F449913

General Info

Members Datasets Scaffolds Average Seq Length
467 255 934 435

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000433|Ga0496125_0000433_47130_48647
Length 486
Sequence VQVASRSQGWFPWQAAQRSNTPKQDIPEGFALKGQTHLVDLGEMSSKYNRAHADPSVLTEGAGDMTKLSRREFLIPTAPGGIDYPIEKGATLRVLRWKRFVQGDEDLWNENVKKFTELTGVPVRTDSEGFEDVRPKAAVAANVGSGPDIVLGWFDDPHQYPTKLLDVSDLANSLGSRYGGWYDVFQKYGKSNGKWIAIPLGVIGICLVYRDSHLKAAGFEAVPKDLPGFLKMAQALKAKNTPIGFAHGKAVGDANNYAHWLLWAHGGKLVDEHGSVVINSAETRAALEYGKQLYQTMVQGTLSWQDPSNNKAYLDGQVSLTNNGISIYYAAKNSTDPKLLELAKDTQHTHYPIGVSGKPTELMQLTQMMAFKHTKYPNAAKAFLQFMMEPDQFNPWMKAAIGYVSQPLKAYEKNPVWTADPKATPYRDAASLMLDHGHAGPLGQASAACLADYVLVDMVAEAASGSKTVQQAIDRAAERAKRFYKT

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
228 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
229 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
230 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
231 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
232 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
233 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
234 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
235 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
236 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
237 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
238 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
239 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
240 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
241 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
242 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
243 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
244 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
245 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
246 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
247 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
248 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
249 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
250 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
251 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
252 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
253 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
254 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
255 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.86
Metatranscriptomes 0.64
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.42
Nodule 1.28
Rhizoplane 3.21
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0000433 3300048928 Bacteria 76686
2 JGI25155J39150_1000076 3300002704 Bacteria 59158
3 JGI25156J39149_1000032 3300002705 Bacteria 118609
4 JGI25156J39149_1000675 3300002705 Bacteria 18418
5 JGI25156J39149_1007399 3300002705 Bacteria 2889
6 JGI25162J39368_1001832 3300002737 Bacteria 9928
7 JGI25154J39366_1000095 3300002738 Bacteria 79187
8 JGI25157J39369_1000212 3300002741 Bacteria 48259
9 JGI25157J39369_1001106 3300002741 Bacteria 12030
10 JGI25151J46595_10001193 3300003187 Bacteria 18647
11 JGI25151J46595_10009780 3300003187 Bacteria 4515
12 Ga0055538_1000054 3300003751 Bacteria 123566
13 Ga0055539_1000066 3300003752 Bacteria 136557
14 Ga0055533_1000076 3300003756 Bacteria 136557
15 Ga0055532_1000083 3300003758 Bacteria 118609
16 Ga0055532_1000157 3300003758 Bacteria 59670
17 Ga0055525_1000098 3300003759 Bacteria 136557
18 Ga0055535_1001985 3300003761 Bacteria 8446
19 Ga0055526_1000723 3300003771 Bacteria 24955
20 Ga0055526_1006049 3300003771 Bacteria 6703
21 Ga0055524_1001068 3300003775 Bacteria 16849
