F449903

General Info

Members Datasets Scaffolds Average Seq Length
467 277 934 246

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0006191|Ga0495588_0006191_2790_3635
Length 281
Sequence MSVLTASQRLCLRSMTASRAGSAAHGGAESGGPAKIAIVTGAGTGIGRAVALALVEDGYSVVFAGRRADHLDSAVTSAGAAASRCLAVPTDVKDPDSVRSLFAATKTRFGRLDLLFNNAGIGTAPIPMEDLPFDQWRAVVDTNLNGAFLCTQEAIRIMKAQTPRGGRIINNGSISAHAPRPHSAAYTATKHAITGLTKSTALDGRAHDIACGQIDIGNAATELTAKMPLGVLQPNGQIASEPTIDTAHVGRAVVYMAALPLDTNVQFMTLMATKMPWIGRG

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2582580736 Prauserella sp. Am3 Isolate Unclassified
274 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
275 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
276 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
277 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 6
Rhizosphere 81.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0006191 3300046674 Bacteria 5376
2 JGI25151J46595_10002909 3300003187 Bacteria 9813
3 JGI25407J50210_10015672 3300003373 Bacteria 1959
4 Ga0055537_1001569 3300003773 Bacteria 8711
5 Ga0055534_1000419 3300003784 Bacteria 25575
6 Ga0065704_10001083 3300005289 Bacteria 10602
7 Ga0065704_10114711 3300005289 Bacteria 1885
8 Ga0065715_10127977 3300005293 Bacteria 2075
9 Ga0065715_10197435 3300005293 Bacteria 1364
10 Ga0065715_10325415 3300005293 Bacteria 994
11 Ga0065707_10001086 3300005295 Bacteria 8272
12 Ga0065707_10113360 3300005295 Bacteria 2330
13 Ga0070676_10062690 3300005328 Bacteria 2213
14 Ga0070683_100305755 3300005329 Bacteria 1513
15 Ga0070683_100491709 3300005329 Bacteria 1172
16 Ga0070670_100671324 3300005331 Bacteria 931
17 Ga0068869_100125216 3300005334 Bacteria 1970
18 Ga0068869_100202630 3300005334 Bacteria 1565
19 Ga0068869_100242253 3300005334 Bacteria 1437
20 Ga0070680_100259481 3300005336 Bacteria 1470
21 Ga0070689_100006835 3300005340 Bacteria 7936
22 Ga0070689_100033980 3300005340 Bacteria 3889
23 Ga0070689_100109491 3300005340 Bacteria 2195
24 Ga0070687_100003394 3300005343 Bacteria 6184
25 Ga0070687_100005127 3300005343 Bacteria 5281
26 Ga0070661_100432300 3300005344 Bacteria 1045
27 Ga0070692_10117964 3300005345 Bacteria 1476
28 Ga0070692_10178468 3300005345 Bacteria 1229
29 Ga0070692_10304774 3300005345 Bacteria 974
30 Ga0070668_100600473 3300005347 Bacteria 963
31 Ga0070669_100002494 3300005353 Bacteria 13325
32 Ga0070675_100000455 3300005354 Bacteria 27928
33 Ga0070675_100002149 3300005354 Bacteria 14583
34 Ga0070675_100443139 3300005354 Bacteria 1164
35 Ga0070671_100008058 3300005355 Bacteria 8434
36 Ga0070671_100524197 3300005355 Bacteria 1020
37 Ga0070674_100058207 3300005356 Bacteria 2685
38 Ga0070673_100047466 3300005364 Bacteria 3342
39 Ga0070673_100048066 3300005364 Bacteria 3324
40 Ga0070673_100140985 3300005364 Bacteria 2033
41 Ga0070673_100198022 3300005364 Bacteria 1729
42 Ga0070688_100007576 3300005365 Bacteria 5858
43 Ga0070659_100279889 3300005366 Bacteria 1388
44 Ga0070667_100008143 3300005367 Bacteria 8689
45 Ga0070713_100561365 3300005436 Bacteria 1082
46 Ga0070701_10046294 3300005438 Bacteria 2235
47 Ga0070711_100142934 3300005439 Bacteria 1796
48 Ga0070705_100052797 3300005440 Bacteria 2376
49 Ga0070705_100201257 3300005440 Bacteria 1365
50 Ga0070705_100548406 3300005440 Bacteria 886
51 Ga0070700_100006426 3300005441 Bacteria 6287
52 Ga0070694_100005043 3300005444 Bacteria 7968
53 Ga0070694_100058606 3300005444 Bacteria 2620
54 Ga0070694_100087668 3300005444 Bacteria 2178
55 Ga0070663_100057116 3300005455 Bacteria 2799
56 Ga0070678_100394902 3300005456 Bacteria 1200
57 Ga0070662_100023279 3300005457 Bacteria 4253
58 Ga0068867_100000156 3300005459 Bacteria 43913
59 Ga0068867_100173018 3300005459 Bacteria 1712
60 Ga0070685_10348520 3300005466 Bacteria 1012
61 Ga0070706_100002307 3300005467 Bacteria 19282
62 Ga0070707_100042746 3300005468 Bacteria 4339
63 Ga0070698_100045207 3300005471 Bacteria 4507
64 Ga0070698_100064589 3300005471 Bacteria 3687
65 Ga0070698_100137883 3300005471 Bacteria 2393
66 Ga0070699_100000181 3300005518 Bacteria 61068
67 Ga0070699_100005172 3300005518 Bacteria 11478
68 Ga0070699_100012483 3300005518 Bacteria 7331
69 Ga0070679_100113780 3300005530 Bacteria 2691
70 Ga0070684_100016483 3300005535 Bacteria 6040
71 Ga0070684_100132172 3300005535 Bacteria 2252
72 Ga0070697_100099457 3300005536 Bacteria 2414
73 Ga0070672_100006177 3300005543 Bacteria 8019
74 Ga0070672_100163507 3300005543 Bacteria 1848
