F449904

General Info

Members Datasets Scaffolds Average Seq Length
467 172 934 481

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0005040|Ga0495669_0005040_3207_4733
Length 508
Sequence MLLPQVGDAWQGTMMKFRTLMAFTALVLGSAGATAPVLAPPPAQLGPDVQPFVHVGPGRIAITHLRIIDGTGAAPVEDATLLIDGAKIAAVQPAGSAIPDGYRTIDGTGETTFPGLVGMHNHLFYLQRPNLDAAGHSEQPVIVPQMTFSAPRLYLANGVTTMRTTGSVETYTDLALKREIDAGHLVGPHLDVTGPYLEGPGAFFIQNHQITSPEDARREVAFWADQGVNSFKAYMNITRAELKAAIGEAHRRGLKVTGHLCSVTYPEAVALGIDNLEHGFFVNTQLDPGKQPDKCSEGTGTPTLLAMKPGSPQADALIKLLVDHHVAITSTLPVFEQSVPLHAPLQARQMDVLTPQAKESYLYLRNLTASRAGTPRAQQFAEAYKNDLGLERQFVAAGGLLIAGPDPTGNGGVIPGFGDQREIELLVEAGFTPVEAIRIGTLNGATYLGLQDRIGSIAAGKNADLVIVKGNPAANIADVENVLLVFKDGVGYDSAKLLDSVKGRFGQY

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 6.64
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0005040 3300046684 Bacteria 5489
2 JGI24740J21852_10000967 3300001979 Bacteria 12788
3 JGI24740J21852_10003822 3300001979 Bacteria 6546
4 JGI24737J22298_10000117 3300001990 Bacteria 24179
5 JGI24737J22298_10006347 3300001990 Bacteria 4042
6 JGI24735J21928_10001342 3300002067 Bacteria 8703
7 JGI24735J21928_10002444 3300002067 Bacteria 6451
8 JGI24738J21930_10001166 3300002075 Bacteria 7419
9 JGI24744J21845_10004490 3300002077 Bacteria 2884
10 Ga0070658_10011752 3300005327 Bacteria 7026
11 Ga0070658_10028774 3300005327 Bacteria 4461
12 Ga0070658_10032765 3300005327 Bacteria 4178
13 Ga0070676_10011463 3300005328 Bacteria 4820
14 Ga0070683_100050064 3300005329 Unclassified 3866
15 Ga0070683_100056273 3300005329 Bacteria 3652
16 Ga0070690_100004623 3300005330 Bacteria 7660
17 Ga0070670_100013411 3300005331 Bacteria 7020
18 Ga0070670_100048872 3300005331 Unclassified 3639
19 Ga0068869_100056316 3300005334 Bacteria 2867
20 Ga0070666_10002097 3300005335 Bacteria 12118
21 Ga0070666_10023313 3300005335 Bacteria 4029
22 Ga0070666_10059490 3300005335 Bacteria 2584
23 Ga0070680_100054893 3300005336 Bacteria 3254
24 Ga0070680_100080496 3300005336 Unclassified 2686
25 Ga0070682_100053308 3300005337 Unclassified 2534
26 Ga0068868_100000041 3300005338 Bacteria 69601
27 Ga0068868_100001494 3300005338 Bacteria 16135
28 Ga0068868_100021883 3300005338 Bacteria 4820
29 Ga0068868_100024205 3300005338 Unclassified 4604
30 Ga0070660_100009651 3300005339 Bacteria 6797
31 Ga0070660_100018165 3300005339 Bacteria 5133
32 Ga0070660_100045945 3300005339 Bacteria 3345
33 Ga0070660_100081254 3300005339 Bacteria 2544
34 Ga0070661_100010995 3300005344 Bacteria 6307
35 Ga0070661_100028074 3300005344 Unclassified 4057
36 Ga0070661_100029703 3300005344 Bacteria 3946
37 Ga0070661_100060521 3300005344 Unclassified 2778
38 Ga0070668_100017056 3300005347 Bacteria 5433
39 Ga0070668_100070104 3300005347 Bacteria 2728
40 Ga0070669_100000556 3300005353 Bacteria 27730
41 Ga0070669_100119503 3300005353 Bacteria 2008
42 Ga0070671_100000229 3300005355 Bacteria 37462
43 Ga0070671_100002741 3300005355 Bacteria 13682
44 Ga0070671_100020496 3300005355 Bacteria 5392
45 Ga0070671_100112646 3300005355 Unclassified 2285
46 Ga0070671_100132084 3300005355 Bacteria 2103
47 Ga0070673_100001837 3300005364 Bacteria 12679
48 Ga0070673_100003792 3300005364 Bacteria 9486
49 Ga0070673_100005185 3300005364 Bacteria 8321
50 Ga0070673_100063367 3300005364 Bacteria 2941
51 Ga0070673_100161061 3300005364 Bacteria 1908
52 Ga0070659_100001959 3300005366 Bacteria 14698
53 Ga0070659_100019798 3300005366 Bacteria 5108
54 Ga0070659_100028358 3300005366 Unclassified 4322
55 Ga0070659_100066550 3300005366 Bacteria 2855
56 Ga0070659_100086206 3300005366 Bacteria 2512
57 Ga0070667_100000368 3300005367 Bacteria 49069
58 Ga0070667_100001265 3300005367 Bacteria 22928
59 Ga0070667_100008385 3300005367 Bacteria 8568
60 Ga0070667_100022665 3300005367 Bacteria 5207
61 Ga0070667_100063709 3300005367 Bacteria 3125
62 Ga0070694_100050138 3300005444 Bacteria 2813
63 Ga0070663_100041626 3300005455 Bacteria 3224
64 Ga0070663_100047447 3300005455 Bacteria 3042
65 Ga0070678_100008539 3300005456 Bacteria 6137
66 Ga0070678_100038595 3300005456 Bacteria 3364
67 Ga0070678_100095938 3300005456 Bacteria 2286
68 Ga0070662_100000733 3300005457 Bacteria 20056
69 Ga0070662_100015643 3300005457 Bacteria 5086
70 Ga0070662_100021407 3300005457 Unclassified 4414
71 Ga0070662_100120387 3300005457 Bacteria 2011
72 Ga0070681_10050182 3300005458 Bacteria 4164
73 Ga0070681_10084762 3300005458 Bacteria 3121
74 Ga0068867_100006812 3300005459 Bacteria 8078
75 Ga0068867_100019965 3300005459 Bacteria 4774
