F449902

General Info

Members Datasets Scaffolds Average Seq Length
467 335 934 144

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0200998|Ga0495609_0200998_361_801
Length 140
Sequence MSTIQTKDRFQSAISAGKPLRLGLWLAQIAAAGLFGMSGVMKLTTPIPELSAMMPWTGEVSPIFVRMIGLIDLAGGLGLILPSLTRVVAAMWCIVLQVLAAGFHAFRGEFAVLPLNAVLLGLVVFIAWGRSKKAPIAPRR

Samples

Sample ID Description Type Environment
1 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
119 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
247 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
260 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
272 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
273 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
277 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
278 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
279 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
280 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
281 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
282 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
283 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
284 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
285 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
286 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
287 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
288 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
289 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
290 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
291 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
292 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
293 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
294 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
295 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
296 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
297 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
298 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
299 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
300 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
301 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
302 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
303 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
304 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
305 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
306 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
307 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
308 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
309 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
310 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
311 2922368715
312 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
313 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
314 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
315 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
316 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
317 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
318 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
319 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
320 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
321 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
322 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
323 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
324 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
325 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
326 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
327 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
328 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
329 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
330 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
331 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
332 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
333 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
334 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
335 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.77
Metatranscriptomes 0
Isolates 12.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.27
Nodule 9.64
Rhizoplane 5.57
Rhizosphere 42.83
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495609_0200998 3300046538 Bacteria 833
2 JGI25165J46597_1004376 3300003214 Bacteria 3057
3 JGI25153J46596_10006379 3300003215 Bacteria 5980
4 JGI25153J46596_10010200 3300003215 Bacteria 4272
5 JGI25153J46596_10043969 3300003215 Bacteria 1347
6 JGI25153J46596_10133236 3300003215 Bacteria 548
7 JGI25153J46596_10135114 3300003215 Bacteria 542
8 JGI25153J46596_10135296 3300003215 Bacteria 542
9 rootH1_10079211 3300003316 Bacteria 1491
10 rootL2_10206084 3300003322 Bacteria 1251
11 rootH1_10266041 3300003323 Bacteria 1001
12 JGI25160J50197_1000955 3300003354 Bacteria 15154
13 JGI25160J50197_1004203 3300003354 Bacteria 6256
14 Ga0055539_1004109 3300003752 Bacteria 1961
15 Ga0055525_1007230 3300003759 Bacteria 938
16 Ga0055526_1017424 3300003771 Bacteria 2743
17 Ga0055530_10001494 3300003791 Bacteria 16973
18 Ga0055540_1000045 3300003792 Bacteria 152083
19 Ga0055531_10000062 3300003794 Bacteria 120504