75 Ga0070672_100180749 3300005543 Bacteria 1758
76 Ga0070695_100002204 3300005545 Bacteria 11178
77 Ga0070696_100005383 3300005546 Bacteria 8536
78 Ga0070696_100012149 3300005546 Bacteria 5771
79 Ga0070696_100022216 3300005546 Bacteria 4309
80 Ga0070696_100158312 3300005546 Bacteria 1667
81 Ga0070693_100250803 3300005547 Bacteria 1173
82 Ga0070693_100374028 3300005547 Bacteria 981
83 Ga0070665_100000493 3300005548 Bacteria 56564
84 Ga0070665_100264264 3300005548 Bacteria 1722
85 Ga0070704_100001149 3300005549 Bacteria 13823
86 Ga0070704_100018977 3300005549 Bacteria 4411
87 Ga0070704_100306281 3300005549 Bacteria 1325
88 Ga0068855_100054247 3300005563 Bacteria 4711
89 Ga0070664_100011656 3300005564 Bacteria 7132
90 Ga0070664_100052090 3300005564 Bacteria 3467
91 Ga0068857_100006178 3300005577 Bacteria 10239
92 Ga0068857_100014674 3300005577 Bacteria 6834
93 Ga0068856_100060385 3300005614 Bacteria 3745
94 Ga0068856_100081409 3300005614 Bacteria 3212
95 Ga0070702_100025770 3300005615 Bacteria 3154
96 Ga0070702_100453431 3300005615 Bacteria 931
97 Ga0068852_100426400 3300005616 Bacteria 1309
98 Ga0068859_100002281 3300005617 Bacteria 19474
99 Ga0068859_100019089 3300005617 Bacteria 6885
100 Ga0068864_100046872 3300005618 Bacteria 3710
101 Ga0068864_100079664 3300005618 Bacteria 2868
102 Ga0068861_100001960 3300005719 Bacteria 13254
103 Ga0068870_10000615 3300005840 Bacteria 13554
104 Ga0068863_100076117 3300005841 Bacteria 3175
105 Ga0068863_100126893 3300005841 Bacteria 2434
106 Ga0068858_100045828 3300005842 Bacteria 4054
107 Ga0068860_100004756 3300005843 Bacteria 13831
108 Ga0068860_100069357 3300005843 Bacteria 3351
109 Ga0068860_100081024 3300005843 Bacteria 3087
110 Ga0068860_100473141 3300005843 Bacteria 1248
111 Ga0068860_100488492 3300005843 Bacteria 1228
112 Ga0068862_100000811 3300005844 Bacteria 31032
113 Ga0081538_10004321 3300005981 Bacteria 13133
114 Ga0081538_10015121 3300005981 Bacteria 5995
115 Ga0081540_1001008 3300005983 Bacteria 25263
116 Ga0070717_10027346 3300006028 Bacteria 4559
117 Ga0075432_10040612 3300006058 Bacteria 1624
118 Ga0070712_100502976 3300006175 Bacteria 1016
119 Ga0075366_10006311 3300006195 Bacteria 6486
120 Ga0075366_10111795 3300006195 Bacteria 1643
121 Ga0075366_10118363 3300006195 Bacteria 1596
122 Ga0097621_100035071 3300006237 Bacteria 4007
123 Ga0097621_100345443 3300006237 Bacteria 1322
124 Ga0097621_100541345 3300006237 Bacteria 1059
125 Ga0075370_10000927 3300006353 Bacteria 12046
126 Ga0068871_100300078 3300006358 Bacteria 1410
127 Ga0075428_100444494 3300006844 Bacteria 1389
128 Ga0075434_100006084 3300006871 Bacteria 11041
129 Ga0075434_100009010 3300006871 Bacteria 9296
130 Ga0075434_100255693 3300006871 Bacteria 1770
131 Ga0075434_100302772 3300006871 Bacteria 1619
132 Ga0075434_101015811 3300006871 Bacteria 843
133 Ga0068865_100021520 3300006881 Bacteria 4194
134 Ga0068865_100114621 3300006881 Bacteria 1994
135 Ga0068865_100127703 3300006881 Bacteria 1900
136 Ga0097620_100002281 3300006931 Bacteria 19474
137 Ga0097620_100019089 3300006931 Bacteria 6885
138 Ga0075435_100033552 3300007076 Bacteria 4059
139 Ga0105240_10004075 3300009093 Bacteria 22481
140 Ga0105240_10885503 3300009093 Bacteria 961
141 Ga0111539_10031946 3300009094 Bacteria 6396
142 Ga0111539_10046566 3300009094 Bacteria 5187
143 Ga0111539_10168252 3300009094 Bacteria 2562
144 Ga0105245_10015561 3300009098 Bacteria 6632
145 Ga0105245_10082648 3300009098 Bacteria 2938
146 Ga0105245_10137473 3300009098 Bacteria 2298
147 Ga0114129_10135437 3300009147 Bacteria 3380
148 Ga0114129_10155165 3300009147 Bacteria 3131
149 Ga0114129_10264660 3300009147 Bacteria 2303
150 Ga0114129_10477006 3300009147 Bacteria 1633
151 Ga0105243_10012835 3300009148 Bacteria 6330
152 Ga0105243_10036965 3300009148 Bacteria 3792
153 Ga0105243_10410692 3300009148 Bacteria 1260
154 Ga0105242_10003913 3300009176 Bacteria 11578
155 Ga0105248_10580721 3300009177 Bacteria 1264
156 Ga0105248_11021996 3300009177 Bacteria 934
157 Ga0105237_10064864 3300009545 Bacteria 3648
158 Ga0105237_10191999 3300009545 Bacteria 2042
159 Ga0105239_10006923 3300010375 Bacteria 13077
160 Ga0105239_10725666 3300010375 Bacteria 1137
161 Ga0105246_10023975 3300011119 Bacteria 3956
162 Ga0157370_10000990 3300013104 Bacteria 35940
163 Ga0157369_10088124 3300013105 Bacteria 3313
164 Ga0157369_10478157 3300013105 Bacteria 1289
165 Ga0157374_10014636 3300013296 Bacteria 6865
166 Ga0157378_10088641 3300013297 Bacteria 2808