76 Ga0068867_100020173 3300005459 Bacteria 4749
77 Ga0070685_10035609 3300005466 Bacteria 2809
78 Ga0070679_100099160 3300005530 Bacteria 2900
79 Ga0068853_100004031 3300005539 Bacteria 11299
80 Ga0068853_100053193 3300005539 Bacteria 3487
81 Ga0070672_100002430 3300005543 Bacteria 11812
82 Ga0070672_100021222 3300005543 Unclassified 4749
83 Ga0070686_100009829 3300005544 Bacteria 5374
84 Ga0070693_100037082 3300005547 Bacteria 2716
85 Ga0070665_100008322 3300005548 Bacteria 10490
86 Ga0070665_100027762 3300005548 Bacteria 5699
87 Ga0070665_100034387 3300005548 Bacteria 5097
88 Ga0070665_100071869 3300005548 Bacteria 3467
89 Ga0068855_100021054 3300005563 Bacteria 7819
90 Ga0068855_100069933 3300005563 Bacteria 4084
91 Ga0070664_100003472 3300005564 Bacteria 12729
92 Ga0070664_100037659 3300005564 Bacteria 4067
93 Ga0070664_100092221 3300005564 Bacteria 2622
94 Ga0068857_100011228 3300005577 Bacteria 7789
95 Ga0068857_100021633 3300005577 Bacteria 5659
96 Ga0068857_100022637 3300005577 Bacteria 5527
97 Ga0068857_100034319 3300005577 Bacteria 4487
98 Ga0068854_100005087 3300005578 Bacteria 8285
99 Ga0068854_100008007 3300005578 Bacteria 6772
100 Ga0068854_100011551 3300005578 Bacteria 5757
101 Ga0068854_100062760 3300005578 Bacteria 2695
102 Ga0068856_100011495 3300005614 Bacteria 8594
103 Ga0068856_100045970 3300005614 Bacteria 4300
104 Ga0068856_100057851 3300005614 Bacteria 3828
105 Ga0068852_100004942 3300005616 Bacteria 9470
106 Ga0068852_100027389 3300005616 Bacteria 4645
107 Ga0068852_100044626 3300005616 Bacteria 3766
108 Ga0068852_100060688 3300005616 Bacteria 3283
109 Ga0068852_100138948 3300005616 Bacteria 2246
110 Ga0068859_100000281 3300005617 Bacteria 50775
111 Ga0068859_100007305 3300005617 Bacteria 11205
112 Ga0068859_100018251 3300005617 Bacteria 7053
113 Ga0068859_100085377 3300005617 Bacteria 3202
114 Ga0068859_100135709 3300005617 Bacteria 2533
115 Ga0068864_100000261 3300005618 Bacteria 47015
116 Ga0068864_100000721 3300005618 Bacteria 27640
117 Ga0068864_100082335 3300005618 Bacteria 2824
118 Ga0068866_10011055 3300005718 Bacteria 3891
119 Ga0068851_10019774 3300005834 Bacteria 3254
120 Ga0068851_10036605 3300005834 Unclassified 2457
121 Ga0068851_10072766 3300005834 Unclassified 1781
122 Ga0068863_100007677 3300005841 Bacteria 10551
123 Ga0068863_100015602 3300005841 Bacteria 7299
124 Ga0068863_100072482 3300005841 Bacteria 3258
125 Ga0068863_100106052 3300005841 Bacteria 2673
126 Ga0068858_100000919 3300005842 Bacteria 30552
127 Ga0068858_100004078 3300005842 Bacteria 14394
128 Ga0068858_100008371 3300005842 Bacteria 9949
129 Ga0068858_100011834 3300005842 Bacteria 8227
130 Ga0068858_100239400 3300005842 Bacteria 1722
131 Ga0068860_100000867 3300005843 Bacteria 33656
132 Ga0068860_100004735 3300005843 Bacteria 13869
133 Ga0068860_100007585 3300005843 Bacteria 10857
134 Ga0068860_100029722 3300005843 Bacteria 5257
135 Ga0068860_100041104 3300005843 Bacteria 4417
136 Ga0068860_100045423 3300005843 Bacteria 4189
137 Ga0068860_100248271 3300005843 Bacteria 1732
138 Ga0068862_100005057 3300005844 Bacteria 11094
139 Ga0068862_100188543 3300005844 Bacteria 1854
140 Ga0070717_10121109 3300006028 Unclassified 2241
141 Ga0070712_100007135 3300006175 Bacteria 6970
142 Ga0097621_100003267 3300006237 Bacteria 11149
143 Ga0097621_100023713 3300006237 Bacteria 4781
144 Ga0097621_100052427 3300006237 Unclassified 3323
145 Ga0068871_100002294 3300006358 Bacteria 13025
146 Ga0068871_100020888 3300006358 Bacteria 5022
147 Ga0068871_100064942 3300006358 Bacteria 2988
148 Ga0075433_10011356 3300006852 Bacteria 7169
149 Ga0068865_100013656 3300006881 Bacteria 5141
150 Ga0097620_100000281 3300006931 Bacteria 50775
151 Ga0097620_100007305 3300006931 Bacteria 11205
152 Ga0097620_100018253 3300006931 Bacteria 7053
153 Ga0097620_100085378 3300006931 Bacteria 3202
154 Ga0097620_100135711 3300006931 Bacteria 2533
155 Ga0105240_10019712 3300009093 Bacteria 9008
156 Ga0105240_10025845 3300009093 Bacteria 7709
157 Ga0105240_10106825 3300009093 Bacteria 3394
158 Ga0105240_10112016 3300009093 Unclassified 3300
159 Ga0105245_10000433 3300009098 Bacteria 38731
160 Ga0105245_10012579 3300009098 Bacteria 7367
161 Ga0105245_10031400 3300009098 Bacteria 4700
162 Ga0105243_10020979 3300009148 Bacteria 4957
163 Ga0105243_10138115 3300009148 Bacteria 2076
164 Ga0105242_10013470 3300009176 Bacteria 6322
165 Ga0105248_10000502 3300009177 Bacteria 44596
166 Ga0105248_10004636 3300009177 Bacteria 15205