20 Ga0055531_10111547 3300003794 Bacteria 545
21 Ga0055543_1002750 3300004625 Bacteria 5592
22 Ga0065165_1001735 3300005262 Bacteria 21799
23 Ga0065165_1125971 3300005262 Bacteria 617
24 Ga0070670_100325846 3300005331 Bacteria 1346
25 Ga0070666_10756895 3300005335 Bacteria 714
26 Ga0068868_100578464 3300005338 Bacteria 993
27 Ga0070669_100672694 3300005353 Bacteria 872
28 Ga0070675_101170147 3300005354 Bacteria 708
29 Ga0070671_100036131 3300005355 Bacteria 4096
30 Ga0070674_101246827 3300005356 Bacteria 661
31 Ga0070659_100848940 3300005366 Bacteria 796
32 Ga0070708_100162149 3300005445 Bacteria 2084
33 Ga0070663_100038725 3300005455 Bacteria 3327
34 Ga0070678_100957887 3300005456 Bacteria 785
35 Ga0070662_100425094 3300005457 Bacteria 1100
36 Ga0070662_100674444 3300005457 Bacteria 873
37 Ga0068867_101379108 3300005459 Bacteria 653
38 Ga0070706_100000388 3300005467 Bacteria 52771
39 Ga0070707_100071369 3300005468 Bacteria 3346
40 Ga0070698_100250786 3300005471 Bacteria 1703
41 Ga0070699_100221696 3300005518 Bacteria 1685
42 Ga0070672_100668081 3300005543 Bacteria 908
43 Ga0070665_100117210 3300005548 Bacteria 2666
44 Ga0070665_100790730 3300005548 Bacteria 962
45 Ga0070665_100997854 3300005548 Bacteria 849
46 Ga0070665_101247892 3300005548 Bacteria 754
47 Ga0068855_102012535 3300005563 Bacteria 583
48 Ga0068854_100070508 3300005578 Bacteria 2554
49 Ga0068856_100047652 3300005614 Bacteria 4222
50 Ga0068852_100009329 3300005616 Bacteria 7281
51 Ga0068859_101163199 3300005617 Bacteria 849
52 Ga0068861_100027756 3300005719 Bacteria 4127
53 Ga0068858_101374621 3300005842 Bacteria 695
54 Ga0068860_100001474 3300005843 Bacteria 25421
55 Ga0068862_100013475 3300005844 Bacteria 6769
56 Ga0068862_101520333 3300005844 Bacteria 675
57 Ga0075365_10101796 3300006038 Bacteria 1967
58 Ga0075365_10299336 3300006038 Bacteria 1132
59 Ga0075368_10469498 3300006042 Bacteria 559
60 Ga0075363_100188342 3300006048 Bacteria 1176
61 Ga0075364_10018240 3300006051 Bacteria 4392
62 Ga0075364_10321519 3300006051 Bacteria 1053
63 Ga0075362_10185990 3300006177 Bacteria 1008
64 Ga0075367_10051839 3300006178 Bacteria 2427
65 Ga0075367_10084374 3300006178 Bacteria 1926
66 Ga0075367_10916188 3300006178 Bacteria 559
67 Ga0075367_11041699 3300006178 Bacteria 523
68 Ga0075369_10036333 3300006186 Bacteria 2096
69 Ga0075369_10230373 3300006186 Bacteria 858
70 Ga0075366_10000186 3300006195 Bacteria 27357
71 Ga0075366_10032521 3300006195 Bacteria 3070
72 Ga0075366_10052968 3300006195 Bacteria 2410
73 Ga0075366_10103111 3300006195 Bacteria 1713
74 Ga0075366_10632949 3300006195 Bacteria 663
75 Ga0075370_10031513 3300006353 Bacteria 2960
76 Ga0075370_10104511 3300006353 Bacteria 1641
77 Ga0097620_101163307 3300006931 Bacteria 849
78 Ga0099825_1028597 3300006941 Bacteria 2690
79 Ga0099823_1047852 3300006944 Bacteria 2745
80 Ga0099826_10035115 3300006948 Bacteria 3570
81 Ga0105240_11003110 3300009093 Bacteria 893
82 Ga0105240_11280324 3300009093 Bacteria 774
83 Ga0111539_11272305 3300009094 Bacteria 854
84 Ga0105245_10018634 3300009098 Bacteria 6070
85 Ga0105245_10507066 3300009098 Bacteria 1223
86 Ga0105247_10032496 3300009101 Bacteria 3171
87 Ga0105247_10093571 3300009101 Bacteria 1911
88 Ga0105243_10044514 3300009148 Bacteria 3483
89 Ga0105241_10003792 3300009174 Bacteria 11210
90 Ga0105241_10037000 3300009174 Bacteria 3675
91 Ga0105248_10195947 3300009177 Bacteria 2276
92 Ga0105237_10012663 3300009545 Bacteria 8878
93 Ga0105237_10079948 3300009545 Bacteria 3259
94 Ga0105237_10723473 3300009545 Bacteria 1002
95 Ga0105238_10018315 3300009551 Bacteria 7126
96 Ga0105238_10060577 3300009551 Bacteria 3789
97 Ga0105249_10033865 3300009553 Bacteria 4627
98 Ga0105239_10128431 3300010375 Bacteria 2818
99 Ga0105239_10224913 3300010375 Bacteria 2105
100 Ga0105239_10484497 3300010375 Bacteria 1405
101 Ga0105239_10657408 3300010375 Bacteria 1197
102 Ga0105239_10769509 3300010375 Bacteria 1102
103 Ga0105246_10020604 3300011119 Bacteria 4231
104 Ga0157313_1015678 3300012503 Bacteria 715
105 Ga0157374_10026771 3300013296 Bacteria 5192
106 Ga0157378_12095411 3300013297 Unclassified 616
107 Ga0163162_10497338 3300013306 Bacteria 1350
108 Ga0163163_10039967 3300014325 Bacteria 4579
109 Ga0157379_10160315 3300014968 Bacteria 2030
110 Ga0157376_10245640 3300014969 Bacteria 1669
111 Ga0182007_10096150 3300015262 Bacteria 978
112 Ga0209563_102487 3300025230 Bacteria 4147
113 Ga0209677_100366 3300025253 Bacteria 27688
114 Ga0209148_1000469 3300025254 Bacteria 43128
115 Ga0209759_1000948 3300025256 Bacteria 20815
116 Ga0209233_1012967 3300025261 Bacteria 2397
117 Ga0209455_1005428 3300025272 Bacteria 3941
118 Ga0209455_1005690 3300025272 Bacteria 3801
119 Ga0209676_1000135 3300025292 Bacteria 182756
120 Ga0209564_1007974 3300025295 Bacteria 5327
121 Ga0209758_1001668 3300025297 Bacteria 25107
122 Ga0209758_1015906 3300025297 Bacteria 3863
123 Ga0209758_1027283 3300025297 Bacteria 2444
124 Ga0209758_1028200 3300025297 Bacteria 2381
125 Ga0209758_1048249 3300025297 Bacteria 1515
126 Ga0209758_1078232 3300025297 Bacteria 1011
127 Ga0209758_1127625 3300025297 Bacteria 677
128 Ga0209050_1000100 3300025298 Bacteria 231385
129 Ga0209256_1016850 3300025299 Bacteria 2463