22 Ga0055536_1000219 3300003781 Bacteria 46718
23 Ga0055534_1001363 3300003784 Bacteria 9779
24 Ga0055540_1009900 3300003792 Bacteria 3228
25 Ga0055531_10000192 3300003794 Bacteria 67874
26 Ga0055541_1000056 3300003841 Bacteria 123566
27 Ga0070658_10012521 3300005327 Bacteria 6805
28 Ga0070690_100005910 3300005330 Bacteria 6903
29 Ga0070677_10033357 3300005333 Bacteria 1982
30 Ga0068869_100001111 3300005334 Bacteria 15680
31 Ga0068869_100023373 3300005334 Bacteria 4268
32 Ga0068869_100102908 3300005334 Bacteria 2163
33 Ga0070666_10139530 3300005335 Unclassified 1688
34 Ga0070680_100084832 3300005336 Bacteria 2616
35 Ga0070682_100112170 3300005337 Bacteria 1819
36 Ga0068868_100008536 3300005338 Bacteria 7336
37 Ga0068868_100017828 3300005338 Bacteria 5296
38 Ga0068868_100068076 3300005338 Archaea 2834
39 Ga0068868_100203660 3300005338 Bacteria 1651
40 Ga0068868_100268693 3300005338 Bacteria 1440
41 Ga0070689_100009272 3300005340 Bacteria 6973
42 Ga0070689_100010513 3300005340 Bacteria 6597
43 Ga0070691_10009266 3300005341 Bacteria 4499
44 Ga0070661_100060602 3300005344 Bacteria 2777
45 Ga0070692_10001690 3300005345 Bacteria 8182
46 Ga0070692_10009480 3300005345 Bacteria 4393
47 Ga0070692_10035362 3300005345 Bacteria 2529
48 Ga0070692_10048469 3300005345 Bacteria 2201
49 Ga0070668_100012754 3300005347 Bacteria 6255
50 Ga0070675_100010314 3300005354 Bacteria 7293
51 Ga0070673_100126913 3300005364 Bacteria 2136
52 Ga0070688_100054905 3300005365 Bacteria 2497
53 Ga0070659_100071131 3300005366 Bacteria 2765
54 Ga0070659_100073701 3300005366 Bacteria 2718
55 Ga0070659_100195696 3300005366 Bacteria 1663
56 Ga0070714_100005537 3300005435 Bacteria 9645
57 Ga0070701_10000947 3300005438 Bacteria 10503
58 Ga0070701_10008850 3300005438 Bacteria 4377
59 Ga0070700_100001391 3300005441 Bacteria 12017
60 Ga0070700_100008103 3300005441 Bacteria 5712
61 Ga0070700_100165086 3300005441 Bacteria 1528
62 Ga0070694_100051267 3300005444 Bacteria 2785
63 Ga0070708_100000292 3300005445 Bacteria 37727
64 Ga0070708_100008387 3300005445 Bacteria 8297
65 Ga0070708_100077567 3300005445 Bacteria 3002
66 Ga0070708_100100984 3300005445 Bacteria 2641
67 Ga0070678_100067388 3300005456 Bacteria 2664
68 Ga0070662_100016681 3300005457 Bacteria 4935
69 Ga0070662_100156478 3300005457 Bacteria 1779
70 Ga0070681_10152829 3300005458 Bacteria 2234
71 Ga0068867_100012345 3300005459 Bacteria 6043
72 Ga0068867_100040202 3300005459 Bacteria 3411
73 Ga0068867_100090365 3300005459 Bacteria 2323
74 Ga0070706_100109810 3300005467 Bacteria 2566
75 Ga0070698_100019505 3300005471 Bacteria 7117
76 Ga0070679_100053529 3300005530 Bacteria 4017
77 Ga0070697_100014081 3300005536 Bacteria 6280
78 Ga0070697_100017621 3300005536 Bacteria 5624
79 Ga0070697_100069468 3300005536 Bacteria 2885
80 Ga0068853_100011708 3300005539 Bacteria 7128
81 Ga0068853_100028825 3300005539 Bacteria 4672
82 Ga0068853_100095778 3300005539 Bacteria 2618
83 Ga0070686_100001046 3300005544 Bacteria 15928
84 Ga0070686_100053038 3300005544 Bacteria 2587
85 Ga0070695_100005269 3300005545 Bacteria 7612
86 Ga0070696_100030025 3300005546 Bacteria 3719
87 Ga0070696_100033569 3300005546 Bacteria 3527
88 Ga0070696_100033628 3300005546 Bacteria 3524
89 Ga0070696_100109836 3300005546 Bacteria 1985
90 Ga0070693_100086052 3300005547 Bacteria 1885
91 Ga0070665_100079791 3300005548 Bacteria 3278
92 Ga0070665_100115209 3300005548 Bacteria 2690
93 Ga0070704_100020448 3300005549 Bacteria 4268
94 Ga0070704_100055899 3300005549 Bacteria 2800