167 Ga0163162_10185745 3300013306 Bacteria 2206
168 Ga0163162_10676986 3300013306 Bacteria 1154
169 Ga0163162_11442122 3300013306 Bacteria 784
170 Ga0157375_10027229 3300013308 Bacteria 5341
171 Ga0157375_10064553 3300013308 Bacteria 3646
172 Ga0157375_10069620 3300013308 Bacteria 3525
173 Ga0157375_10244598 3300013308 Bacteria 1954
174 Ga0157375_10318235 3300013308 Bacteria 1720
175 Ga0163163_10023545 3300014325 Bacteria 5846
176 Ga0163163_10083747 3300014325 Bacteria 3195
177 Ga0163163_10200396 3300014325 Bacteria 2044
178 Ga0163163_11122183 3300014325 Bacteria 849
179 Ga0157380_10176304 3300014326 Bacteria 1873
180 Ga0157380_10332731 3300014326 Bacteria 1413
181 Ga0157380_10448345 3300014326 Bacteria 1238
182 Ga0157379_10085135 3300014968 Bacteria 2833
183 Ga0157379_10269537 3300014968 Bacteria 1548
184 Ga0157376_10427555 3300014969 Bacteria 1287
185 Ga0213874_10019311 3300021377 Bacteria 1853
186 Ga0213876_10030975 3300021384 Bacteria 2823
187 Ga0213876_10120023 3300021384 Bacteria 1395
188 Ga0213875_10011267 3300021388 Bacteria 4453
189 Ga0213875_10104154 3300021388 Bacteria 1324
190 Ga0209565_1000097 3300025263 Bacteria 133082
191 Ga0209673_1025217 3300025273 Bacteria 1980
192 Ga0209675_1000804 3300025291 Bacteria 20694
193 Ga0209025_1001270 3300025294 Bacteria 34717
194 Ga0209564_1001135 3300025295 Bacteria 31269
195 Ga0209758_1054230 3300025297 Bacteria 1371
196 Ga0209256_1000528 3300025299 Bacteria 55473
197 Ga0209256_1000597 3300025299 Bacteria 50222
198 Ga0207645_10001485 3300025907 Bacteria 19163
199 Ga0207645_10287387 3300025907 Bacteria 1093
200 Ga0207643_10003812 3300025908 Bacteria 8108
201 Ga0207684_10098948 3300025910 Bacteria 2491
202 Ga0207654_10022240 3300025911 Bacteria 3381
203 Ga0207695_10037500 3300025913 Bacteria 5230
204 Ga0207695_10114785 3300025913 Bacteria 2668
205 Ga0207671_10066851 3300025914 Bacteria 2676
206 Ga0207671_10246158 3300025914 Bacteria 1405
207 Ga0207662_10010958 3300025918 Bacteria 5014
208 Ga0207662_10068428 3300025918 Bacteria 2144
209 Ga0207652_10438487 3300025921 Bacteria 1178
210 Ga0207646_10032191 3300025922 Bacteria 4746
211 Ga0207646_10302800 3300025922 Bacteria 1444
212 Ga0207681_10003671 3300025923 Bacteria 9543
213 Ga0207694_10161508 3300025924 Bacteria 1810
214 Ga0207650_10086281 3300025925 Bacteria 2389
215 Ga0207659_10000704 3300025926 Bacteria 19847
216 Ga0207687_10019049 3300025927 Bacteria 4542
217 Ga0207687_10077297 3300025927 Bacteria 2393
218 Ga0207687_10222934 3300025927 Bacteria 1486
219 Ga0207687_10420205 3300025927 Bacteria 1103
220 Ga0207700_10184380 3300025928 Bacteria 1750
221 Ga0207644_10021978 3300025931 Bacteria 4352
222 Ga0207644_10052251 3300025931 Bacteria 2936
223 Ga0207690_10057684 3300025932 Bacteria 2624
224 Ga0207706_10152057 3300025933 Bacteria 2035
225 Ga0207706_10781845 3300025933 Bacteria 812
226 Ga0207686_10001732 3300025934 Bacteria 12142
227 Ga0207686_10009466 3300025934 Bacteria 5288
228 Ga0207709_10037022 3300025935 Bacteria 2897
229 Ga0207709_10127909 3300025935 Bacteria 1726
230 Ga0207709_10235432 3300025935 Bacteria 1329
231 Ga0207670_10018573 3300025936 Bacteria 4231
232 Ga0207670_10039444 3300025936 Bacteria 3093
233 Ga0207704_10013370 3300025938 Bacteria 4105
234 Ga0207704_10015179 3300025938 Bacteria 3917
235 Ga0207704_10049574 3300025938 Bacteria 2527
236 Ga0207704_10464284 3300025938 Bacteria 1013
237 Ga0207691_10004143 3300025940 Bacteria 14086
238 Ga0207691_10177151 3300025940 Bacteria 1864
239 Ga0207691_10181081 3300025940 Bacteria 1841
240 Ga0207691_10227579 3300025940 Bacteria 1615
241 Ga0207689_10193334 3300025942 Bacteria 1679
242 Ga0207689_10203026 3300025942 Bacteria 1636
243 Ga0207689_10248049 3300025942 Bacteria 1472
244 Ga0207689_10515562 3300025942 Bacteria 1002
245 Ga0207661_10008036 3300025944 Bacteria 7521
246 Ga0207661_10378579 3300025944 Bacteria 1281
247 Ga0207667_10056062 3300025949 Bacteria 4141
248 Ga0207640_10136991 3300025981 Bacteria 1779
249 Ga0207658_10004620 3300025986 Bacteria 9548
250 Ga0207658_10195187 3300025986 Bacteria 1686
251 Ga0207677_10216633 3300026023 Bacteria 1533
252 Ga0207708_10026024 3300026075 Bacteria 4426
253 Ga0207708_10034243 3300026075 Bacteria 3863
254 Ga0207702_10061620 3300026078 Bacteria 3200
255 Ga0207702_10084207 3300026078 Bacteria 2768
256 Ga0207702_10216153 3300026078 Bacteria 1784
257 Ga0207702_10562751 3300026078 Bacteria 1116
258 Ga0207641_10056848 3300026088 Bacteria 3326