167 Ga0105248_10007361 3300009177 Bacteria 12080
168 Ga0105248_10010830 3300009177 Bacteria 10069
169 Ga0105248_10015210 3300009177 Bacteria 8480
170 Ga0105248_10071753 3300009177 Bacteria 3891
171 Ga0105248_10122303 3300009177 Bacteria 2936
172 Ga0105237_10078100 3300009545 Bacteria 3300
173 Ga0105238_10006284 3300009551 Bacteria 11808
174 Ga0105238_10051108 3300009551 Unclassified 4158
175 Ga0105238_10051962 3300009551 Bacteria 4121
176 Ga0105238_10143417 3300009551 Bacteria 2365
177 Ga0105249_10044928 3300009553 Bacteria 4017
178 Ga0105249_10050321 3300009553 Bacteria 3799
179 Ga0105239_10029465 3300010375 Bacteria 6035
180 Ga0105246_10010349 3300011119 Bacteria 5769
181 Ga0157373_10077080 3300013100 Bacteria 2352
182 Ga0157371_10001574 3300013102 Bacteria 23422
183 Ga0157371_10006595 3300013102 Bacteria 9539
184 Ga0157371_10060685 3300013102 Bacteria 2681
185 Ga0157370_10053279 3300013104 Bacteria 3858
186 Ga0157370_10144430 3300013104 Unclassified 2216
187 Ga0157369_10004144 3300013105 Bacteria 17177
188 Ga0157369_10027440 3300013105 Bacteria 6312
189 Ga0157369_10070853 3300013105 Bacteria 3744
190 Ga0157369_10196369 3300013105 Bacteria 2119
191 Ga0157374_10008752 3300013296 Bacteria 8660
192 Ga0157374_10023660 3300013296 Bacteria 5497
193 Ga0157378_10004424 3300013297 Bacteria 12369
194 Ga0157378_10009588 3300013297 Bacteria 8431
195 Ga0157378_10018746 3300013297 Bacteria 6083
196 Ga0163162_10016387 3300013306 Bacteria 7244
197 Ga0163162_10016711 3300013306 Bacteria 7172
198 Ga0163162_10035083 3300013306 Unclassified 4995
199 Ga0157375_10010809 3300013308 Bacteria 8041
200 Ga0157375_10019402 3300013308 Bacteria 6184
201 Ga0163163_10016395 3300014325 Bacteria 6884
202 Ga0157379_10001085 3300014968 Bacteria 22205
203 Ga0157379_10028309 3300014968 Bacteria 4987
204 Ga0157379_10050940 3300014968 Bacteria 3697
205 Ga0157379_10054584 3300014968 Bacteria 3570
206 Ga0157376_10022442 3300014969 Bacteria 4921
207 Ga0207697_10000296 3300025315 Bacteria 27773
208 Ga0207656_10006684 3300025321 Bacteria 4165
209 Ga0207642_10007316 3300025899 Bacteria 3721
210 Ga0207688_10003923 3300025901 Bacteria 8111
211 Ga0207688_10032669 3300025901 Bacteria 2877
212 Ga0207688_10061060 3300025901 Bacteria 2124
213 Ga0207680_10000959 3300025903 Bacteria 13596
214 Ga0207680_10018921 3300025903 Bacteria 3674
215 Ga0207680_10036663 3300025903 Bacteria 2825
216 Ga0207647_10000047 3300025904 Bacteria 89112
217 Ga0207647_10006533 3300025904 Bacteria 8472
218 Ga0207647_10006730 3300025904 Bacteria 8345
219 Ga0207647_10010505 3300025904 Bacteria 6538
220 Ga0207647_10028332 3300025904 Bacteria 3640
221 Ga0207645_10001679 3300025907 Bacteria 18006
222 Ga0207645_10008193 3300025907 Bacteria 7317
223 Ga0207645_10008603 3300025907 Bacteria 7108
224 Ga0207645_10027926 3300025907 Bacteria 3643
225 Ga0207645_10039994 3300025907 Bacteria 3004
226 Ga0207645_10066581 3300025907 Bacteria 2303
227 Ga0207705_10017357 3300025909 Bacteria 5155
228 Ga0207705_10029540 3300025909 Bacteria 3907
229 Ga0207705_10029987 3300025909 Bacteria 3880
230 Ga0207705_10041355 3300025909 Unclassified 3307
231 Ga0207705_10044221 3300025909 Bacteria 3200
232 Ga0207705_10045556 3300025909 Bacteria 3152
233 Ga0207707_10064126 3300025912 Bacteria 3198
234 Ga0207695_10024862 3300025913 Bacteria 6722
235 Ga0207695_10067743 3300025913 Unclassified 3660
236 Ga0207693_10080970 3300025915 Bacteria 2542
237 Ga0207660_10014103 3300025917 Bacteria 5247
238 Ga0207660_10028641 3300025917 Unclassified 3811
239 Ga0207660_10158681 3300025917 Bacteria 1743
240 Ga0207657_10003423 3300025919 Bacteria 16942
241 Ga0207657_10003711 3300025919 Bacteria 16232
242 Ga0207657_10005157 3300025919 Bacteria 13704
243 Ga0207657_10013861 3300025919 Bacteria 7889
244 Ga0207657_10014022 3300025919 Bacteria 7842
245 Ga0207657_10075183 3300025919 Bacteria 2851
246 Ga0207649_10015373 3300025920 Bacteria 4300
247 Ga0207649_10019162 3300025920 Bacteria 3908
248 Ga0207652_10023831 3300025921 Bacteria 5074
249 Ga0207694_10040782 3300025924 Bacteria 3576
250 Ga0207694_10045319 3300025924 Bacteria 3397
251 Ga0207694_10058567 3300025924 Unclassified 2996
252 Ga0207650_10005752 3300025925 Bacteria 8457
253 Ga0207650_10092280 3300025925 Bacteria 2316
254 Ga0207650_10103187 3300025925 Unclassified 2198
255 Ga0207687_10008683 3300025927 Bacteria 6639
256 Ga0207687_10046859 3300025927 Bacteria 2995
257 Ga0207700_10072646 3300025928 Bacteria 2653
258 Ga0207644_10000337 3300025931 Bacteria 30381