130 Ga0207426_1000347 3300025302 Bacteria 85420
131 Ga0207426_1026583 3300025302 Bacteria 1936
132 Ga0207426_1085785 3300025302 Bacteria 844
133 Ga0209051_1000067 3300025303 Bacteria 227181
134 Ga0209257_1000095 3300025304 Bacteria 259437
135 Ga0209257_1004512 3300025304 Bacteria 10712
136 Ga0209257_1047379 3300025304 Bacteria 1236
137 Ga0207710_10296745 3300025900 Bacteria 816
138 Ga0207688_10195899 3300025901 Bacteria 1210
139 Ga0207647_10001188 3300025904 Bacteria 20058
140 Ga0207647_10171933 3300025904 Bacteria 1261
141 Ga0207684_10001941 3300025910 Bacteria 21443
142 Ga0207654_10043172 3300025911 Bacteria 2555
143 Ga0207654_10086622 3300025911 Bacteria 1899
144 Ga0207695_10000006 3300025913 Bacteria 1135309
145 Ga0207695_11226208 3300025913 Bacteria 630
146 Ga0207671_10064833 3300025914 Bacteria 2716
147 Ga0207671_10142395 3300025914 Bacteria 1848
148 Ga0207671_10659740 3300025914 Bacteria 833
149 Ga0207649_11563113 3300025920 Bacteria 522
150 Ga0207694_10030985 3300025924 Bacteria 4085
151 Ga0207659_10378077 3300025926 Bacteria 1181
152 Ga0207687_10309031 3300025927 Bacteria 1276
153 Ga0207690_10449262 3300025932 Bacteria 1036
154 Ga0207706_10329286 3300025933 Bacteria 1329
155 Ga0207706_11064747 3300025933 Bacteria 677
156 Ga0207709_10236989 3300025935 Bacteria 1325
157 Ga0207667_12140083 3300025949 Bacteria 517
158 Ga0207712_10045365 3300025961 Bacteria 3043
159 Ga0207668_11334965 3300025972 Bacteria 646
160 Ga0207640_10347080 3300025981 Bacteria 1191
161 Ga0207658_10745305 3300025986 Bacteria 887
162 Ga0207677_10266785 3300026023 Bacteria 1398
163 Ga0207703_10440577 3300026035 Bacteria 1215
164 Ga0207639_10073398 3300026041 Bacteria 2682
165 Ga0207639_10091930 3300026041 Bacteria 2431
166 Ga0207678_10034820 3300026067 Bacteria 4385
167 Ga0207702_10068619 3300026078 Bacteria 3046
168 Ga0207675_100062483 3300026118 Bacteria 3478
169 Ga0207698_10165887 3300026142 Bacteria 1938
170 Ga0209389_1000015 3300027296 Bacteria 188311
171 Ga0209489_100072 3300027361 Bacteria 138111
172 Ga0209700_100034 3300027363 Bacteria 197276
173 Ga0268266_10025618 3300028379 Bacteria 5017
174 Ga0268266_10182439 3300028379 Bacteria 1912
175 Ga0268266_10580107 3300028379 Bacteria 1076
176 Ga0268266_11271463 3300028379 Bacteria 711
177 Ga0268265_10312994 3300028380 Bacteria 1418
178 Ga0268264_10000119 3300028381 Bacteria 192507
179 Ga0268264_10410656 3300028381 Bacteria 1303
180 Ga0265337_1035196 3300028556 Bacteria 1468
181 Ga0265319_1025028 3300028563 Bacteria 2140
182 Ga0265334_10002358 3300028573 Bacteria 8890
183 Ga0265323_10000434 3300028653 Bacteria 23913
184 Ga0265322_10023692 3300028654 Bacteria 1755
185 Ga0265336_10000649 3300028666 Bacteria 18964
186 Ga0265338_10000280 3300028800 Bacteria 91942
187 Ga0265324_10010204 3300029957 Bacteria 3632
188 Ga0307512_10025046 3300030522 Bacteria 5294
189 Ga0307513_10803842 3300031456 Bacteria 646
190 Ga0307508_10612604 3300031616 Bacteria 691
191 Ga0307516_10009299 3300031730 Bacteria 10981
192 Ga0307516_10023804 3300031730 Bacteria 6266
193 Ga0307507_10211764 3300033179 Unclassified 1320
194 Ga0307507_10488108 3300033179 Bacteria 668
195 Ga0307510_10007078 3300033180 Bacteria 13364
196 Ga0307510_10037765 3300033180 Bacteria 5353
197 Ga0307510_10328094 3300033180 Bacteria 986
198 Ga0307510_10431116 3300033180 Bacteria 760
199 Ga0395900_1546509 3300037418 Bacteria 575
200 Ga0436364_0914149 3300037853 Bacteria 1937
201 Ga0436365_0057994 3300039437 Bacteria 2545
202 Ga0436365_1646390 3300039437 Bacteria 581
203 Ga0436361_0644153 3300039447 Bacteria 1259
204 Ga0436361_0870621 3300039447 Bacteria 973
205 Ga0436361_0966806 3300039447 Bacteria 1322
206 Ga0451789_0436694 3300041443 Bacteria 1062
207 Ga0451791_1011064 3300041451 Unclassified 1400
208 Ga0451793_1873426 3300041452 Bacteria 999
209 Ga0451795_1305124 3300041456 Bacteria 587
210 Ga0451800_0578289 3300041459 Bacteria 1891
211 Ga0451802_1037132 3300041460 Unclassified 1811
212 Ga0451804_0039962 3300041463 Bacteria 981
213 Ga0451833_1128143 3300041491 Bacteria 2206
214 Ga0451839_0854493 3300041496 Bacteria 1774
215 Ga0451849_1366188 3300041505 Bacteria 1111
216 Ga0451855_1449691 3300041511 Bacteria 811
217 Ga0439448_0114339 3300042005 Bacteria 923
218 Ga0450919_000024 3300042121 Bacteria 12284
219 Ga0450918_000043 3300042531 Bacteria 25951
220 Ga0466969_0010417 3300044656 Bacteria 4928
221 Ga0466972_0018293 3300044658 Bacteria 3502
222 Ga0466972_0042011 3300044658 Bacteria 2224
223 Ga0466966_0000384 3300044684 Bacteria 28738
224 Ga0466966_0005799 3300044684 Bacteria 8144
225 Ga0466961_0000018 3300044693 Bacteria 109837
226 Ga0466961_0004929 3300044693 Bacteria 8391
227 Ga0466964_0002600 3300044706 Bacteria 6447
228 Ga0466970_0007978 3300044765 Bacteria 5317
229 Ga0466957_0004206 3300044842 Bacteria 7982
230 Ga0466960_0059765 3300044901 Bacteria 1866
231 Ga0466959_0016490 3300045049 Bacteria 5398
232 Ga0466959_0920987 3300045049 Bacteria 583
233 Ga0451576_0250380 3300045051 Bacteria 1851
234 Ga0466958_0009631 3300045836 Bacteria 5388
235 Ga0495592_0090183 3300046454 Bacteria 2200
236 Ga0495629_0002395 3300046459 Bacteria 14415
237 Ga0495651_0030158 3300046462 Bacteria 4229
238 Ga0495653_0085681 3300046463 Bacteria 2317