95 Ga0068855_100000791 3300005563 Bacteria 39102
96 Ga0068855_100019387 3300005563 Bacteria 8172
97 Ga0068855_100071556 3300005563 Bacteria 4033
98 Ga0068855_100106657 3300005563 Bacteria 3219
99 Ga0068855_100148510 3300005563 Bacteria 2667
100 Ga0068855_100323173 3300005563 Bacteria 1705
101 Ga0070664_100268210 3300005564 Bacteria 1537
102 Ga0068857_100013406 3300005577 Bacteria 7140
103 Ga0068857_100042988 3300005577 Bacteria 4009
104 Ga0068857_100081110 3300005577 Bacteria 2897
105 Ga0068857_100174261 3300005577 Bacteria 1956
106 Ga0068854_100127384 3300005578 Bacteria 1940
107 Ga0068856_100056797 3300005614 Bacteria 3863
108 Ga0068856_100107697 3300005614 Bacteria 2783
109 Ga0068856_100203022 3300005614 Bacteria 1997
110 Ga0068856_100215841 3300005614 Bacteria 1934
111 Ga0068856_100277948 3300005614 Bacteria 1691
112 Ga0070702_100000641 3300005615 Bacteria 12981
113 Ga0068852_100006348 3300005616 Bacteria 8534
114 Ga0068852_100006577 3300005616 Bacteria 8414
115 Ga0068852_100055000 3300005616 Bacteria 3433
116 Ga0068852_100120302 3300005616 Bacteria 2402
117 Ga0068859_100027104 3300005617 Bacteria 5748
118 Ga0068859_100073598 3300005617 Bacteria 3455
119 Ga0068864_100097304 3300005618 Bacteria 2605
120 Ga0068866_10001033 3300005718 Bacteria 12241
121 Ga0068866_10003238 3300005718 Bacteria 6706
122 Ga0068866_10047052 3300005718 Bacteria 2173
123 Ga0068861_100001865 3300005719 Bacteria 13569
124 Ga0068861_100003892 3300005719 Bacteria 9982
125 Ga0068861_100010032 3300005719 Bacteria 6565
126 Ga0068870_10010548 3300005840 Bacteria 4251
127 Ga0068858_100000679 3300005842 Bacteria 35449
128 Ga0068858_100015042 3300005842 Bacteria 7278
129 Ga0068858_100041121 3300005842 Bacteria 4287
130 Ga0068860_100009556 3300005843 Bacteria 9633
131 Ga0068860_100021211 3300005843 Bacteria 6293
132 Ga0068862_100015052 3300005844 Bacteria 6424
133 Ga0068862_100030154 3300005844 Bacteria 4570
134 Ga0068862_100143188 3300005844 Bacteria 2123
135 Ga0081455_10057144 3300005937 Bacteria 3308
136 Ga0097621_100017693 3300006237 Bacteria 5421
137 Ga0097621_100073984 3300006237 Bacteria 2821
138 Ga0097621_100158581 3300006237 Bacteria 1944
139 Ga0097621_100219621 3300006237 Bacteria 1656
140 Ga0068871_100006781 3300006358 Bacteria 8138
141 Ga0068871_100012320 3300006358 Bacteria 6299
142 Ga0068871_100048348 3300006358 Bacteria 3434
143 Ga0075434_100102147 3300006871 Bacteria 2875
144 Ga0075429_100000320 3300006880 Bacteria 34451
145 Ga0068865_100022697 3300006881 Bacteria 4098
146 Ga0068865_100033142 3300006881 Bacteria 3456
147 Ga0097620_100027104 3300006931 Bacteria 5748
148 Ga0097620_100073598 3300006931 Bacteria 3455
149 Ga0079104_1004787 3300006946 Bacteria 5640
150 Ga0075435_100001710 3300007076 Bacteria 14255
151 Ga0075435_100080165 3300007076 Bacteria 2680
152 Ga0105240_10002015 3300009093 Bacteria 33500
153 Ga0105240_10005343 3300009093 Bacteria 19158
154 Ga0105240_10008689 3300009093 Bacteria 14492
155 Ga0105240_10015015 3300009093 Bacteria 10546
156 Ga0105240_10044364 3300009093 Bacteria 5650
157 Ga0105245_10004092 3300009098 Bacteria 12945
158 Ga0105245_10008233 3300009098 Bacteria 9112
159 Ga0105245_10088819 3300009098 Bacteria 2840
160 Ga0105245_10281290 3300009098 Bacteria 1626
161 Ga0105247_10069131 3300009101 Bacteria 2203
162 Ga0114129_10039254 3300009147 Bacteria 6675
163 Ga0105243_10015745 3300009148 Bacteria 5719
164 Ga0105241_10004458 3300009174 Bacteria 10357
165 Ga0105241_10007759 3300009174 Bacteria 7890
166 Ga0105241_10039667 3300009174 Bacteria 3552
