717 Ga0495597_0000212
718 Ga0495597_0001656
719 Ga0495597_0009125
720 Ga0495597_0021239
721 Ga0495622_0000279
722 Ga0495622_0014223
723 Ga0495633_0000093
724 Ga0495633_0000198
725 Ga0495633_0001843
726 Ga0495656_0006248
727 Ga0495656_0013647
728 Ga0495668_0000709
729 Ga0495668_0001092
730 Ga0495668_0004056
731 Ga0495668_0009015
732 Ga0495668_0050509
733 Ga0495611_0019498
734 Ga0495625_0000075
735 Ga0495625_0001667
736 Ga0495625_0013470
737 Ga0495625_0018693
738 Ga0495625_0070760
739 Ga0495661_0000206
740 Ga0495661_0000671
741 Ga0495661_0005374
742 Ga0495661_0025618
743 Ga0495661_0034697
744 Ga0495661_0037056
745 Ga0495588_0002836
746 Ga0495588_0019273
747 Ga0495588_0034775
748 Ga0495588_0106899
749 Ga0495623_0022569
750 Ga0495669_0000158
751 Ga0495613_0034992
752 Ga0495670_0000153
753 Ga0495670_0041651
754 Ga0495670_0082299
755 Ga0495671_0000006
756 Ga0495649_0010031
757 Ga0495649_0014191
758 Ga0495589_0000152
759 Ga0495589_0000250
760 Ga0495589_0028596
761 Ga0495660_0000280
762 Ga0495660_0000288
763 Ga0495660_0001773
764 Ga0495660_0007194
765 Ga0495660_0020787
766 Ga0495660_0032910
767 Ga0495636_0051435
768 Ga0495672_0000030
769 Ga0495672_0000362
770 Ga0495672_0093300
771 Ga0495676_0000168
772 Ga0495676_0085477
773 Ga0495683_0000128
774 Ga0495683_0005900
775 Ga0495683_0015656
776 Ga0495683_0018648
777 Ga0495683_0025954
778 Ga0495687_000027
779 Ga0495687_000576
780 Ga0495677_0000001
781 Ga0495677_0001392
782 Ga0495677_0007081
783 Ga0495677_0015460
784 Ga0495679_000125
785 Ga0495679_018164
786 Ga0495685_006853
787 Ga0495673_0000003
788 Ga0495673_0000050
789 Ga0495673_0000055
790 Ga0495673_0000136
791 Ga0495673_0005180
792 Ga0495681_0011347
793 Ga0495614_0000667
794 Ga0495626_0000037
795 Ga0495626_0000520
796 Ga0495626_0004492
797 Ga0496102_0000215
798 Ga0496103_0006822
799 Ga0496103_0061159
800 Ga0496109_0023615
801 Ga0496112_0138354
802 Ga0496113_0005748
803 Ga0496115_0026246
804 Ga0496115_0058343
805 Ga0496116_0047347
806 Ga0496116_0065179
807 Ga0496117_0000267
808 Ga0496117_0043194
809 Ga0496118_0000238
810 Ga0496118_0012638
811 Ga0496118_0027925
812 Ga0496119_0002626
813 Ga0496119_0006886
814 Ga0496120_0000374
815 Ga0496120_0000760
816 Ga0496120_0007007
817 Ga0496120_0018554
818 Ga0496120_0128478
819 Ga0496121_0001878
820 Ga0496121_0006182
821 Ga0496121_0007418
822 Ga0496122_0000016
823 Ga0496122_0000289
824 Ga0496122_0001749
825 Ga0496122_0011751
826 Ga0496122_0019444
827 Ga0496122_0032610
828 Ga0496122_0055313
829 Ga0496123_0000017
830 Ga0496123_0001412
831 Ga0496123_0003640
832 Ga0496123_0003952
833 Ga0496123_0006820
834 Ga0496123_0036775
835 Ga0496123_0053505
836 Ga0496124_0000039
837 Ga0496124_0002044
838 Ga0496124_0030024
839 Ga0496124_0079554
840 Ga0496124_0162300
841 Ga0496125_0002401
842 Ga0496125_0002537
843 Ga0496125_0120815
844 Ga0496126_0000342
845 Ga0496126_0002211
846 Ga0496126_0073691
847 Ga0495678_000002
848 Ga0495678_000040
849 Ga0495678_004713
850 Ga0501047_0100096
851 Ga0501269_000057
852 nmdc:mga00v17_143916_c1
853 nmdc:mga05p37_17406_c1
854 nmdc:mga05p37_291948_c1
855 nmdc:mga05p37_412067_c1
856 nmdc:mga09592_3521_c1
857 nmdc:mga09592_36634_c1
858 nmdc:mga08y16_6529_c1
859 nmdc:mga0rr50_66102_c1
860 nmdc:mga08x19_138471_c1
861 nmdc:mga0a205_31098_c2
862 nmdc:mga0a205_43270_c1
863 nmdc:mga0a205_61652_c1
864 nmdc:mga0a205_89014_c1
865 Ga0500594_0023239
866 Ga0500618_000030
867 Ga0500586_000942
868 Ga0500586_002383
869 Ga0466962_0040011
870 2547696050
871 2555258840
872 2562464569
873 2603700856
874 2603701203
875 2603865656
876 2637223209
877 2649118589
878 2649119057
879 2652973889
880 2652975662
881 2656275862
882 2671104602
883 2682008156
884 2738828452
885 2739152248
886 2739193731
887 2739320644
888 2739338448
889 2739350175
890 2765590783
891 2772437662
892 2777019519
893 2792312635
894 2809143067
895 2821132242
896 2823376544
897 2842712435
898 2857562825
899 2857569970
900 2881645656
901 2891671614
902 2898907809
903 2904425011
904 2904517110
905 2916975981
906 2919113407
907 2919477752
908 2923636346
909 2936365642
910 2937969476
911 2939572357
912 2939604547
913 2939610504
914 2939645562
915 2969080227
916 2971821599
917 2974314989
918 2984562683
919 2984577555
920 2984600743
921 2990259716
922 2990280511
923 3001896220
924 3001896526
925 3006987234
926 8018224316
927 8018225654
928 8018407021
929 8054848242
930 8055089590
931 8055095924
932 8055101674
933 8057306182
934 8057636856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02595