259 Ga0207641_10099334 3300026088 Bacteria 2561
260 Ga0207648_10001256 3300026089 Bacteria 28334
261 Ga0207648_10003372 3300026089 Bacteria 16778
262 Ga0207648_10182326 3300026089 Bacteria 1858
263 Ga0207676_10018156 3300026095 Bacteria 5109
264 Ga0207674_10003540 3300026116 Bacteria 19068
265 Ga0207674_10008465 3300026116 Bacteria 11883
266 Ga0207674_10019381 3300026116 Bacteria 7369
267 Ga0207675_100005174 3300026118 Bacteria 12556
268 Ga0207683_10033872 3300026121 Bacteria 4438
269 Ga0207683_10070172 3300026121 Bacteria 3095
270 Ga0207683_10079554 3300026121 Bacteria 2906
271 Ga0207428_10001064 3300027907 Bacteria 30122
272 Ga0207428_10163763 3300027907 Bacteria 1687
273 Ga0268266_10000181 3300028379 Bacteria 112266
274 Ga0268265_10000103 3300028380 Bacteria 106177
275 Ga0268264_10064477 3300028381 Bacteria 3083
276 Ga0268264_10289154 3300028381 Bacteria 1539
277 Ga0265334_10004304 3300028573 Bacteria 6340
278 Ga0265318_10000079 3300028577 Bacteria 86861
279 Ga0265336_10009614 3300028666 Bacteria 3335
280 Ga0307517_10085553 3300028786 Bacteria 2640
281 Ga0307517_10201860 3300028786 Bacteria 1241
282 Ga0307515_10026774 3300028794 Bacteria 9898
283 Ga0307515_10286943 3300028794 Bacteria 1346
284 Ga0307515_10346345 3300028794 Bacteria 1135
285 Ga0265338_10006074 3300028800 Bacteria 15514
286 Ga0265320_10000568 3300031240 Bacteria 28517
287 Ga0265325_10098455 3300031241 Bacteria 1435
288 Ga0265339_10123481 3300031249 Bacteria 1329
289 Ga0265331_10117165 3300031250 Bacteria 1219
290 Ga0265327_10000359 3300031251 Bacteria 86745
291 Ga0307513_10148481 3300031456 Bacteria 2258
292 Ga0307513_10292889 3300031456 Bacteria 1398
293 Ga0307509_10027259 3300031507 Bacteria 6358
294 Ga0307509_10124440 3300031507 Bacteria 2548
295 Ga0307408_100438025 3300031548 Bacteria 1131
296 Ga0265313_10015533 3300031595 Bacteria 4424
297 Ga0307508_10001066 3300031616 Bacteria 31732
298 Ga0307508_10105778 3300031616 Bacteria 2412
299 Ga0307514_10095119 3300031649 Bacteria 2157
300 Ga0265314_10070651 3300031711 Bacteria 2338
301 Ga0316578_10010035 3300031728 Bacteria 4900
302 Ga0307516_10038283 3300031730 Bacteria 4787
303 Ga0307405_10036250 3300031731 Bacteria 2953
304 Ga0307405_10038362 3300031731 Bacteria 2887
305 Ga0307405_10198654 3300031731 Bacteria 1454
306 Ga0307413_10554217 3300031824 Bacteria 933
307 Ga0307413_10663411 3300031824 Bacteria 862
308 Ga0307410_10162821 3300031852 Bacteria 1673
309 Ga0307410_10304860 3300031852 Bacteria 1258
310 Ga0307406_10033769 3300031901 Bacteria 3133
311 Ga0307406_10154752 3300031901 Bacteria 1640
312 Ga0307407_10026175 3300031903 Bacteria 3086
313 Ga0307407_10359136 3300031903 Bacteria 1034
314 Ga0307412_10251968 3300031911 Bacteria 1371
315 Ga0307412_10339954 3300031911 Bacteria 1201
316 Ga0307409_100019756 3300031995 Bacteria 4572
317 Ga0307409_100491026 3300031995 Bacteria 1193
318 Ga0307416_100001584 3300032002 Bacteria 12484
319 Ga0307416_100017396 3300032002 Bacteria 5030
320 Ga0307411_10047848 3300032005 Bacteria 2767
321 Ga0307411_10292398 3300032005 Bacteria 1302
322 Ga0307415_100016651 3300032126 Bacteria 4387
323 Ga0307415_100214154 3300032126 Bacteria 1539
324 Ga0307415_100308673 3300032126 Bacteria 1314
325 Ga0307415_100424132 3300032126 Bacteria 1142
326 Ga0316583_10073365 3300032133 Bacteria 1197
327 Ga0373934_0067750 3300035086 Bacteria 1426
328 Ga0373943_0077781 3300035170 Bacteria 1695
329 Ga0316574_0002067 3300035398 Bacteria 9922
330 Ga0373937_0013703 3300036401 Bacteria 7142
331 Ga0373937_0091867 3300036401 Bacteria 2813
332 Ga0316584_0070400 3300036712 Bacteria 2622
333 Ga0373925_0056755 3300037068 Bacteria 2934
334 Ga0373925_0235542 3300037068 Bacteria 1465
335 Ga0436365_0228452 3300039437 Bacteria 15449
336 Ga0436365_1867753 3300039437 Bacteria 1133
337 Ga0436363_0338443 3300039450 Bacteria 19838
338 Ga0436363_0417755 3300039450 Bacteria 1627
339 Ga0436362_0445683 3300039453 Bacteria 1643
340 Ga0439431_0078985 3300041997 Bacteria 885
341 Ga0451577_0291850 3300042876 Bacteria 1478
342 Ga0466973_0038234 3300044659 Bacteria 4547
343 Ga0453684_0087517 3300044712 Bacteria 3860
344 Ga0466968_0096105 3300044735 Bacteria 1319
345 Ga0466957_0137705 3300044842 Bacteria 1570
346 Ga0451576_0023741 3300045051 Bacteria 6635
347 Ga0451576_0050642 3300045051 Bacteria 4355
348 Ga0451576_0074508 3300045051 Bacteria 3532
349 Ga0466967_0003337 3300045976 Bacteria 10434
350 Ga0466967_0214093 3300045976 Bacteria 1828