167 Ga0105241_10105698 3300009174 Bacteria 2246
168 Ga0105242_10008454 3300009176 Bacteria 7909
169 Ga0105242_10087057 3300009176 Bacteria 2622
170 Ga0105242_10123747 3300009176 Bacteria 2223
171 Ga0105248_10045951 3300009177 Bacteria 4895
172 Ga0105237_10016720 3300009545 Bacteria 7617
173 Ga0105237_10031873 3300009545 Bacteria 5338
174 Ga0105237_10036514 3300009545 Bacteria 4973
175 Ga0105237_10111587 3300009545 Bacteria 2726
176 Ga0105238_10000632 3300009551 Bacteria 37034
177 Ga0105238_10007883 3300009551 Bacteria 10653
178 Ga0105238_10022892 3300009551 Bacteria 6369
179 Ga0105238_10052495 3300009551 Bacteria 4098
180 Ga0105238_10086380 3300009551 Bacteria 3124
181 Ga0105238_10131300 3300009551 Bacteria 2483
182 Ga0105238_10149651 3300009551 Bacteria 2310
183 Ga0105238_10340856 3300009551 Bacteria 1487
184 Ga0105249_10013998 3300009553 Bacteria 7090
185 Ga0105249_10017247 3300009553 Bacteria 6408
186 Ga0105239_10018198 3300010375 Bacteria 7768
187 Ga0105239_10043254 3300010375 Bacteria 4936
188 Ga0105239_10075103 3300010375 Bacteria 3716
189 Ga0105239_10090918 3300010375 Bacteria 3368
190 Ga0105239_10112133 3300010375 Bacteria 3024
191 Ga0105239_10141658 3300010375 Bacteria 2680
192 Ga0105246_10210468 3300011119 Bacteria 1517
193 Ga0157371_10156577 3300013102 Bacteria 1626
194 Ga0157370_10032636 3300013104 Bacteria 5083
195 Ga0157369_10127566 3300013105 Bacteria 2696
196 Ga0157374_10040727 3300013296 Bacteria 4280
197 Ga0157374_10122936 3300013296 Bacteria 2507
198 Ga0157374_10192274 3300013296 Unclassified 1996
199 Ga0157378_10003424 3300013297 Bacteria 14077
200 Ga0157378_10041912 3300013297 Bacteria 4062
201 Ga0157378_10164311 3300013297 Unclassified 2078
202 Ga0163162_10062755 3300013306 Bacteria 3756
203 Ga0157375_10055609 3300013308 Bacteria 3903
204 Ga0157375_10108897 3300013308 Bacteria 2866
205 Ga0157380_10003649 3300014326 Bacteria 10586
206 Ga0157380_10012821 3300014326 Bacteria 6092
207 Ga0157379_10038095 3300014968 Bacteria 4290
208 Ga0157379_10208631 3300014968 Unclassified 1768
209 Ga0157379_10210761 3300014968 Bacteria 1759
210 Ga0157379_10212815 3300014968 Bacteria 1750
211 Ga0157376_10210496 3300014969 Bacteria 1795
212 Ga0182006_1015758 3300015261 Bacteria 3235
213 Ga0209435_100013 3300025206 Bacteria 366789
214 Ga0209435_100085 3300025206 Bacteria 45218
215 Ga0209435_100486 3300025206 Bacteria 7854
216 Ga0209784_100002 3300025224 Bacteria 1753105
217 Ga0209566_100003 3300025225 Bacteria 1753105
218 Ga0209674_100004 3300025226 Bacteria 1753105
219 Ga0209147_100030 3300025229 Bacteria 366789
220 Ga0209147_100217 3300025229 Bacteria 59789
221 Ga0209563_100006 3300025230 Bacteria 1753105
222 Ga0209437_100419 3300025233 Bacteria 38515
223 Ga0209437_100432 3300025233 Bacteria 36626
224 Ga0209258_100390 3300025242 Bacteria 55905
225 Ga0209258_100433 3300025242 Bacteria 48200
226 Ga0209646_1000034 3300025246 Bacteria 366789
227 Ga0209646_1000204 3300025246 Bacteria 69552
228 Ga0209646_1000227 3300025246 Bacteria 59789
229 Ga0209026_1000022 3300025250 Bacteria 366789
230 Ga0209026_1000340 3300025250 Bacteria 45211
231 Ga0209026_1004699 3300025250 Bacteria 3946
232 Ga0209677_100003 3300025253 Bacteria 1753105
233 Ga0209759_1000018 3300025256 Bacteria 366789
234 Ga0209759_1000298 3300025256 Bacteria 68472
235 Ga0209759_1000561 3300025256 Bacteria 37637
236 Ga0209565_1000021 3300025263 Bacteria 406281
237 Ga0209673_1009563 3300025273 Bacteria 4178
238 Ga0209675_1000040 3300025291 Bacteria 247535
239 Ga0209676_1000014 3300025292 Bacteria 793514