239 Ga0495650_0263707 3300046471 Bacteria 583
240 Ga0495639_0067451 3300046475 Bacteria 1648
241 Ga0495662_0339929 3300046476 Bacteria 738
242 Ga0495585_0073633 3300046492 Bacteria 1859
243 Ga0495594_0562502 3300046499 Bacteria 647
244 Ga0495583_0052130 3300046506 Bacteria 1863
245 Ga0495606_0035165 3300046507 Bacteria 3428
246 Ga0495606_0549621 3300046507 Bacteria 575
247 Ga0495608_0064887 3300046511 Bacteria 2392
248 Ga0495610_0078251 3300046512 Bacteria 1525
249 Ga0495610_0188214 3300046512 Unclassified 853
250 Ga0495610_0215226 3300046512 Bacteria 779
251 Ga0495616_0105062 3300046513 Bacteria 1319
252 Ga0495620_0012241 3300046515 Bacteria 4443
253 Ga0495632_0467001 3300046519 Bacteria 546
254 Ga0495643_0023056 3300046522 Bacteria 3542
255 Ga0495648_0016650 3300046524 Bacteria 5290
256 Ga0495648_0035423 3300046524 Bacteria 3236
257 Ga0495652_0039970 3300046529 Bacteria 4054
258 Ga0495665_0334220 3300046531 Bacteria 773
259 Ga0495640_0130007 3300046533 Bacteria 1630
260 Ga0495587_0085675 3300046536 Bacteria 1824
261 Ga0495622_0017931 3300046557 Bacteria 3296
262 Ga0495668_0054334 3300046616 Bacteria 2214
263 Ga0495634_0028288 3300046642 Bacteria 3892
264 Ga0495625_0029535 3300046660 Bacteria 4098
265 Ga0495635_0002322 3300046663 Bacteria 12926
266 Ga0495588_0107796 3300046674 Bacteria 1467
267 Ga0495657_0004282 3300046675 Bacteria 11395
268 Ga0495646_0050743 3300046680 Bacteria 2513
269 Ga0495613_0093220 3300046689 Bacteria 2180
270 Ga0495624_0519700 3300046690 Unclassified 712
271 Ga0495649_0033366 3300046694 Bacteria 2833
272 Ga0495649_0094202 3300046694 Bacteria 1594
273 Ga0495600_0007662 3300046809 Bacteria 6615
274 Ga0495660_0189044 3300046810 Bacteria 991
275 Ga0495581_0028971 3300047315 Bacteria 3211
276 Ga0495604_0172311 3300047317 Bacteria 1520
277 Ga0495672_0221081 3300047320 Bacteria 935
278 Ga0495676_0002485 3300047321 Bacteria 16404
279 Ga0495676_0008762 3300047321 Bacteria 9253
280 Ga0495683_0110173 3300047323 Unclassified 1315
281 Ga0495683_0210665 3300047323 Bacteria 872
282 Ga0495687_011887 3300047443 Bacteria 4648
283 Ga0495673_0210853 3300047469 Bacteria 723
284 Ga0495673_0326640 3300047469 Bacteria 545
285 Ga0495681_0011219 3300047470 Bacteria 5356
286 Ga0495686_0013950 3300047472 Bacteria 5556
287 Ga0495686_0014259 3300047472 Bacteria 5476
288 Ga0495686_0170507 3300047472 Bacteria 1266
289 Ga0495593_0034100 3300047673 Bacteria 2770
290 Ga0495593_0107916 3300047673 Bacteria 1423
291 Ga0495602_0075193 3300048088 Bacteria 2868
292 Ga0495614_0048541 3300048089 Bacteria 1820
293 Ga0495614_0187848 3300048089 Bacteria 931
294 Ga0496100_0119198 3300048903 Bacteria 1844
295 Ga0496101_0076533 3300048904 Bacteria 2465
296 Ga0496102_0354436 3300048905 Bacteria 1381
297 Ga0496103_0025651 3300048906 Bacteria 3564
298 Ga0496103_0744821 3300048906 Bacteria 620
299 Ga0496104_0013526 3300048907 Bacteria 7353
300 Ga0496104_0752340 3300048907 Bacteria 881
301 Ga0496105_0001000 3300048908 Bacteria 19533
302 Ga0496105_0037272 3300048908 Bacteria 4004
303 Ga0496108_0075572 3300048911 Bacteria 2847
304 Ga0496108_0166805 3300048911 Bacteria 1904
305 Ga0496110_0482430 3300048913 Bacteria 1129
306 Ga0496111_0045594 3300048914 Bacteria 3155
307 Ga0496112_0067802 3300048915 Bacteria 3522
308 Ga0496112_0598563 3300048915 Bacteria 1034
309 Ga0496113_0044060 3300048916 Bacteria 3304
310 Ga0496113_0101767 3300048916 Bacteria 2227
311 Ga0496115_0060951 3300048918 Bacteria 3041
312 Ga0496115_0852999 3300048918 Bacteria 705
313 Ga0496118_0092585 3300048921 Bacteria 2074
314 Ga0496118_0131269 3300048921 Bacteria 1608
315 Ga0496119_0001056 3300048922 Bacteria 35138
316 Ga0496119_0008066 3300048922 Bacteria 9345
317 Ga0496119_0038425 3300048922 Bacteria 3093
318 Ga0496119_0150232 3300048922 Bacteria 1249
319 Ga0496120_0000170 3300048923 Bacteria 110378
320 Ga0496120_0044403 3300048923 Bacteria 2582
321 Ga0496121_0029944 3300048924 Bacteria 5014
322 Ga0496121_0157861 3300048924 Bacteria 1662
323 Ga0496121_0164237 3300048924 Bacteria 1620
324 Ga0496121_0204240 3300048924 Bacteria 1405
325 Ga0496121_0750642 3300048924 Bacteria 580
326 Ga0496122_0237123 3300048925 Bacteria 1032
327 Ga0496124_0014900 3300048927 Bacteria 7491
328 Ga0496124_0055707 3300048927 Bacteria 3340
329 Ga0496125_0050855 3300048928 Bacteria 3426
330 Ga0496125_0051080 3300048928 Bacteria 3414
331 Ga0496125_0058938 3300048928 Bacteria 3097
332 Ga0496125_0100760 3300048928 Bacteria 2128
333 Ga0496125_0487250 3300048928 Bacteria 697
334 Ga0496125_0741324 3300048928 Unclassified 516
335 Ga0496126_0007179 3300048929 Bacteria 12262
336 Ga0496126_0289752 3300048929 Bacteria 1354
337 Ga0496126_0608122 3300048929 Bacteria 860
338 Ga0495682_0020840 3300049460 Bacteria 2459
339 Ga0495682_0023121 3300049460 Bacteria 2322
340 nmdc:mga03683_277926_c1 3300050489 Bacteria 782
341 nmdc:mga03683_355811_c1 3300050489 Bacteria 694
342 nmdc:mga03n38_13016_c1 3300050490 Bacteria 3148
343 nmdc:mga00v17_22650_c1 3300050491 Bacteria 3627
344 nmdc:mga00v17_348945_c1 3300050491 Bacteria 962
345 nmdc:mga0yw44_380822_c1 3300050492 Bacteria 953
346 nmdc:mga0yw44_458706_c1 3300050492 Bacteria 864
347 nmdc:mga0k408_200454_c1 3300050493 Bacteria 1191
348 nmdc:mga0k408_366279_c1 3300050493 Bacteria 859