351 Ga0495592_0000291 3300046454 Bacteria 42990
352 Ga0495603_0043303 3300046455 Bacteria 2689
353 Ga0495603_0043739 3300046455 Bacteria 2673
354 Ga0495629_0000628 3300046459 Bacteria 28692
355 Ga0495653_0143559 3300046463 Bacteria 1676
356 Ga0495580_0319223 3300046472 Bacteria 1056
357 Ga0495582_0201229 3300046473 Bacteria 1137
358 Ga0495584_0031360 3300046491 Bacteria 2691
359 Ga0495584_0186108 3300046491 Bacteria 1055
360 Ga0495632_0016014 3300046519 Bacteria 4183
361 Ga0495644_0072168 3300046523 Bacteria 1298
362 Ga0495642_0003866 3300046528 Bacteria 5871
363 Ga0495598_0108864 3300046537 Bacteria 926
364 Ga0495609_0010426 3300046538 Bacteria 4456
365 Ga0495609_0061970 3300046538 Bacteria 1652
366 Ga0495621_0002278 3300046539 Bacteria 5139
367 Ga0495621_0131266 3300046539 Bacteria 975
368 Ga0495645_0087771 3300046543 Bacteria 2225
369 Ga0495659_0002076 3300046664 Bacteria 6551
370 Ga0495659_0006018 3300046664 Bacteria 3834
371 Ga0495659_0013172 3300046664 Bacteria 2689
372 Ga0495659_0036731 3300046664 Bacteria 1732
373 Ga0495647_0064086 3300046681 Bacteria 1457
374 Ga0495658_0051657 3300046683 Bacteria 2329
375 Ga0495658_0340940 3300046683 Bacteria 952
376 Ga0495669_0063981 3300046684 Bacteria 1669
377 Ga0495670_0155988 3300046691 Bacteria 1198
378 Ga0495649_0001864 3300046694 Bacteria 15426
379 Ga0495589_0094384 3300046794 Bacteria 1452
380 Ga0495636_0060811 3300047318 Bacteria 1596
381 Ga0495676_0019722 3300047321 Bacteria 5929
382 Ga0495687_003808 3300047443 Bacteria 10640
383 Ga0495687_019864 3300047443 Bacteria 3287
384 Ga0495685_009891 3300047447 Bacteria 3193
385 Ga0495626_0048580 3300048091 Bacteria 1968
386 Ga0496100_0021189 3300048903 Bacteria 3911
387 Ga0496100_0044210 3300048903 Bacteria 2852
388 Ga0496101_0001701 3300048904 Bacteria 13168
389 Ga0496101_0120780 3300048904 Bacteria 1981
390 Ga0496101_0147547 3300048904 Bacteria 1797
391 Ga0496102_0051489 3300048905 Bacteria 3751
392 Ga0496103_0082763 3300048906 Bacteria 2020
393 Ga0496104_0004852 3300048907 Bacteria 11719
394 Ga0496104_0055156 3300048907 Bacteria 3757
395 Ga0496105_0018304 3300048908 Bacteria 5627
396 Ga0496105_0045330 3300048908 Bacteria 3628
397 Ga0496105_0709827 3300048908 Bacteria 771
398 Ga0496106_0014023 3300048909 Bacteria 5924
399 Ga0496106_0066052 3300048909 Bacteria 2754
400 Ga0496107_0045647 3300048910 Bacteria 3152
401 Ga0496108_0001399 3300048911 Bacteria 18999
402 Ga0496108_0117099 3300048911 Bacteria 2283
403 Ga0496109_0082356 3300048912 Bacteria 2965
404 Ga0496109_0176570 3300048912 Bacteria 2005
405 Ga0496110_0002306 3300048913 Bacteria 14255
406 Ga0496110_0126965 3300048913 Bacteria 2302
407 Ga0496111_0005213 3300048914 Bacteria 8290
408 Ga0496111_0421345 3300048914 Bacteria 986
409 Ga0496112_0047244 3300048915 Bacteria 4223
410 Ga0496112_0281929 3300048915 Bacteria 1609
411 Ga0496113_0031964 3300048916 Bacteria 3823
412 Ga0496114_0064373 3300048917 Bacteria 3071
413 Ga0496115_0010151 3300048918 Bacteria 7026
414 Ga0496126_0000003 3300048929 Bacteria 961576
415 Ga0501037_0051549 3300049573 Bacteria 3010
416 Ga0501039_0005099 3300049575 Bacteria 9951
417 Ga0501040_0081044 3300049576 Bacteria 2249
418 Ga0501041_0060036 3300049577 Bacteria 2327
419 Ga0501046_0303355 3300049580 Bacteria 1166
420 Ga0501048_0196429 3300049582 Bacteria 1430
421 Ga0501067_0020206 3300049583 Bacteria 3684
422 Ga0501067_0048075 3300049583 Bacteria 2366
423 Ga0501067_0135592 3300049583 Bacteria 1371
424 Ga0501071_0355017 3300049587 Bacteria 1116
425 Ga0501072_0016125 3300049588 Bacteria 5730
426 Ga0501072_0179152 3300049588 Bacteria 1690
427 Ga0501073_0037393 3300049589 Bacteria 3447
428 Ga0501073_0041604 3300049589 Bacteria 3247
429 Ga0501074_0015261 3300049590 Bacteria 5583
430 Ga0501075_0034971 3300049591 Bacteria 3745
431 Ga0501076_0094512 3300049592 Bacteria 2407
432 Ga0501076_0421023 3300049592 Bacteria 1099
433 Ga0501080_0705764 3300049742 Bacteria 889
434 Ga0501083_0019200 3300049744 Bacteria 4761
435 Ga0501035_0128963 3300049822 Bacteria 2206
436 Ga0501045_0236526 3300049824 Bacteria 1360
437 nmdc:mga03n38_225037_c1 3300050490 Bacteria 981
438 nmdc:mga0k408_198538_c1 3300050493 Bacteria 1197
439 nmdc:mga0k408_3678_c1 3300050493 Bacteria 8116
440 nmdc:mga0k408_4213_c1 3300050493 Bacteria 7626
441 nmdc:mga0k408_823_c1 3300050493 Bacteria 17139
442 nmdc:mga0k408_87212_c1 3300050493 Bacteria 1833
443 nmdc:mga07m45_210_c1 3300050496 Bacteria 23070