Gly_kinase

Glycerate kinase family

3

374

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cwc-assembly1.cif.gz_B crystal structure of putative glycerate kinase 2 from salmonella typhimurium lt2 0.9465 1 378
3cwc-assembly1.cif.gz_A crystal structure of putative glycerate kinase 2 from salmonella typhimurium lt2 0.9461 1 377
3cwc-assembly1.cif.gz_B crystal structure of putative glycerate kinase 2 from salmonella typhimurium lt2 0.9366 1 378
3cwc-assembly1.cif.gz_A crystal structure of putative glycerate kinase 2 from salmonella typhimurium lt2 0.9336 1 377
1to6-assembly1.cif.gz_A glycerate kinase from neisseria meningitidis (serogroup a) 0.8311 1 373
ID Description Score Start End Superfamily
af_P23524_42_266_3.90.1510.10 Alpha Beta;Alpha-Beta Complex;Glycerate kinase, domain 2;Glycerate kinase, domain 2 1.001 42 266 3.90.1510.10
af_P23524_267_371_3.40.50.10350 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase; domain 1 0.9997 267 370 3.40.50.10350
af_P23524_42_266_3.90.1510.10 Alpha Beta;Alpha-Beta Complex;Glycerate kinase, domain 2;Glycerate kinase, domain 2 0.9968 42 266 3.90.1510.10
af_Q2FVI7_272_379_3.40.50.10350 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase; domain 1 0.9871 269 374 3.40.50.10350
af_P77364_2_91_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.983 4 86 3.30.360.10
ID Description Score Start End GO Terms
AF-X1NWP4-F1-model_v4 Glycerate kinase 0.998 61 263 GO:0008887
GO:0031388
AF-A0A377K058-F1-model_v4 Glycerate kinase (EC 2.7.1.31) 0.9978 53 222 GO:0008887
GO:0031388
AF-A0A6L7EFG3-F1-model_v4 deleted 0.9977 81 230
AF-A0A6M1I304-F1-model_v4 deleted 0.9951 77 226
AF-A0A0B8P2P2-F1-model_v4 Glycerate kinase (EC 2.7.1.31) 0.9939 274 373 GO:0008887
GO:0031388

Map