349 nmdc:mga0k408_414_c1 3300050493 Bacteria 23298
350 nmdc:mga0k408_48253_c1 3300050493 Bacteria 2462
351 nmdc:mga0k408_49389_c1 3300050493 Bacteria 2435
352 nmdc:mga06z11_377945_c1 3300050494 Bacteria 851
353 nmdc:mga06z11_402771_c1 3300050494 Bacteria 824
354 nmdc:mga06z11_750141_c1 3300050494 Bacteria 595
355 nmdc:mga06z11_916030_c1 3300050494 Bacteria 534
356 nmdc:mga07m45_430088_c1 3300050496 Bacteria 766
357 nmdc:mga07m45_44423_c1 3300050496 Bacteria 2494
358 nmdc:mga0sz30_19100_c1 3300050516 Bacteria 2173
359 nmdc:mga0sz30_33314_c1 3300050516 Bacteria 2141
360 nmdc:mga0sz30_594644_c1 3300050516 Bacteria 501
361 Ga0500610_0245673 3300053079 Bacteria 829
362 Ga0495619_0227708 3300053085 Bacteria 1291
363 Ga0500578_0009951 3300053086 Bacteria 6170
364 Ga0500578_0193935 3300053086 Bacteria 1246
365 Ga0500643_000018 3300053087 Bacteria 296505
366 Ga0500643_000328 3300053087 Bacteria 38149
367 Ga0500643_001321 3300053087 Bacteria 14552
368 Ga0500646_0049533 3300053090 Bacteria 1208
369 Ga0500647_0207388 3300053091 Bacteria 885
370 Ga0500583_0042294 3300053092 Bacteria 2075
371 Ga0500583_0250301 3300053092 Bacteria 875
372 Ga0500651_0207122 3300053093 Bacteria 1155
373 Ga0500640_186690 3300053095 Bacteria 743
374 Ga0500641_0027821 3300053096 Bacteria 2204
375 Ga0500650_0323298 3300053098 Bacteria 679
376 Ga0500555_021630 3300053103 Bacteria 1852
377 Ga0500556_0116774 3300053104 Bacteria 1038
378 Ga0500557_000019 3300053105 Bacteria 93216
379 Ga0500569_111757 3300053109 Bacteria 904
380 Ga0500572_001006 3300053111 Bacteria 8512
381 Ga0500595_034321 3300053119 Bacteria 1678
382 Ga0500595_036114 3300053119 Bacteria 1622
383 Ga0500597_214905 3300053120 Bacteria 802
384 Ga0500608_006938 3300053122 Bacteria 4652
385 Ga0500618_003502 3300053125 Bacteria 5353
386 Ga0500628_009614 3300053129 Bacteria 1709
387 Ga0500642_0000064 3300053130 Bacteria 58285
388 Ga0500642_0005550 3300053130 Bacteria 4079
389 Ga0500655_000085 3300053133 Bacteria 24719
390 Ga0500655_014819 3300053133 Bacteria 1428
391 Ga0500658_0016048 3300053134 Bacteria 2788
392 Ga0500559_0001342 3300053136 Bacteria 14123
393 Ga0500559_0011985 3300053136 Bacteria 3694
394 Ga0500574_000046 3300053141 Bacteria 14738
395 Ga0500588_0016716 3300053146 Bacteria 1903
396 Ga0500589_179892 3300053147 Bacteria 832
397 Ga0500622_0011980 3300053156 Bacteria 4714
398 Ga0500634_0000866 3300053161 Bacteria 10766
399 Ga0500638_018009 3300053162 Bacteria 3289
400 Ga0500638_110360 3300053162 Bacteria 1271
401 Ga0500639_004522 3300053163 Bacteria 7069
402 Ga0500639_080012 3300053163 Bacteria 1648
403 Ga0500636_0010450 3300053177 Bacteria 5416
404 Ga0500636_0160880 3300053177 Bacteria 1224
405 Ga0500636_0244148 3300053177 Bacteria 920
406 Ga0500637_0440585 3300053178 Bacteria 664
407 Ga0500576_001460 3300053725 Bacteria 7974
408 Ga0500625_012486 3300053729 Bacteria 3883
409 Ga0500596_002703 3300053735 Bacteria 3476
410 2508695950 2508501042 Bacteria 8719808
411 2511395790 2511231028 Bacteria 8046582
412 2513651771 2513237095 Bacteria 8976980
413 2513721998 2513237104 Bacteria 10034502
414 2513879252 2513237139 Bacteria 8737671
415 2517106551 2517093001 Bacteria 9002274
416 2528850687 2528768022 Bacteria 10457665
417 2587757063 2585428062 Bacteria 6842168
418 2745077759 2744054633 Bacteria 8678936
419 2793065774 2791355196 Bacteria 7323613
420 2805920323 2802429603 Bacteria 8777136
421 2818239323 2816332527 Bacteria 8933356
422 2824683625 2824679649 Bacteria 8248951
423 2824702411 2824696289 Bacteria 8335049
424 2824708013 2824704595 Bacteria 9667483
425 2824758388 2824753945 Bacteria 9787441
426 2824768910 2824763712 Bacteria 9792355
427 2841959087 2841957949 Bacteria 8652217
428 2841965690 2841957949 Bacteria 8652217
429 2842041472 2842038055 Bacteria 8002051
430 2842049514 2842045827 Bacteria 8006841
431 2844322655 2844315083 Bacteria 8138177
432 2847939849 2847930680 Bacteria 9342022
433 2874618657 2874612657 Bacteria 8252029
434 2874629246 2874628541 Bacteria 8630250
435 2876769815 2876761206 Bacteria 10111113
436 2879083591 2879083081 Bacteria 8587928
437 2888379044 2888378607 Bacteria 9652610
438 2888390222 2888388044 Bacteria 7304136
439 2903734830 2903727486 Bacteria 8281579
440 2904716073 2904711408 Bacteria 9771557
441 2906604859 2906602504 Bacteria 8295279
442 2906634476 2906626472 Bacteria 8826946
443 2922377929
444 2922400830 2922393267 Bacteria 8285685
445 2935649133 2935648319 Bacteria 8801166
446 2935658095 2935656913 Bacteria 8965014
447 2935686866 2935684952 Bacteria 9590419
448 2935716554 2935713505 Bacteria 9608509
449 2935723321 2935722832 Bacteria 9608746
450 2935734877 2935732158 Bacteria 9706831
451 2935744332 2935741537 Bacteria 9707219
452 2935752832 2935750917 Bacteria 9590372
453 2935767920 2935760218 Bacteria 9817913
454 2935779630 2935777560 Bacteria 8077691
455 2935985417 2935984226 Bacteria 8302647
456 2936012314 2936011229 Bacteria 8801034
457 2936020605 2936019824 Bacteria 8804134
458 2936029607 2936028420 Bacteria 8965941
459 2936051928 2936046547 Bacteria 8903709
460 2936056815 2936055302 Bacteria 8785755
461 2940558745 2940556831 Bacteria 9590747
462 3005602751 3005594810 Bacteria 8716512
463 3005725223 3005718088 Bacteria 8283608