444 nmdc:mga07m45_226518_c1 3300050496 Bacteria 1088
445 nmdc:mga05p37_254453_c1 3300050507 Bacteria 2105
446 nmdc:mga05p37_79089_c1 3300050507 Bacteria 4049
447 nmdc:mga08y16_167612_c1 3300050511 Bacteria 2282
448 nmdc:mga08y16_20344_c1 3300050511 Bacteria 7006
449 nmdc:mga08y16_227825_c1 3300050511 Bacteria 1928
450 nmdc:mga0n895_379943_c1 3300050512 Bacteria 1430
451 nmdc:mga0n895_4669_c1 3300050512 Bacteria 11301
452 nmdc:mga0rr50_126817_c1 3300050513 Bacteria 2039
453 nmdc:mga0rr50_500980_c1 3300050513 Bacteria 1033
454 Ga0500641_0013638 3300053096 Bacteria 2987
455 Ga0500595_002168 3300053119 Bacteria 9983
456 Ga0500658_0006016 3300053134 Bacteria 4509
457 Ga0500568_0043760 3300053139 Bacteria 1788
458 Ga0500616_0000393 3300053153 Bacteria 60542
459 Ga0501084_0242475 3300054114 Bacteria 1521
460 Ga0501082_0052072 3300060353 Bacteria 3528
461 Ga0501082_0265605 3300060353 Bacteria 1493
462 Ga0530510_0381866 3300061734 Bacteria 1060
463 2583149665 2582580736 Bacteria 5325865
464 2644303963 2643221654 Bacteria 5273570
465 2838075655 2838074704 Bacteria 6785777
466 2896388163 2896384573 Bacteria 7700774
467 3003666812 3003665799 Bacteria 7279786
468 Ga0495588_0006191
469 JGI25151J46595_10002909
470 JGI25407J50210_10015672
471 Ga0055537_1001569
472 Ga0055534_1000419
473 Ga0065704_10001083
474 Ga0065704_10114711
475 Ga0065715_10127977
476 Ga0065715_10197435
477 Ga0065715_10325415
478 Ga0065707_10001086
479 Ga0065707_10113360
480 Ga0070676_10062690
481 Ga0070683_100305755
482 Ga0070683_100491709
483 Ga0070670_100671324
484 Ga0068869_100125216
485 Ga0068869_100202630
486 Ga0068869_100242253
487 Ga0070680_100259481
488 Ga0070689_100006835
489 Ga0070689_100033980
490 Ga0070689_100109491
491 Ga0070687_100003394
492 Ga0070687_100005127
493 Ga0070661_100432300
494 Ga0070692_10117964
495 Ga0070692_10178468
496 Ga0070692_10304774
497 Ga0070668_100600473
498 Ga0070669_100002494
499 Ga0070675_100000455
500 Ga0070675_100002149
501 Ga0070675_100443139
502 Ga0070671_100008058
503 Ga0070671_100524197
504 Ga0070674_100058207
505 Ga0070673_100047466
506 Ga0070673_100048066
507 Ga0070673_100140985
508 Ga0070673_100198022
509 Ga0070688_100007576
510 Ga0070659_100279889
511 Ga0070667_100008143
512 Ga0070713_100561365
513 Ga0070701_10046294
514 Ga0070711_100142934
515 Ga0070705_100052797
516 Ga0070705_100201257
517 Ga0070705_100548406
518 Ga0070700_100006426
519 Ga0070694_100005043
520 Ga0070694_100058606
521 Ga0070694_100087668
522 Ga0070663_100057116
523 Ga0070678_100394902
524 Ga0070662_100023279
525 Ga0068867_100000156
526 Ga0068867_100173018
527 Ga0070685_10348520
528 Ga0070706_100002307
529 Ga0070707_100042746
530 Ga0070698_100045207
531 Ga0070698_100064589
532 Ga0070698_100137883
533 Ga0070699_100000181
534 Ga0070699_100005172
535 Ga0070699_100012483
536 Ga0070679_100113780
537 Ga0070684_100016483
538 Ga0070684_100132172
539 Ga0070697_100099457
540 Ga0070672_100006177
541 Ga0070672_100163507
542 Ga0070672_100180749
543 Ga0070695_100002204
544 Ga0070696_100005383
545 Ga0070696_100012149
546 Ga0070696_100022216
547 Ga0070696_100158312
548 Ga0070693_100250803
549 Ga0070693_100374028
550 Ga0070665_100000493
551 Ga0070665_100264264
552 Ga0070704_100001149
553 Ga0070704_100018977
554 Ga0070704_100306281
555 Ga0068855_100054247
556 Ga0070664_100011656
557 Ga0070664_100052090
558 Ga0068857_100006178
559 Ga0068857_100014674
560 Ga0068856_100060385
561 Ga0068856_100081409
562 Ga0070702_100025770
563 Ga0070702_100453431
564 Ga0068852_100426400
565 Ga0068859_100002281
566 Ga0068859_100019089
567 Ga0068864_100046872
568 Ga0068864_100079664
569 Ga0068861_100001960
570 Ga0068870_10000615
571 Ga0068863_100076117
572 Ga0068863_100126893
573 Ga0068858_100045828
574 Ga0068860_100004756
575 Ga0068860_100069357
576 Ga0068860_100081024
577 Ga0068860_100473141
578 Ga0068860_100488492
579 Ga0068862_100000811
580 Ga0081538_10004321
581 Ga0081538_10015121
582 Ga0081540_1001008
583 Ga0070717_10027346
584 Ga0075432_10040612
585 Ga0070712_100502976
586 Ga0075366_10006311
587 Ga0075366_10111795
588 Ga0075366_10118363
589 Ga0097621_100035071
590 Ga0097621_100345443
591 Ga0097621_100541345
592 Ga0075370_10000927
593 Ga0068871_100300078
594 Ga0075428_100444494
595 Ga0075434_100006084
596 Ga0075434_100009010
597 Ga0075434_100255693
598 Ga0075434_100302772
599 Ga0075434_101015811
600 Ga0068865_100021520
601 Ga0068865_100114621
602 Ga0068865_100127703
603 Ga0097620_100002281
604 Ga0097620_100019089