240 Ga0209025_1000092 3300025294 Bacteria 247020
241 Ga0209025_1048278 3300025294 Bacteria 1727
242 Ga0209564_1000159 3300025295 Bacteria 164319
243 Ga0209564_1000218 3300025295 Bacteria 130563
244 Ga0209564_1000452 3300025295 Bacteria 69505
245 Ga0209758_1010313 3300025297 Bacteria 5612
246 Ga0209256_1003336 3300025299 Bacteria 11391
247 Ga0209051_1000281 3300025303 Bacteria 83196
248 Ga0209257_1000039 3300025304 Bacteria 591694
249 Ga0207697_10055030 3300025315 Bacteria 1649
250 Ga0207642_10000792 3300025899 Bacteria 9809
251 Ga0207642_10002165 3300025899 Bacteria 6093
252 Ga0207642_10104498 3300025899 Unclassified 1429
253 Ga0207680_10034211 3300025903 Bacteria 2906
254 Ga0207643_10009245 3300025908 Bacteria 5293
255 Ga0207654_10012729 3300025911 Bacteria 4317
256 Ga0207654_10058805 3300025911 Bacteria 2239
257 Ga0207654_10063423 3300025911 Bacteria 2169
258 Ga0207707_10054717 3300025912 Bacteria 3473
259 Ga0207707_10102678 3300025912 Bacteria 2499
260 Ga0207707_10201963 3300025912 Bacteria 1733
261 Ga0207695_10001105 3300025913 Bacteria 46872
262 Ga0207695_10001995 3300025913 Bacteria 31509
263 Ga0207695_10004190 3300025913 Bacteria 19814
264 Ga0207695_10006194 3300025913 Bacteria 15592
265 Ga0207695_10012196 3300025913 Bacteria 10324
266 Ga0207671_10016590 3300025914 Bacteria 5718
267 Ga0207671_10033225 3300025914 Bacteria 3838
268 Ga0207671_10049119 3300025914 Bacteria 3123
269 Ga0207671_10065756 3300025914 Bacteria 2697
270 Ga0207660_10112139 3300025917 Bacteria 2054
271 Ga0207649_10055756 3300025920 Bacteria 2465
272 Ga0207646_10104733 3300025922 Bacteria 2537
273 Ga0207681_10028175 3300025923 Bacteria 3637
274 Ga0207694_10000171 3300025924 Bacteria 66876
275 Ga0207694_10041449 3300025924 Bacteria 3548
276 Ga0207694_10060031 3300025924 Bacteria 2959
277 Ga0207659_10068274 3300025926 Bacteria 2585
278 Ga0207687_10003861 3300025927 Bacteria 10059
279 Ga0207687_10037391 3300025927 Bacteria 3312
280 Ga0207664_10004401 3300025929 Bacteria 9540
281 Ga0207690_10007532 3300025932 Bacteria 6460
282 Ga0207690_10107217 3300025932 Bacteria 2006
283 Ga0207686_10001479 3300025934 Bacteria 13268
284 Ga0207686_10003638 3300025934 Bacteria 8258
285 Ga0207686_10133108 3300025934 Bacteria 1708
286 Ga0207670_10003899 3300025936 Bacteria 7960
287 Ga0207669_10019594 3300025937 Bacteria 3527
288 Ga0207704_10001625 3300025938 Bacteria 10096
289 Ga0207711_10003165 3300025941 Bacteria 14351
290 Ga0207689_10000392 3300025942 Bacteria 41178
291 Ga0207689_10000550 3300025942 Bacteria 35746
292 Ga0207689_10001736 3300025942 Bacteria 20587
293 Ga0207689_10017767 3300025942 Bacteria 6009
294 Ga0207661_10259608 3300025944 Bacteria 1547
295 Ga0207667_10000191 3300025949 Bacteria 89641
296 Ga0207667_10002722 3300025949 Bacteria 21860
297 Ga0207667_10003921 3300025949 Bacteria 18305
298 Ga0207667_10020526 3300025949 Bacteria 7343
299 Ga0207667_10048606 3300025949 Bacteria 4485
300 Ga0207667_10065049 3300025949 Bacteria 3805
301 Ga0207667_10078817 3300025949 Bacteria 3414
302 Ga0207667_10096505 3300025949 Bacteria 3051
303 Ga0207712_10047240 3300025961 Bacteria 2988
304 Ga0207640_10072670 3300025981 Bacteria 2321
305 Ga0207640_10127063 3300025981 Bacteria 1837
306 Ga0207677_10004108 3300026023 Bacteria 7787
307 Ga0207677_10033386 3300026023 Bacteria 3320
308 Ga0207703_10008734 3300026035 Bacteria 7997
309 Ga0207703_10028026 3300026035 Bacteria 4436
310 Ga0207703_10030512 3300026035 Bacteria 4261
311 Ga0207703_10056327 3300026035 Bacteria 3202
312 Ga0207639_10005658 3300026041 Bacteria 8457