259 Ga0207644_10001265 3300025931 Bacteria 16259
260 Ga0207644_10001415 3300025931 Bacteria 15455
261 Ga0207644_10054024 3300025931 Bacteria 2892
262 Ga0207644_10068765 3300025931 Bacteria 2584
263 Ga0207690_10003458 3300025932 Bacteria 9422
264 Ga0207690_10026446 3300025932 Bacteria 3654
265 Ga0207690_10046981 3300025932 Bacteria 2862
266 Ga0207690_10113844 3300025932 Bacteria 1953
267 Ga0207690_10134041 3300025932 Unclassified 1816
268 Ga0207690_10143287 3300025932 Bacteria 1764
269 Ga0207706_10000103 3300025933 Bacteria 89756
270 Ga0207706_10008086 3300025933 Bacteria 9707
271 Ga0207706_10029629 3300025933 Bacteria 4885
272 Ga0207669_10029986 3300025937 Bacteria 3017
273 Ga0207704_10100134 3300025938 Bacteria 1929
274 Ga0207691_10000586 3300025940 Bacteria 36317
275 Ga0207691_10006859 3300025940 Bacteria 10988
276 Ga0207691_10008566 3300025940 Bacteria 9819
277 Ga0207691_10015125 3300025940 Bacteria 7343
278 Ga0207691_10076398 3300025940 Bacteria 3018
279 Ga0207711_10000042 3300025941 Bacteria 158782
280 Ga0207711_10001952 3300025941 Bacteria 18719
281 Ga0207711_10002857 3300025941 Bacteria 15139
282 Ga0207711_10004112 3300025941 Bacteria 12473
283 Ga0207711_10004844 3300025941 Bacteria 11439
284 Ga0207711_10011758 3300025941 Bacteria 7271
285 Ga0207711_10146055 3300025941 Bacteria 2131
286 Ga0207689_10000242 3300025942 Bacteria 48659
287 Ga0207689_10074392 3300025942 Bacteria 2791
288 Ga0207661_10123815 3300025944 Unclassified 2205
289 Ga0207679_10010510 3300025945 Bacteria 5963
290 Ga0207679_10010627 3300025945 Bacteria 5932
291 Ga0207679_10030243 3300025945 Unclassified 3779
292 Ga0207679_10087191 3300025945 Bacteria 2403
293 Ga0207667_10021080 3300025949 Bacteria 7228
294 Ga0207667_10033204 3300025949 Bacteria 5552
295 Ga0207667_10038143 3300025949 Bacteria 5133
296 Ga0207667_10048964 3300025949 Bacteria 4466
297 Ga0207667_10096349 3300025949 Bacteria 3053
298 Ga0207667_10183555 3300025949 Bacteria 2148
299 Ga0207651_10004760 3300025960 Bacteria 6896
300 Ga0207651_10005130 3300025960 Bacteria 6686
301 Ga0207651_10005791 3300025960 Bacteria 6382
302 Ga0207651_10010629 3300025960 Bacteria 5110
303 Ga0207651_10079126 3300025960 Unclassified 2361
304 Ga0207712_10001308 3300025961 Bacteria 17062
305 Ga0207668_10001278 3300025972 Bacteria 14997
306 Ga0207640_10000173 3300025981 Bacteria 46801
307 Ga0207640_10005481 3300025981 Bacteria 6919
308 Ga0207640_10006524 3300025981 Bacteria 6405
309 Ga0207658_10011801 3300025986 Bacteria 5953
310 Ga0207658_10059209 3300025986 Unclassified 2853
311 Ga0207677_10002057 3300026023 Bacteria 10601
312 Ga0207677_10011755 3300026023 Bacteria 5003
313 Ga0207703_10005559 3300026035 Bacteria 10116
314 Ga0207703_10006075 3300026035 Bacteria 9658
315 Ga0207703_10008455 3300026035 Bacteria 8132
316 Ga0207703_10035421 3300026035 Bacteria 3967
317 Ga0207703_10047162 3300026035 Bacteria 3473
318 Ga0207703_10098029 3300026035 Bacteria 2478
319 Ga0207703_10103631 3300026035 Bacteria 2416
320 Ga0207639_10002541 3300026041 Bacteria 12243
321 Ga0207639_10009370 3300026041 Bacteria 6752
322 Ga0207639_10062387 3300026041 Unclassified 2882
323 Ga0207678_10008758 3300026067 Bacteria 8903
324 Ga0207678_10023693 3300026067 Bacteria 5368
325 Ga0207678_10101223 3300026067 Bacteria 2461
326 Ga0207678_10150451 3300026067 Bacteria 1987
327 Ga0207702_10024179 3300026078 Bacteria 5040
328 Ga0207641_10000415 3300026088 Bacteria 49760
329 Ga0207641_10004170 3300026088 Bacteria 12597
330 Ga0207641_10009260 3300026088 Bacteria 8119
331 Ga0207641_10025981 3300026088 Bacteria 4831
332 Ga0207648_10001953 3300026089 Bacteria 22530
333 Ga0207648_10010578 3300026089 Bacteria 8729
334 Ga0207648_10012180 3300026089 Bacteria 8057
335 Ga0207648_10013891 3300026089 Bacteria 7468
336 Ga0207676_10000456 3300026095 Bacteria 34458
337 Ga0207676_10057618 3300026095 Bacteria 3060
338 Ga0207674_10000283 3300026116 Bacteria 64153
339 Ga0207674_10000632 3300026116 Bacteria 45854
340 Ga0207674_10003420 3300026116 Bacteria 19432
341 Ga0207674_10013160 3300026116 Bacteria 9207
342 Ga0207674_10044158 3300026116 Bacteria 4592
343 Ga0207674_10048511 3300026116 Unclassified 4346
344 Ga0207674_10049012 3300026116 Bacteria 4321
345 Ga0207674_10058956 3300026116 Bacteria 3887
346 Ga0207674_10135114 3300026116 Bacteria 2428
347 Ga0207675_100056720 3300026118 Bacteria 3653
348 Ga0207683_10006743 3300026121 Bacteria 9827
349 Ga0207683_10008442 3300026121 Bacteria 8816
350 Ga0207683_10030481 3300026121 Bacteria 4674