605 Ga0075435_100033552
606 Ga0105240_10004075
607 Ga0105240_10885503
608 Ga0111539_10031946
609 Ga0111539_10046566
610 Ga0111539_10168252
611 Ga0105245_10015561
612 Ga0105245_10082648
613 Ga0105245_10137473
614 Ga0114129_10135437
615 Ga0114129_10155165
616 Ga0114129_10264660
617 Ga0114129_10477006
618 Ga0105243_10012835
619 Ga0105243_10036965
620 Ga0105243_10410692
621 Ga0105242_10003913
622 Ga0105248_10580721
623 Ga0105248_11021996
624 Ga0105237_10064864
625 Ga0105237_10191999
626 Ga0105239_10006923
627 Ga0105239_10725666
628 Ga0105246_10023975
629 Ga0157370_10000990
630 Ga0157369_10088124
631 Ga0157369_10478157
632 Ga0157374_10014636
633 Ga0157378_10088641
634 Ga0163162_10185745
635 Ga0163162_10676986
636 Ga0163162_11442122
637 Ga0157375_10027229
638 Ga0157375_10064553
639 Ga0157375_10069620
640 Ga0157375_10244598
641 Ga0157375_10318235
642 Ga0163163_10023545
643 Ga0163163_10083747
644 Ga0163163_10200396
645 Ga0163163_11122183
646 Ga0157380_10176304
647 Ga0157380_10332731
648 Ga0157380_10448345
649 Ga0157379_10085135
650 Ga0157379_10269537
651 Ga0157376_10427555
652 Ga0213874_10019311
653 Ga0213876_10030975
654 Ga0213876_10120023
655 Ga0213875_10011267
656 Ga0213875_10104154
657 Ga0209565_1000097
658 Ga0209673_1025217
659 Ga0209675_1000804
660 Ga0209025_1001270
661 Ga0209564_1001135
662 Ga0209758_1054230
663 Ga0209256_1000528
664 Ga0209256_1000597
665 Ga0207645_10001485
666 Ga0207645_10287387
667 Ga0207643_10003812
668 Ga0207684_10098948
669 Ga0207654_10022240
670 Ga0207695_10037500
671 Ga0207695_10114785
672 Ga0207671_10066851
673 Ga0207671_10246158
674 Ga0207662_10010958
675 Ga0207662_10068428
676 Ga0207652_10438487
677 Ga0207646_10032191
678 Ga0207646_10302800
679 Ga0207681_10003671
680 Ga0207694_10161508
681 Ga0207650_10086281
682 Ga0207659_10000704
683 Ga0207687_10019049
684 Ga0207687_10077297
685 Ga0207687_10222934
686 Ga0207687_10420205
687 Ga0207700_10184380
688 Ga0207644_10021978
689 Ga0207644_10052251
690 Ga0207690_10057684
691 Ga0207706_10152057
692 Ga0207706_10781845
693 Ga0207686_10001732
694 Ga0207686_10009466
695 Ga0207709_10037022
696 Ga0207709_10127909
697 Ga0207709_10235432
698 Ga0207670_10018573
699 Ga0207670_10039444
700 Ga0207704_10013370
701 Ga0207704_10015179
702 Ga0207704_10049574
703 Ga0207704_10464284
704 Ga0207691_10004143
705 Ga0207691_10177151
706 Ga0207691_10181081
707 Ga0207691_10227579
708 Ga0207689_10193334
709 Ga0207689_10203026
710 Ga0207689_10248049
711 Ga0207689_10515562
712 Ga0207661_10008036
713 Ga0207661_10378579
714 Ga0207667_10056062
715 Ga0207640_10136991
716 Ga0207658_10004620
717 Ga0207658_10195187
718 Ga0207677_10216633
719 Ga0207708_10026024
720 Ga0207708_10034243
721 Ga0207702_10061620
722 Ga0207702_10084207
723 Ga0207702_10216153
724 Ga0207702_10562751
725 Ga0207641_10056848
726 Ga0207641_10099334
727 Ga0207648_10001256
728 Ga0207648_10003372
729 Ga0207648_10182326
730 Ga0207676_10018156
731 Ga0207674_10003540
732 Ga0207674_10008465
733 Ga0207674_10019381
734 Ga0207675_100005174
735 Ga0207683_10033872
736 Ga0207683_10070172
737 Ga0207683_10079554
738 Ga0207428_10001064
739 Ga0207428_10163763
740 Ga0268266_10000181
741 Ga0268265_10000103
742 Ga0268264_10064477
743 Ga0268264_10289154
744 Ga0265334_10004304
745 Ga0265318_10000079
746 Ga0265336_10009614
747 Ga0307517_10085553
748 Ga0307517_10201860
749 Ga0307515_10026774
750 Ga0307515_10286943
751 Ga0307515_10346345
752 Ga0265338_10006074
753 Ga0265320_10000568
754 Ga0265325_10098455
755 Ga0265339_10123481
756 Ga0265331_10117165
757 Ga0265327_10000359
758 Ga0307513_10148481
759 Ga0307513_10292889
760 Ga0307509_10027259
761 Ga0307509_10124440
762 Ga0307408_100438025
763 Ga0265313_10015533
764 Ga0307508_10001066
765 Ga0307508_10105778
766 Ga0307514_10095119
767 Ga0265314_10070651
768 Ga0316578_10010035
769 Ga0307516_10038283
770 Ga0307405_10036250
771 Ga0307405_10038362
772 Ga0307405_10198654
773 Ga0307413_10554217
774 Ga0307413_10663411
775 Ga0307410_10162821
776 Ga0307410_10304860
777 Ga0307406_10033769
778 Ga0307406_10154752
779 Ga0307407_10026175
780 Ga0307407_10359136
781 Ga0307412_10251968
782 Ga0307412_10339954
783 Ga0307409_100019756
784 Ga0307409_100491026
785 Ga0307416_100001584
786 Ga0307416_100017396
787 Ga0307411_10047848
788 Ga0307411_10292398
789 Ga0307415_100016651
790 Ga0307415_100214154
791 Ga0307415_100308673
792 Ga0307415_100424132
793 Ga0316583_10073365
794 Ga0373934_0067750
795 Ga0373943_0077781
796 Ga0316574_0002067
797 Ga0373937_0013703