464 8016606985 8016603502 Bacteria 8731218
465 8016618892 8016613128 Bacteria 8794220
466 8019540974 8019538911 Bacteria 7872763
467 8056976686 8056967851 Bacteria 9038162
468 Ga0495609_0200998
469 JGI25165J46597_1004376
470 JGI25153J46596_10006379
471 JGI25153J46596_10010200
472 JGI25153J46596_10043969
473 JGI25153J46596_10133236
474 JGI25153J46596_10135114
475 JGI25153J46596_10135296
476 rootH1_10079211
477 rootL2_10206084
478 rootH1_10266041
479 JGI25160J50197_1000955
480 JGI25160J50197_1004203
481 Ga0055539_1004109
482 Ga0055525_1007230
483 Ga0055526_1017424
484 Ga0055530_10001494
485 Ga0055540_1000045
486 Ga0055531_10000062
487 Ga0055531_10111547
488 Ga0055543_1002750
489 Ga0065165_1001735
490 Ga0065165_1125971
491 Ga0070670_100325846
492 Ga0070666_10756895
493 Ga0068868_100578464
494 Ga0070669_100672694
495 Ga0070675_101170147
496 Ga0070671_100036131
497 Ga0070674_101246827
498 Ga0070659_100848940
499 Ga0070708_100162149
500 Ga0070663_100038725
501 Ga0070678_100957887
502 Ga0070662_100425094
503 Ga0070662_100674444
504 Ga0068867_101379108
505 Ga0070706_100000388
506 Ga0070707_100071369
507 Ga0070698_100250786
508 Ga0070699_100221696
509 Ga0070672_100668081
510 Ga0070665_100117210
511 Ga0070665_100790730
512 Ga0070665_100997854
513 Ga0070665_101247892
514 Ga0068855_102012535
515 Ga0068854_100070508
516 Ga0068856_100047652
517 Ga0068852_100009329
518 Ga0068859_101163199
519 Ga0068861_100027756
520 Ga0068858_101374621
521 Ga0068860_100001474
522 Ga0068862_100013475
523 Ga0068862_101520333
524 Ga0075365_10101796
525 Ga0075365_10299336
526 Ga0075368_10469498
527 Ga0075363_100188342
528 Ga0075364_10018240
529 Ga0075364_10321519
530 Ga0075362_10185990
531 Ga0075367_10051839
532 Ga0075367_10084374
533 Ga0075367_10916188
534 Ga0075367_11041699
535 Ga0075369_10036333
536 Ga0075369_10230373
537 Ga0075366_10000186
538 Ga0075366_10032521
539 Ga0075366_10052968
540 Ga0075366_10103111
541 Ga0075366_10632949
542 Ga0075370_10031513
543 Ga0075370_10104511
544 Ga0097620_101163307
545 Ga0099825_1028597
546 Ga0099823_1047852
547 Ga0099826_10035115
548 Ga0105240_11003110
549 Ga0105240_11280324
550 Ga0111539_11272305
551 Ga0105245_10018634
552 Ga0105245_10507066
553 Ga0105247_10032496
554 Ga0105247_10093571
555 Ga0105243_10044514
556 Ga0105241_10003792
557 Ga0105241_10037000
558 Ga0105248_10195947
559 Ga0105237_10012663
560 Ga0105237_10079948
561 Ga0105237_10723473
562 Ga0105238_10018315
563 Ga0105238_10060577
564 Ga0105249_10033865
565 Ga0105239_10128431
566 Ga0105239_10224913
567 Ga0105239_10484497
568 Ga0105239_10657408
569 Ga0105239_10769509
570 Ga0105246_10020604
571 Ga0157313_1015678
572 Ga0157374_10026771
573 Ga0157378_12095411
574 Ga0163162_10497338
575 Ga0163163_10039967
576 Ga0157379_10160315
577 Ga0157376_10245640
578 Ga0182007_10096150
579 Ga0209563_102487
580 Ga0209677_100366
581 Ga0209148_1000469
582 Ga0209759_1000948
583 Ga0209233_1012967
584 Ga0209455_1005428
585 Ga0209455_1005690
586 Ga0209676_1000135
587 Ga0209564_1007974
588 Ga0209758_1001668
589 Ga0209758_1015906
590 Ga0209758_1027283
591 Ga0209758_1028200
592 Ga0209758_1048249
593 Ga0209758_1078232
594 Ga0209758_1127625
595 Ga0209050_1000100
596 Ga0209256_1016850
597 Ga0207426_1000347
598 Ga0207426_1026583
599 Ga0207426_1085785
600 Ga0209051_1000067
601 Ga0209257_1000095
602 Ga0209257_1004512
603 Ga0209257_1047379
604 Ga0207710_10296745
605 Ga0207688_10195899
606 Ga0207647_10001188
607 Ga0207647_10171933
608 Ga0207684_10001941
609 Ga0207654_10043172
610 Ga0207654_10086622
611 Ga0207695_10000006
612 Ga0207695_11226208
613 Ga0207671_10064833
614 Ga0207671_10142395
615 Ga0207671_10659740
616 Ga0207649_11563113
617 Ga0207694_10030985
618 Ga0207659_10378077
619 Ga0207687_10309031
620 Ga0207690_10449262
621 Ga0207706_10329286
622 Ga0207706_11064747
623 Ga0207709_10236989
624 Ga0207667_12140083
625 Ga0207712_10045365
626 Ga0207668_11334965
627 Ga0207640_10347080
628 Ga0207658_10745305
629 Ga0207677_10266785
630 Ga0207703_10440577
631 Ga0207639_10073398
632 Ga0207639_10091930
633 Ga0207678_10034820
634 Ga0207702_10068619
635 Ga0207675_100062483
636 Ga0207698_10165887
637 Ga0209389_1000015
638 Ga0209489_100072
639 Ga0209700_100034
640 Ga0268266_10025618
641 Ga0268266_10182439
642 Ga0268266_10580107
643 Ga0268266_11271463
644 Ga0268265_10312994
645 Ga0268264_10000119
646 Ga0268264_10410656
647 Ga0265337_1035196
648 Ga0265319_1025028
649 Ga0265334_10002358
650 Ga0265323_10000434
651 Ga0265322_10023692
652 Ga0265336_10000649
653 Ga0265338_10000280
654 Ga0265324_10010204
655 Ga0307512_10025046
656 Ga0307513_10803842
657 Ga0307508_10612604
658 Ga0307516_10009299
659 Ga0307516_10023804
660 Ga0307507_10211764
661 Ga0307507_10488108
662 Ga0307510_10007078
663 Ga0307510_10037765
664 Ga0307510_10328094
665 Ga0307510_10431116
666 Ga0395900_1546509
667 Ga0436364_0914149
668 Ga0436365_0057994
669 Ga0436365_1646390
670 Ga0436361_0644153
671 Ga0436361_0870621
672 Ga0436361_0966806
673 Ga0451789_0436694
674 Ga0451791_1011064
675 Ga0451793_1873426
676 Ga0451795_1305124
677 Ga0451800_0578289
678 Ga0451802_1037132
679 Ga0451804_0039962
680 Ga0451833_1128143
681 Ga0451839_0854493
682 Ga0451849_1366188
683 Ga0451855_1449691
684 Ga0439448_0114339
685 Ga0450919_000024
686 Ga0450918_000043