351 Ga0207683_10038904 3300026121 Bacteria 4148
352 Ga0207698_10007179 3300026142 Bacteria 6977
353 Ga0207698_10017206 3300026142 Bacteria 4898
354 Ga0207698_10128282 3300026142 Bacteria 2162
355 Ga0268266_10010115 3300028379 Bacteria 8271
356 Ga0268266_10031298 3300028379 Bacteria 4517
357 Ga0268266_10072164 3300028379 Bacteria 2993
358 Ga0268265_10006133 3300028380 Bacteria 8155
359 Ga0268265_10010146 3300028380 Bacteria 6359
360 Ga0268265_10033066 3300028380 Bacteria 3756
361 Ga0268265_10051546 3300028380 Bacteria 3106
362 Ga0268264_10000750 3300028381 Bacteria 36591
363 Ga0268264_10020688 3300028381 Bacteria 5376
364 Ga0268264_10025853 3300028381 Bacteria 4794
365 Ga0268264_10028476 3300028381 Bacteria 4571
366 Ga0307513_10068957 3300031456 Bacteria 3702
367 Ga0373935_0007574 3300035692 Bacteria 6502
368 Ga0395899_0032731 3300037312 Bacteria 3907
369 Ga0395899_0051929 3300037312 Bacteria 3041
370 Ga0395900_0003748 3300037418 Bacteria 16331
371 Ga0395900_0005244 3300037418 Bacteria 13599
372 Ga0395900_0024063 3300037418 Bacteria 6233
373 Ga0395900_0028782 3300037418 Bacteria 5695
374 Ga0395900_0032720 3300037418 Bacteria 5348
375 Ga0395900_0040956 3300037418 Bacteria 4775
376 Ga0395900_0101932 3300037418 Bacteria 2948
377 Ga0395900_0119856 3300037418 Bacteria 2700
378 Ga0395900_0155710 3300037418 Bacteria 2334
379 Ga0395900_0239596 3300037418 Bacteria 1820
380 Ga0395898_0057843 3300037466 Unclassified 3776
381 Ga0395898_0067329 3300037466 Bacteria 3467
382 Ga0395898_0072160 3300037466 Bacteria 3335
383 Ga0395898_0077758 3300037466 Bacteria 3203
384 Ga0395905_0000092 3300037471 Bacteria 149300
385 Ga0395905_0004490 3300037471 Bacteria 14474
386 Ga0395905_0010895 3300037471 Bacteria 8805
387 Ga0395905_0015888 3300037471 Bacteria 7151
388 Ga0395905_0020413 3300037471 Bacteria 6276
389 Ga0395905_0026754 3300037471 Bacteria 5440
390 Ga0395905_0045074 3300037471 Bacteria 4137
391 Ga0395905_0046724 3300037471 Bacteria 4059
392 Ga0395905_0053029 3300037471 Bacteria 3796
393 Ga0395905_0088813 3300037471 Bacteria 2896
394 Ga0395905_0096984 3300037471 Bacteria 2768
395 Ga0395905_0106844 3300037471 Bacteria 2628
396 Ga0395905_0125340 3300037471 Bacteria 2415
397 Ga0395905_0158430 3300037471 Bacteria 2128
398 Ga0395905_0158691 3300037471 Bacteria 2126
399 Ga0395901_0014222 3300038443 Bacteria 8102
400 Ga0395901_0017953 3300038443 Bacteria 7222
401 Ga0395901_0043563 3300038443 Bacteria 4655
402 Ga0395901_0057509 3300038443 Bacteria 4044
403 Ga0395901_0081861 3300038443 Bacteria 3372
404 Ga0395901_0177026 3300038443 Bacteria 2237
405 Ga0436365_1881774 3300039437 Bacteria 5076
406 Ga0466961_0017191 3300044693 Bacteria 4646
407 Ga0466961_0047152 3300044693 Bacteria 2756
408 Ga0466963_0038251 3300044694 Unclassified 3136
409 Ga0466963_0041547 3300044694 Bacteria 3016
410 Ga0466964_0027925 3300044706 Bacteria 2219
411 Ga0466971_0004199 3300044719 Bacteria 6208
412 Ga0466971_0020734 3300044719 Bacteria 2921
413 Ga0466957_0011568 3300044842 Bacteria 5097
414 Ga0466959_0152588 3300045049 Unclassified 1627
415 Ga0466958_0012292 3300045836 Bacteria 4847
416 Ga0466967_0023562 3300045976 Bacteria 5048
417 Ga0466967_0033775 3300045976 Bacteria 4334
418 Ga0466967_0037499 3300045976 Bacteria 4149
419 Ga0466967_0043417 3300045976 Bacteria 3892
420 Ga0466967_0093409 3300045976 Bacteria 2737
421 Ga0495585_0053631 3300046492 Bacteria 2231
422 Ga0495621_0000267 3300046539 Bacteria 12474
423 Ga0495645_0033483 3300046543 Bacteria 3749
424 Ga0495668_0009427 3300046616 Bacteria 5997
425 Ga0495669_0005424 3300046684 Bacteria 5322
426 Ga0495669_0017503 3300046684 Unclassified 3077
427 Ga0495670_0036385 3300046691 Bacteria 2452
428 Ga0495677_0003651 3300047445 Bacteria 5956
429 Ga0495677_0006908 3300047445 Bacteria 4266
430 Ga0496100_0001078 3300048903 Bacteria 13164
431 Ga0496101_0001752 3300048904 Bacteria 13008
432 Ga0496101_0093900 3300048904 Unclassified 2235
433 Ga0496102_0040075 3300048905 Bacteria 4236
434 Ga0496103_0077624 3300048906 Bacteria 2085
435 Ga0496105_0003271 3300048908 Bacteria 11948
436 Ga0496106_0125756 3300048909 Unclassified 2007
437 Ga0496107_0001662 3300048910 Bacteria 13891
438 Ga0496107_0031051 3300048910 Unclassified 3810
439 Ga0496108_0003190 3300048911 Bacteria 13194
440 Ga0496108_0009534 3300048911 Bacteria 7866
441 Ga0496108_0014168 3300048911 Bacteria 6505
442 Ga0496109_0029131 3300048912 Bacteria 4942
443 Ga0496109_0080459 3300048912 Bacteria 3001
444 Ga0496110_0000819 3300048913 Bacteria 21801