313 Ga0207639_10008661 3300026041 Bacteria 6983
314 Ga0207639_10016794 3300026041 Bacteria 5186
315 Ga0207639_10018667 3300026041 Bacteria 4932
316 Ga0207678_10014250 3300026067 Bacteria 6989
317 Ga0207708_10002193 3300026075 Bacteria 14415
318 Ga0207708_10005789 3300026075 Bacteria 9137
319 Ga0207708_10015508 3300026075 Bacteria 5715
320 Ga0207708_10120356 3300026075 Bacteria 2045
321 Ga0207708_10251138 3300026075 Bacteria 1425
322 Ga0207702_10083259 3300026078 Bacteria 2783
323 Ga0207702_10092922 3300026078 Bacteria 2645
324 Ga0207702_10167390 3300026078 Bacteria 2012
325 Ga0207702_10241514 3300026078 Bacteria 1692
326 Ga0207648_10006481 3300026089 Bacteria 11625
327 Ga0207648_10007807 3300026089 Bacteria 10448
328 Ga0207648_10092855 3300026089 Bacteria 2639
329 Ga0207648_10103380 3300026089 Bacteria 2498
330 Ga0207676_10045564 3300026095 Bacteria 3389
331 Ga0207674_10032457 3300026116 Bacteria 5477
332 Ga0207674_10048785 3300026116 Bacteria 4332
333 Ga0207674_10154049 3300026116 Bacteria 2254
334 Ga0207675_100000576 3300026118 Bacteria 35873
335 Ga0207675_100002917 3300026118 Bacteria 16822
336 Ga0207675_100004949 3300026118 Bacteria 12840
337 Ga0207683_10027137 3300026121 Bacteria 4949
338 Ga0207698_10044122 3300026142 Bacteria 3347
339 Ga0207698_10060608 3300026142 Bacteria 2943
340 Ga0268265_10080624 3300028380 Bacteria 2567
341 Ga0268264_10028804 3300028381 Bacteria 4546
342 Ga0268264_10107207 3300028381 Bacteria 2440
343 Ga0265318_10015153 3300028577 Bacteria 3214
344 Ga0307515_10147648 3300028794 Bacteria 2480
345 Ga0265338_10163289 3300028800 Bacteria 1718
346 Ga0265330_10002659 3300031235 Bacteria 9677
347 Ga0265332_10000694 3300031238 Bacteria 21499
348 Ga0265332_10003742 3300031238 Bacteria 7280
349 Ga0265328_10006406 3300031239 Bacteria 4987
350 Ga0265320_10008016 3300031240 Bacteria 6504
351 Ga0265325_10011026 3300031241 Bacteria 5203
352 Ga0265329_10002182 3300031242 Bacteria 9041
353 Ga0265329_10012724 3300031242 Bacteria 3016
354 Ga0265331_10001220 3300031250 Bacteria 19327
355 Ga0265331_10026551 3300031250 Bacteria 2909
356 Ga0265327_10010221 3300031251 Bacteria 6629
357 Ga0265327_10042720 3300031251 Bacteria 2431
358 Ga0265316_10011543 3300031344 Bacteria 7955
359 Ga0265316_10053784 3300031344 Bacteria 3154
360 Ga0307513_10023595 3300031456 Bacteria 7183
361 Ga0265314_10001520 3300031711 Bacteria 25622
362 Ga0265314_10008184 3300031711 Bacteria 8991
363 Ga0307414_10007333 3300032004 Bacteria 6197
364 Ga0316588_1019709 3300033528 Bacteria 1522
365 Ga0316587_1004378 3300033529 Unclassified 2053
366 Ga0316596_1023929 3300033541 Bacteria 1567
367 Ga0373931_0002282 3300035691 Bacteria 8477
368 Ga0373927_0015575 3300035695 Bacteria 5023
369 Ga0373937_0189535 3300036401 Bacteria 1932
370 Ga0373937_0245368 3300036401 Bacteria 1688
371 Ga0373937_0307643 3300036401 Bacteria 1499
372 Ga0395900_0032253 3300037418 Bacteria 5386
373 Ga0395905_0210222 3300037471 Bacteria 1823
374 Ga0436364_0294446 3300037853 Bacteria 2205
375 Ga0436361_0532183 3300039447 Bacteria 5597
376 Ga0436361_0601494 3300039447 Bacteria 2783
377 Ga0436361_1085109 3300039447 Bacteria 7859
378 Ga0451577_0048792 3300042876 Bacteria 3781
379 Ga0451577_0054387 3300042876 Bacteria 3573
380 Ga0451577_0137460 3300042876 Bacteria 2194
381 Ga0451577_0207969 3300042876 Bacteria 1767
382 Ga0453684_0001209 3300044712 Bacteria 79474
383 Ga0453684_0005063 3300044712 Bacteria 26699
384 Ga0453684_0018355 3300044712 Bacteria 10741
385 Ga0453684_0021041 3300044712 Bacteria 9780
386 Ga0453684_0101689 3300044712 Bacteria 3516