687 Ga0466969_0010417
688 Ga0466972_0018293
689 Ga0466972_0042011
690 Ga0466966_0000384
691 Ga0466966_0005799
692 Ga0466961_0000018
693 Ga0466961_0004929
694 Ga0466964_0002600
695 Ga0466970_0007978
696 Ga0466957_0004206
697 Ga0466960_0059765
698 Ga0466959_0016490
699 Ga0466959_0920987
700 Ga0451576_0250380
701 Ga0466958_0009631
702 Ga0495592_0090183
703 Ga0495629_0002395
704 Ga0495651_0030158
705 Ga0495653_0085681
706 Ga0495650_0263707
707 Ga0495639_0067451
708 Ga0495662_0339929
709 Ga0495585_0073633
710 Ga0495594_0562502
711 Ga0495583_0052130
712 Ga0495606_0035165
713 Ga0495606_0549621
714 Ga0495608_0064887
715 Ga0495610_0078251
716 Ga0495610_0188214
717 Ga0495610_0215226
718 Ga0495616_0105062
719 Ga0495620_0012241
720 Ga0495632_0467001
721 Ga0495643_0023056
722 Ga0495648_0016650
723 Ga0495648_0035423
724 Ga0495652_0039970
725 Ga0495665_0334220
726 Ga0495640_0130007
727 Ga0495587_0085675
728 Ga0495622_0017931
729 Ga0495668_0054334
730 Ga0495634_0028288
731 Ga0495625_0029535
732 Ga0495635_0002322
733 Ga0495588_0107796
734 Ga0495657_0004282
735 Ga0495646_0050743
736 Ga0495613_0093220
737 Ga0495624_0519700
738 Ga0495649_0033366
739 Ga0495649_0094202
740 Ga0495600_0007662
741 Ga0495660_0189044
742 Ga0495581_0028971
743 Ga0495604_0172311
744 Ga0495672_0221081
745 Ga0495676_0002485
746 Ga0495676_0008762
747 Ga0495683_0110173
748 Ga0495683_0210665
749 Ga0495687_011887
750 Ga0495673_0210853
751 Ga0495673_0326640
752 Ga0495681_0011219
753 Ga0495686_0013950
754 Ga0495686_0014259
755 Ga0495686_0170507
756 Ga0495593_0034100
757 Ga0495593_0107916
758 Ga0495602_0075193
759 Ga0495614_0048541
760 Ga0495614_0187848
761 Ga0496100_0119198
762 Ga0496101_0076533
763 Ga0496102_0354436
764 Ga0496103_0025651
765 Ga0496103_0744821
766 Ga0496104_0013526
767 Ga0496104_0752340
768 Ga0496105_0001000
769 Ga0496105_0037272
770 Ga0496108_0075572
771 Ga0496108_0166805
772 Ga0496110_0482430
773 Ga0496111_0045594
774 Ga0496112_0067802
775 Ga0496112_0598563
776 Ga0496113_0044060
777 Ga0496113_0101767
778 Ga0496115_0060951
779 Ga0496115_0852999
780 Ga0496118_0092585
781 Ga0496118_0131269
782 Ga0496119_0001056
783 Ga0496119_0008066
784 Ga0496119_0038425
785 Ga0496119_0150232
786 Ga0496120_0000170
787 Ga0496120_0044403
788 Ga0496121_0029944
789 Ga0496121_0157861
790 Ga0496121_0164237
791 Ga0496121_0204240
792 Ga0496121_0750642
793 Ga0496122_0237123
794 Ga0496124_0014900
795 Ga0496124_0055707
796 Ga0496125_0050855
797 Ga0496125_0051080
798 Ga0496125_0058938
799 Ga0496125_0100760
800 Ga0496125_0487250
801 Ga0496125_0741324
802 Ga0496126_0007179
803 Ga0496126_0289752
804 Ga0496126_0608122
805 Ga0495682_0020840
806 Ga0495682_0023121
807 nmdc:mga03683_277926_c1
808 nmdc:mga03683_355811_c1
809 nmdc:mga03n38_13016_c1
810 nmdc:mga00v17_22650_c1
811 nmdc:mga00v17_348945_c1
812 nmdc:mga0yw44_380822_c1
813 nmdc:mga0yw44_458706_c1
814 nmdc:mga0k408_200454_c1
815 nmdc:mga0k408_366279_c1
816 nmdc:mga0k408_414_c1
817 nmdc:mga0k408_48253_c1
818 nmdc:mga0k408_49389_c1
819 nmdc:mga06z11_377945_c1
820 nmdc:mga06z11_402771_c1
821 nmdc:mga06z11_750141_c1
822 nmdc:mga06z11_916030_c1
823 nmdc:mga07m45_430088_c1
824 nmdc:mga07m45_44423_c1
825 nmdc:mga0sz30_19100_c1
826 nmdc:mga0sz30_33314_c1
827 nmdc:mga0sz30_594644_c1
828 Ga0500610_0245673
829 Ga0495619_0227708
830 Ga0500578_0009951
831 Ga0500578_0193935
832 Ga0500643_000018
833 Ga0500643_000328
834 Ga0500643_001321
835 Ga0500646_0049533
836 Ga0500647_0207388
837 Ga0500583_0042294
838 Ga0500583_0250301
839 Ga0500651_0207122
840 Ga0500640_186690
841 Ga0500641_0027821
842 Ga0500650_0323298
843 Ga0500555_021630
844 Ga0500556_0116774
845 Ga0500557_000019
846 Ga0500569_111757
847 Ga0500572_001006
848 Ga0500595_034321
849 Ga0500595_036114
850 Ga0500597_214905
851 Ga0500608_006938
852 Ga0500618_003502
853 Ga0500628_009614
854 Ga0500642_0000064
855 Ga0500642_0005550
856 Ga0500655_000085
857 Ga0500655_014819
858 Ga0500658_0016048
859 Ga0500559_0001342
860 Ga0500559_0011985
861 Ga0500574_000046
862 Ga0500588_0016716
863 Ga0500589_179892
864 Ga0500622_0011980
865 Ga0500634_0000866
866 Ga0500638_018009
867 Ga0500638_110360
868 Ga0500639_004522
869 Ga0500639_080012
870 Ga0500636_0010450
871 Ga0500636_0160880
872 Ga0500636_0244148
873 Ga0500637_0440585
874 Ga0500576_001460
875 Ga0500625_012486
876 Ga0500596_002703
877 2508695950
878 2511395790
879 2513651771
880 2513721998
881 2513879252
882 2517106551
883 2528850687
884 2587757063
885 2745077759
886 2793065774
887 2805920323
888 2818239323
889 2824683625
890 2824702411
891 2824708013
892 2824758388
893 2824768910
894 2841959087
895 2841965690
896 2842041472
897 2842049514
898 2844322655
899 2847939849
900 2874618657
901 2874629246
902 2876769815
903 2879083591
904 2888379044
905 2888390222
906 2903734830
907 2904716073
908 2906604859
909 2906634476
910 2922377929
911 2922400830
912 2935649133
913 2935658095
914 2935686866
915 2935716554
916 2935723321
917 2935734877
918 2935744332
919 2935752832
920 2935767920
921 2935779630
922 2935985417
923 2936012314
924 2936020605
925 2936029607
926 2936051928
927 2936056815
928 2940558745
929 3005602751
930 3005725223
931 8016606985
932 8016618892
933 8019540974
934 8056976686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