445 Ga0496110_0010358 3300048913 Bacteria 7579
446 Ga0496110_0019562 3300048913 Bacteria 5701
447 Ga0496110_0032074 3300048913 Bacteria 4535
448 Ga0496111_0000373 3300048914 Bacteria 22307
449 Ga0496111_0024699 3300048914 Bacteria 4236
450 Ga0496111_0038711 3300048914 Bacteria 3417
451 Ga0496111_0051921 3300048914 Bacteria 2960
452 Ga0496112_0006544 3300048915 Bacteria 10249
453 Ga0496112_0025542 3300048915 Bacteria 5672
454 Ga0496112_0033154 3300048915 Bacteria 5018
455 Ga0496112_0075874 3300048915 Bacteria 3325
456 Ga0496113_0001651 3300048916 Bacteria 12587
457 Ga0496113_0007291 3300048916 Bacteria 7097
458 Ga0496113_0029755 3300048916 Bacteria 3947
459 Ga0496113_0181520 3300048916 Bacteria 1668
460 Ga0496114_0082646 3300048917 Bacteria 2715
461 Ga0496126_0002529 3300048929 Bacteria 24479
462 nmdc:mga0rr50_225100_c1 3300050513 Bacteria 1550
463 nmdc:mga0a205_6815_c1 3300050515 Bacteria 10335
464 Ga0500608_019379 3300053122 Bacteria 3119
465 Ga0500658_0000329 3300053134 Bacteria 21052
466 Ga0500616_0012217 3300053153 Bacteria 5031
467 Ga0466962_0006184 3300061719 Bacteria 5752
468 Ga0495669_0005040
469 JGI24740J21852_10000967
470 JGI24740J21852_10003822
471 JGI24737J22298_10000117
472 JGI24737J22298_10006347
473 JGI24735J21928_10001342
474 JGI24735J21928_10002444
475 JGI24738J21930_10001166
476 JGI24744J21845_10004490
477 Ga0070658_10011752
478 Ga0070658_10028774
479 Ga0070658_10032765
480 Ga0070676_10011463
481 Ga0070683_100050064
482 Ga0070683_100056273
483 Ga0070690_100004623
484 Ga0070670_100013411
485 Ga0070670_100048872
486 Ga0068869_100056316
487 Ga0070666_10002097
488 Ga0070666_10023313
489 Ga0070666_10059490
490 Ga0070680_100054893
491 Ga0070680_100080496
492 Ga0070682_100053308
493 Ga0068868_100000041
494 Ga0068868_100001494
495 Ga0068868_100021883
496 Ga0068868_100024205
497 Ga0070660_100009651
498 Ga0070660_100018165
499 Ga0070660_100045945
500 Ga0070660_100081254
501 Ga0070661_100010995
502 Ga0070661_100028074
503 Ga0070661_100029703
504 Ga0070661_100060521
505 Ga0070668_100017056
506 Ga0070668_100070104
507 Ga0070669_100000556
508 Ga0070669_100119503
509 Ga0070671_100000229
510 Ga0070671_100002741
511 Ga0070671_100020496
512 Ga0070671_100112646
513 Ga0070671_100132084
514 Ga0070673_100001837
515 Ga0070673_100003792
516 Ga0070673_100005185
517 Ga0070673_100063367
518 Ga0070673_100161061
519 Ga0070659_100001959
520 Ga0070659_100019798
521 Ga0070659_100028358
522 Ga0070659_100066550
523 Ga0070659_100086206
524 Ga0070667_100000368
525 Ga0070667_100001265
526 Ga0070667_100008385
527 Ga0070667_100022665
528 Ga0070667_100063709
529 Ga0070694_100050138
530 Ga0070663_100041626
531 Ga0070663_100047447
532 Ga0070678_100008539
533 Ga0070678_100038595
534 Ga0070678_100095938
535 Ga0070662_100000733
536 Ga0070662_100015643
537 Ga0070662_100021407
538 Ga0070662_100120387
539 Ga0070681_10050182
540 Ga0070681_10084762
541 Ga0068867_100006812
542 Ga0068867_100019965
543 Ga0068867_100020173
544 Ga0070685_10035609
545 Ga0070679_100099160
546 Ga0068853_100004031
547 Ga0068853_100053193
548 Ga0070672_100002430
549 Ga0070672_100021222
550 Ga0070686_100009829
551 Ga0070693_100037082
552 Ga0070665_100008322
553 Ga0070665_100027762
554 Ga0070665_100034387
555 Ga0070665_100071869
556 Ga0068855_100021054
557 Ga0068855_100069933
558 Ga0070664_100003472
559 Ga0070664_100037659
560 Ga0070664_100092221
561 Ga0068857_100011228
562 Ga0068857_100021633
563 Ga0068857_100022637
564 Ga0068857_100034319
565 Ga0068854_100005087
566 Ga0068854_100008007
567 Ga0068854_100011551
568 Ga0068854_100062760
569 Ga0068856_100011495
570 Ga0068856_100045970
571 Ga0068856_100057851
572 Ga0068852_100004942
573 Ga0068852_100027389
574 Ga0068852_100044626
575 Ga0068852_100060688
576 Ga0068852_100138948
577 Ga0068859_100000281
578 Ga0068859_100007305
579 Ga0068859_100018251
580 Ga0068859_100085377
581 Ga0068859_100135709
582 Ga0068864_100000261
583 Ga0068864_100000721
584 Ga0068864_100082335
585 Ga0068866_10011055
586 Ga0068851_10019774
587 Ga0068851_10036605
588 Ga0068851_10072766
589 Ga0068863_100007677
590 Ga0068863_100015602
591 Ga0068863_100072482
592 Ga0068863_100106052
593 Ga0068858_100000919
594 Ga0068858_100004078
595 Ga0068858_100008371
596 Ga0068858_100011834
597 Ga0068858_100239400
598 Ga0068860_100000867
599 Ga0068860_100004735
600 Ga0068860_100007585
601 Ga0068860_100029722
602 Ga0068860_100041104
603 Ga0068860_100045423
604 Ga0068860_100248271
605 Ga0068862_100005057
606 Ga0068862_100188543