387 Ga0453684_0111567 3300044712 Bacteria 3321
388 Ga0495580_0051560 3300046472 Bacteria 2909
389 Ga0495661_0054250 3300046665 Bacteria 2407
390 Ga0496101_0051300 3300048904 Bacteria 2972
391 Ga0496102_0134442 3300048905 Bacteria 2317
392 Ga0496102_0204335 3300048905 Bacteria 1862
393 Ga0496104_0114732 3300048907 Bacteria 2584
394 Ga0496105_0151706 3300048908 Bacteria 1904
395 Ga0496106_0007766 3300048909 Bacteria 7936
396 Ga0496106_0237888 3300048909 Bacteria 1455
397 Ga0496107_0029226 3300048910 Bacteria 3920
398 Ga0496109_0085898 3300048912 Bacteria 2905
399 Ga0496110_0088272 3300048913 Bacteria 2769
400 Ga0496110_0099036 3300048913 Bacteria 2614
401 Ga0496110_0116386 3300048913 Bacteria 2406
402 Ga0496110_0193865 3300048913 Bacteria 1845
403 Ga0496111_0034868 3300048914 Bacteria 3594
404 Ga0496115_0056798 3300048918 Bacteria 3146
405 Ga0496116_0014781 3300048919 Bacteria 6209
406 Ga0496116_0021941 3300048919 Bacteria 4801
407 Ga0496118_0093284 3300048921 Bacteria 2063
408 Ga0496121_0003466 3300048924 Bacteria 22480
409 Ga0496121_0050538 3300048924 Bacteria 3511
410 Ga0496122_0000134 3300048925 Bacteria 171080
411 Ga0496122_0000693 3300048925 Bacteria 67068
412 Ga0496123_0000307 3300048926 Bacteria 95174
413 Ga0496123_0000433 3300048926 Bacteria 75427
414 Ga0501037_0183990 3300049573 Bacteria 1482
415 Ga0501047_0026236 3300049581 Bacteria 5605
416 Ga0501069_0015512 3300049585 Bacteria 4085
417 Ga0501069_0063213 3300049585 Bacteria 2067
418 Ga0501070_0004818 3300049586 Bacteria 11531
419 Ga0501071_0086812 3300049587 Bacteria 2295
420 Ga0501073_0082558 3300049589 Bacteria 2236
421 Ga0501080_0053387 3300049742 Bacteria 3762
422 Ga0501083_0006285 3300049744 Bacteria 8428
423 Ga0501083_0053572 3300049744 Bacteria 2708
424 Ga0501035_0038184 3300049822 Bacteria 4348
425 Ga0501044_0046382 3300049823 Bacteria 4499
426 Ga0501044_0162795 3300049823 Bacteria 2206
427 Ga0501044_0206626 3300049823 Bacteria 1920
428 nmdc:mga0k408_98177_c1 3300050493 Bacteria 1726
429 nmdc:mga0n895_124075_c1 3300050512 Bacteria 2605
430 nmdc:mga0rr50_152524_c1 3300050513 Bacteria 1868
431 nmdc:mga0rr50_46631_c1 3300050513 Bacteria 3191
432 Ga0500641_0047674 3300053096 Bacteria 1753
433 2511252190 2511231003 Bacteria 5606035
434 2511383674 2511231026 Bacteria 5225445
435 2521559295 2521172590 Bacteria 5047645
436 2550694037 2548876994 Bacteria 4904866
437 2550696174 2548876994 Bacteria 4904866
438 2553004094 2551306416 Bacteria 6152985
439 2739612866 2739367655 Bacteria 4051151
440 2765568535 2765235838 Bacteria 5445269
441 2808981268 2808606386 Bacteria 4471946
442 2809128851 2808606415 Bacteria 4576710
443 2809148472 2808606419 Bacteria 4576925
444 2819591833 2818991445 Bacteria 4955017
445 2819595492 2818991445 Bacteria 4955017
446 2819615809 2818991449 Bacteria 5518009
447 2839096586 2839094727 Bacteria 5534556
448 2852621005 2852618963 Bacteria 4577824
449 2881928158 2881927736 Bacteria 3993927
450 2884816755 2884811622 Bacteria 5552861
451 2884817058 2884811622 Bacteria 5552861
452 2884836741 2884836552 Bacteria 5219991
453 2884837638 2884836552 Bacteria 5219991
454 2884853032 2884852848 Bacteria 5221161
455 2884853929 2884852848 Bacteria 5221161
456 2887376939 2887375801 Bacteria 5334027
457 2896154954 2896154374 Bacteria 5221518
458 2896155850 2896154374 Bacteria 5221518
459 2904443704 2904439833 Bacteria 5931679
460 2904532601 2904530477 Bacteria 5876334
461 2904585099 2904584206 Bacteria 6028872
462 2904593448 2904589729 Bacteria 6113573
463 2904605628 2904601388 Bacteria 5884906