798 Ga0373937_0091867
799 Ga0316584_0070400
800 Ga0373925_0056755
801 Ga0373925_0235542
802 Ga0436365_0228452
803 Ga0436365_1867753
804 Ga0436363_0338443
805 Ga0436363_0417755
806 Ga0436362_0445683
807 Ga0439431_0078985
808 Ga0451577_0291850
809 Ga0466973_0038234
810 Ga0453684_0087517
811 Ga0466968_0096105
812 Ga0466957_0137705
813 Ga0451576_0023741
814 Ga0451576_0050642
815 Ga0451576_0074508
816 Ga0466967_0003337
817 Ga0466967_0214093
818 Ga0495592_0000291
819 Ga0495603_0043303
820 Ga0495603_0043739
821 Ga0495629_0000628
822 Ga0495653_0143559
823 Ga0495580_0319223
824 Ga0495582_0201229
825 Ga0495584_0031360
826 Ga0495584_0186108
827 Ga0495632_0016014
828 Ga0495644_0072168
829 Ga0495642_0003866
830 Ga0495598_0108864
831 Ga0495609_0010426
832 Ga0495609_0061970
833 Ga0495621_0002278
834 Ga0495621_0131266
835 Ga0495645_0087771
836 Ga0495659_0002076
837 Ga0495659_0006018
838 Ga0495659_0013172
839 Ga0495659_0036731
840 Ga0495647_0064086
841 Ga0495658_0051657
842 Ga0495658_0340940
843 Ga0495669_0063981
844 Ga0495670_0155988
845 Ga0495649_0001864
846 Ga0495589_0094384
847 Ga0495636_0060811
848 Ga0495676_0019722
849 Ga0495687_003808
850 Ga0495687_019864
851 Ga0495685_009891
852 Ga0495626_0048580
853 Ga0496100_0021189
854 Ga0496100_0044210
855 Ga0496101_0001701
856 Ga0496101_0120780
857 Ga0496101_0147547
858 Ga0496102_0051489
859 Ga0496103_0082763
860 Ga0496104_0004852
861 Ga0496104_0055156
862 Ga0496105_0018304
863 Ga0496105_0045330
864 Ga0496105_0709827
865 Ga0496106_0014023
866 Ga0496106_0066052
867 Ga0496107_0045647
868 Ga0496108_0001399
869 Ga0496108_0117099
870 Ga0496109_0082356
871 Ga0496109_0176570
872 Ga0496110_0002306
873 Ga0496110_0126965
874 Ga0496111_0005213
875 Ga0496111_0421345
876 Ga0496112_0047244
877 Ga0496112_0281929
878 Ga0496113_0031964
879 Ga0496114_0064373
880 Ga0496115_0010151
881 Ga0496126_0000003
882 Ga0501037_0051549
883 Ga0501039_0005099
884 Ga0501040_0081044
885 Ga0501041_0060036
886 Ga0501046_0303355
887 Ga0501048_0196429
888 Ga0501067_0020206
889 Ga0501067_0048075
890 Ga0501067_0135592
891 Ga0501071_0355017
892 Ga0501072_0016125
893 Ga0501072_0179152
894 Ga0501073_0037393
895 Ga0501073_0041604
896 Ga0501074_0015261
897 Ga0501075_0034971
898 Ga0501076_0094512
899 Ga0501076_0421023
900 Ga0501080_0705764
901 Ga0501083_0019200
902 Ga0501035_0128963
903 Ga0501045_0236526
904 nmdc:mga03n38_225037_c1
905 nmdc:mga0k408_198538_c1
906 nmdc:mga0k408_3678_c1
907 nmdc:mga0k408_4213_c1
908 nmdc:mga0k408_823_c1
909 nmdc:mga0k408_87212_c1
910 nmdc:mga07m45_210_c1
911 nmdc:mga07m45_226518_c1
912 nmdc:mga05p37_254453_c1
913 nmdc:mga05p37_79089_c1
914 nmdc:mga08y16_167612_c1
915 nmdc:mga08y16_20344_c1
916 nmdc:mga08y16_227825_c1
917 nmdc:mga0n895_379943_c1
918 nmdc:mga0n895_4669_c1
919 nmdc:mga0rr50_126817_c1
920 nmdc:mga0rr50_500980_c1
921 Ga0500641_0013638
922 Ga0500595_002168
923 Ga0500658_0006016
924 Ga0500568_0043760
925 Ga0500616_0000393
926 Ga0501084_0242475
927 Ga0501082_0052072
928 Ga0501082_0265605
929 Ga0530510_0381866
930 2583149665
931 2644303963
932 2838075655
933 2896388163
934 3003666812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

230

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

261

0.9

PF08659

KR

KR domain

36

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9581 8 236
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.936 8 236
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9264 8 236
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.905 8 236
6k8u-assembly1.cif.gz_B crystal structure of c-domain with nadp of baterial malonyl-coa reductase 0.9002 8 175
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9548 4 168 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9295 45 161 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9165 3 168 3.40.50.720
af_Q62730_83_351_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9131 7 178 3.40.50.720
af_Q20012_42_307_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.911 8 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C0Y7A3-F1-model_v4 3-oxoacyl-ACP reductase 0.9859 64 216 GO:0016491
AF-A0A535LZJ1-F1-model_v4 SDR family oxidoreductase 0.9768 3 177 GO:0016491
AF-A0A2V8BVN7-F1-model_v4 3-oxoacyl-ACP reductase 0.9753 67 199
AF-A0A0M4KMG1-F1-model_v4 deleted 0.975 45 236
AF-A0A0R3S4R7-F1-model_v4 ABC transporter domain-containing protein 0.9742 6 231 GO:0005524
GO:0008643
GO:0016491
GO:0016887
GO:0043190
GO:0140359

Map