607 Ga0070717_10121109
608 Ga0070712_100007135
609 Ga0097621_100003267
610 Ga0097621_100023713
611 Ga0097621_100052427
612 Ga0068871_100002294
613 Ga0068871_100020888
614 Ga0068871_100064942
615 Ga0075433_10011356
616 Ga0068865_100013656
617 Ga0097620_100000281
618 Ga0097620_100007305
619 Ga0097620_100018253
620 Ga0097620_100085378
621 Ga0097620_100135711
622 Ga0105240_10019712
623 Ga0105240_10025845
624 Ga0105240_10106825
625 Ga0105240_10112016
626 Ga0105245_10000433
627 Ga0105245_10012579
628 Ga0105245_10031400
629 Ga0105243_10020979
630 Ga0105243_10138115
631 Ga0105242_10013470
632 Ga0105248_10000502
633 Ga0105248_10004636
634 Ga0105248_10007361
635 Ga0105248_10010830
636 Ga0105248_10015210
637 Ga0105248_10071753
638 Ga0105248_10122303
639 Ga0105237_10078100
640 Ga0105238_10006284
641 Ga0105238_10051108
642 Ga0105238_10051962
643 Ga0105238_10143417
644 Ga0105249_10044928
645 Ga0105249_10050321
646 Ga0105239_10029465
647 Ga0105246_10010349
648 Ga0157373_10077080
649 Ga0157371_10001574
650 Ga0157371_10006595
651 Ga0157371_10060685
652 Ga0157370_10053279
653 Ga0157370_10144430
654 Ga0157369_10004144
655 Ga0157369_10027440
656 Ga0157369_10070853
657 Ga0157369_10196369
658 Ga0157374_10008752
659 Ga0157374_10023660
660 Ga0157378_10004424
661 Ga0157378_10009588
662 Ga0157378_10018746
663 Ga0163162_10016387
664 Ga0163162_10016711
665 Ga0163162_10035083
666 Ga0157375_10010809
667 Ga0157375_10019402
668 Ga0163163_10016395
669 Ga0157379_10001085
670 Ga0157379_10028309
671 Ga0157379_10050940
672 Ga0157379_10054584
673 Ga0157376_10022442
674 Ga0207697_10000296
675 Ga0207656_10006684
676 Ga0207642_10007316
677 Ga0207688_10003923
678 Ga0207688_10032669
679 Ga0207688_10061060
680 Ga0207680_10000959
681 Ga0207680_10018921
682 Ga0207680_10036663
683 Ga0207647_10000047
684 Ga0207647_10006533
685 Ga0207647_10006730
686 Ga0207647_10010505
687 Ga0207647_10028332
688 Ga0207645_10001679
689 Ga0207645_10008193
690 Ga0207645_10008603
691 Ga0207645_10027926
692 Ga0207645_10039994
693 Ga0207645_10066581
694 Ga0207705_10017357
695 Ga0207705_10029540
696 Ga0207705_10029987
697 Ga0207705_10041355
698 Ga0207705_10044221
699 Ga0207705_10045556
700 Ga0207707_10064126
701 Ga0207695_10024862
702 Ga0207695_10067743
703 Ga0207693_10080970
704 Ga0207660_10014103
705 Ga0207660_10028641
706 Ga0207660_10158681
707 Ga0207657_10003423
708 Ga0207657_10003711
709 Ga0207657_10005157
710 Ga0207657_10013861
711 Ga0207657_10014022
712 Ga0207657_10075183
713 Ga0207649_10015373
714 Ga0207649_10019162
715 Ga0207652_10023831
716 Ga0207694_10040782
717 Ga0207694_10045319
718 Ga0207694_10058567
719 Ga0207650_10005752
720 Ga0207650_10092280
721 Ga0207650_10103187
722 Ga0207687_10008683
723 Ga0207687_10046859
724 Ga0207700_10072646
725 Ga0207644_10000337
726 Ga0207644_10001265
727 Ga0207644_10001415
728 Ga0207644_10054024
729 Ga0207644_10068765
730 Ga0207690_10003458
731 Ga0207690_10026446
732 Ga0207690_10046981
733 Ga0207690_10113844
734 Ga0207690_10134041
735 Ga0207690_10143287
736 Ga0207706_10000103
737 Ga0207706_10008086
738 Ga0207706_10029629
739 Ga0207669_10029986
740 Ga0207704_10100134
741 Ga0207691_10000586
742 Ga0207691_10006859
743 Ga0207691_10008566
744 Ga0207691_10015125
745 Ga0207691_10076398
746 Ga0207711_10000042
747 Ga0207711_10001952
748 Ga0207711_10002857
749 Ga0207711_10004112
750 Ga0207711_10004844
751 Ga0207711_10011758
752 Ga0207711_10146055
753 Ga0207689_10000242
754 Ga0207689_10074392
755 Ga0207661_10123815
756 Ga0207679_10010510
757 Ga0207679_10010627
758 Ga0207679_10030243
759 Ga0207679_10087191
760 Ga0207667_10021080
761 Ga0207667_10033204
762 Ga0207667_10038143
763 Ga0207667_10048964
764 Ga0207667_10096349
765 Ga0207667_10183555
766 Ga0207651_10004760
767 Ga0207651_10005130
768 Ga0207651_10005791
769 Ga0207651_10010629
770 Ga0207651_10079126
771 Ga0207712_10001308
772 Ga0207668_10001278
773 Ga0207640_10000173
774 Ga0207640_10005481
775 Ga0207640_10006524
776 Ga0207658_10011801
777 Ga0207658_10059209
778 Ga0207677_10002057
779 Ga0207677_10011755
780 Ga0207703_10005559
781 Ga0207703_10006075
782 Ga0207703_10008455
783 Ga0207703_10035421
784 Ga0207703_10047162
785 Ga0207703_10098029
786 Ga0207703_10103631
787 Ga0207639_10002541
788 Ga0207639_10009370
789 Ga0207639_10062387
790 Ga0207678_10008758
791 Ga0207678_10023693
792 Ga0207678_10101223
793 Ga0207678_10150451
794 Ga0207702_10024179
795 Ga0207641_10000415
796 Ga0207641_10004170
797 Ga0207641_10009260
798 Ga0207641_10025981
799 Ga0207648_10001953