26

126

0.94

PF07681

DoxX

DoxX

23

105

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p06-assembly1.cif.gz_B-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.5855 61 133
5uhq-assembly1.cif.gz_A structure of a semisweet q20a mutant 0.5608 56 135
4x5m-assembly2.cif.gz_B crystal structure of semisweet in the inward-open conformation 0.5436 14 128
5tcx-assembly1.cif.gz_A crystal structure of human tetraspanin cd81 0.5162 20 124
8e0m-assembly1.cif.gz_A homotrimeric variant of tctrp9, bgl15 0.4934 20 129
ID Description Score Start End Superfamily
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8825 88 129 1.10.287.1080
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8254 17 134 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8066 17 134 1.10.10.1740
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7463 13 134 1.20.120.550
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7386 17 134 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A0Q4TYF8-F1-model_v4 deleted 1.002 13 141
AF-A0A547AGW7-F1-model_v4 DoxX family protein 0.9918 8 141 GO:0016020
AF-Q89Y33-F1-model_v4 Blr0122 protein 0.9874 1 142 GO:0016020
AF-A0A2W5SX17-F1-model_v4 DoxX family protein 0.9862 12 133 GO:0016020
AF-A0A4R8DVY1-F1-model_v4 DoxX-like protein 0.9828 16 133 GO:0016020

Map