800 Ga0207648_10010578
801 Ga0207648_10012180
802 Ga0207648_10013891
803 Ga0207676_10000456
804 Ga0207676_10057618
805 Ga0207674_10000283
806 Ga0207674_10000632
807 Ga0207674_10003420
808 Ga0207674_10013160
809 Ga0207674_10044158
810 Ga0207674_10048511
811 Ga0207674_10049012
812 Ga0207674_10058956
813 Ga0207674_10135114
814 Ga0207675_100056720
815 Ga0207683_10006743
816 Ga0207683_10008442
817 Ga0207683_10030481
818 Ga0207683_10038904
819 Ga0207698_10007179
820 Ga0207698_10017206
821 Ga0207698_10128282
822 Ga0268266_10010115
823 Ga0268266_10031298
824 Ga0268266_10072164
825 Ga0268265_10006133
826 Ga0268265_10010146
827 Ga0268265_10033066
828 Ga0268265_10051546
829 Ga0268264_10000750
830 Ga0268264_10020688
831 Ga0268264_10025853
832 Ga0268264_10028476
833 Ga0307513_10068957
834 Ga0373935_0007574
835 Ga0395899_0032731
836 Ga0395899_0051929
837 Ga0395900_0003748
838 Ga0395900_0005244
839 Ga0395900_0024063
840 Ga0395900_0028782
841 Ga0395900_0032720
842 Ga0395900_0040956
843 Ga0395900_0101932
844 Ga0395900_0119856
845 Ga0395900_0155710
846 Ga0395900_0239596
847 Ga0395898_0057843
848 Ga0395898_0067329
849 Ga0395898_0072160
850 Ga0395898_0077758
851 Ga0395905_0000092
852 Ga0395905_0004490
853 Ga0395905_0010895
854 Ga0395905_0015888
855 Ga0395905_0020413
856 Ga0395905_0026754
857 Ga0395905_0045074
858 Ga0395905_0046724
859 Ga0395905_0053029
860 Ga0395905_0088813
861 Ga0395905_0096984
862 Ga0395905_0106844
863 Ga0395905_0125340
864 Ga0395905_0158430
865 Ga0395905_0158691
866 Ga0395901_0014222
867 Ga0395901_0017953
868 Ga0395901_0043563
869 Ga0395901_0057509
870 Ga0395901_0081861
871 Ga0395901_0177026
872 Ga0436365_1881774
873 Ga0466961_0017191
874 Ga0466961_0047152
875 Ga0466963_0038251
876 Ga0466963_0041547
877 Ga0466964_0027925
878 Ga0466971_0004199
879 Ga0466971_0020734
880 Ga0466957_0011568
881 Ga0466959_0152588
882 Ga0466958_0012292
883 Ga0466967_0023562
884 Ga0466967_0033775
885 Ga0466967_0037499
886 Ga0466967_0043417
887 Ga0466967_0093409
888 Ga0495585_0053631
889 Ga0495621_0000267
890 Ga0495645_0033483
891 Ga0495668_0009427
892 Ga0495669_0005424
893 Ga0495669_0017503
894 Ga0495670_0036385
895 Ga0495677_0003651
896 Ga0495677_0006908
897 Ga0496100_0001078
898 Ga0496101_0001752
899 Ga0496101_0093900
900 Ga0496102_0040075
901 Ga0496103_0077624
902 Ga0496105_0003271
903 Ga0496106_0125756
904 Ga0496107_0001662
905 Ga0496107_0031051
906 Ga0496108_0003190
907 Ga0496108_0009534
908 Ga0496108_0014168
909 Ga0496109_0029131
910 Ga0496109_0080459
911 Ga0496110_0000819
912 Ga0496110_0010358
913 Ga0496110_0019562
914 Ga0496110_0032074
915 Ga0496111_0000373
916 Ga0496111_0024699
917 Ga0496111_0038711
918 Ga0496111_0051921
919 Ga0496112_0006544
920 Ga0496112_0025542
921 Ga0496112_0033154
922 Ga0496112_0075874
923 Ga0496113_0001651
924 Ga0496113_0007291
925 Ga0496113_0029755
926 Ga0496113_0181520
927 Ga0496114_0082646
928 Ga0496126_0002529
929 nmdc:mga0rr50_225100_c1
930 nmdc:mga0a205_6815_c1
931 Ga0500608_019379
932 Ga0500658_0000329
933 Ga0500616_0012217
934 Ga0466962_0006184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

111

491

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p9b-assembly1.cif.gz_A crystal structure of putative prolidase from bifidobacterium longum 0.7739 34 479
3be7-assembly1.cif.gz_G crystal structure of zn-dependent arginine carboxypeptidase 0.7678 38 471
3mtw-assembly1.cif.gz_A crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine 0.7671 35 469
6i5s-assembly1.cif.gz_A ah, bottromycin amidohydrolase 0.7669 19 479
2p9b-assembly1.cif.gz_A crystal structure of putative prolidase from bifidobacterium longum 0.7667 34 479
ID Description Score Start End Superfamily
3be7A01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9105 433 471 2.30.40.10
4whbE01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9025 36 92 2.30.40.10
3gnhA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8862 37 93 2.30.40.10
6gddA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8727 37 92 2.30.40.10
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8558 37 92 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A6I4T1K6-F1-model_v4 Amidohydrolase family protein 0.961 28 486 GO:0016810
AF-A0A7V8XSC7-F1-model_v4 Amidohydrolase family protein 0.959 152 485 GO:0016810
AF-A0A2V7MMD8-F1-model_v4 Amidohydrolase 0.9581 203 486 GO:0016810
AF-A0A7Y2CA42-F1-model_v4 Amidohydrolase family protein 0.9518 188 486 GO:0016810
AF-A0A2V7MMD8-F1-model_v4 Amidohydrolase 0.9515 203 486 GO:0016810

Map