464 2919048093 2919046199 Bacteria 5567169
465 2919081423 2919079590 Bacteria 5946433
466 2923512968 2923510766 Bacteria 5926163
467 2928133807 2928130867 Bacteria 5467269
468 Ga0496125_0000433
469 JGI25155J39150_1000076
470 JGI25156J39149_1000032
471 JGI25156J39149_1000675
472 JGI25156J39149_1007399
473 JGI25162J39368_1001832
474 JGI25154J39366_1000095
475 JGI25157J39369_1000212
476 JGI25157J39369_1001106
477 JGI25151J46595_10001193
478 JGI25151J46595_10009780
479 Ga0055538_1000054
480 Ga0055539_1000066
481 Ga0055533_1000076
482 Ga0055532_1000083
483 Ga0055532_1000157
484 Ga0055525_1000098
485 Ga0055535_1001985
486 Ga0055526_1000723
487 Ga0055526_1006049
488 Ga0055524_1001068
489 Ga0055536_1000219
490 Ga0055534_1001363
491 Ga0055540_1009900
492 Ga0055531_10000192
493 Ga0055541_1000056
494 Ga0070658_10012521
495 Ga0070690_100005910
496 Ga0070677_10033357
497 Ga0068869_100001111
498 Ga0068869_100023373
499 Ga0068869_100102908
500 Ga0070666_10139530
501 Ga0070680_100084832
502 Ga0070682_100112170
503 Ga0068868_100008536
504 Ga0068868_100017828
505 Ga0068868_100068076
506 Ga0068868_100203660
507 Ga0068868_100268693
508 Ga0070689_100009272
509 Ga0070689_100010513
510 Ga0070691_10009266
511 Ga0070661_100060602
512 Ga0070692_10001690
513 Ga0070692_10009480
514 Ga0070692_10035362
515 Ga0070692_10048469
516 Ga0070668_100012754
517 Ga0070675_100010314
518 Ga0070673_100126913
519 Ga0070688_100054905
520 Ga0070659_100071131
521 Ga0070659_100073701
522 Ga0070659_100195696
523 Ga0070714_100005537
524 Ga0070701_10000947
525 Ga0070701_10008850
526 Ga0070700_100001391
527 Ga0070700_100008103
528 Ga0070700_100165086
529 Ga0070694_100051267
530 Ga0070708_100000292
531 Ga0070708_100008387
532 Ga0070708_100077567
533 Ga0070708_100100984
534 Ga0070678_100067388
535 Ga0070662_100016681
536 Ga0070662_100156478
537 Ga0070681_10152829
538 Ga0068867_100012345
539 Ga0068867_100040202
540 Ga0068867_100090365
541 Ga0070706_100109810
542 Ga0070698_100019505
543 Ga0070679_100053529
544 Ga0070697_100014081
545 Ga0070697_100017621
546 Ga0070697_100069468
547 Ga0068853_100011708
548 Ga0068853_100028825
549 Ga0068853_100095778
550 Ga0070686_100001046
551 Ga0070686_100053038
552 Ga0070695_100005269
553 Ga0070696_100030025
554 Ga0070696_100033569
555 Ga0070696_100033628
556 Ga0070696_100109836
557 Ga0070693_100086052
558 Ga0070665_100079791
559 Ga0070665_100115209
560 Ga0070704_100020448
561 Ga0070704_100055899
562 Ga0068855_100000791
563 Ga0068855_100019387
564 Ga0068855_100071556
565 Ga0068855_100106657
566 Ga0068855_100148510
567 Ga0068855_100323173
568 Ga0070664_100268210
569 Ga0068857_100013406
570 Ga0068857_100042988
571 Ga0068857_100081110
572 Ga0068857_100174261
573 Ga0068854_100127384
574 Ga0068856_100056797
575 Ga0068856_100107697
576 Ga0068856_100203022
577 Ga0068856_100215841
578 Ga0068856_100277948
579 Ga0070702_100000641
580 Ga0068852_100006348
581 Ga0068852_100006577
582 Ga0068852_100055000
583 Ga0068852_100120302
584 Ga0068859_100027104
585 Ga0068859_100073598
586 Ga0068864_100097304
587 Ga0068866_10001033
588 Ga0068866_10003238
589 Ga0068866_10047052
590 Ga0068861_100001865
591 Ga0068861_100003892
592 Ga0068861_100010032
593 Ga0068870_10010548
594 Ga0068858_100000679
595 Ga0068858_100015042
596 Ga0068858_100041121
597 Ga0068860_100009556
598 Ga0068860_100021211
599 Ga0068862_100015052
600 Ga0068862_100030154
601 Ga0068862_100143188
602 Ga0081455_10057144
603 Ga0097621_100017693
604 Ga0097621_100073984
605 Ga0097621_100158581
606 Ga0097621_100219621
607 Ga0068871_100006781
608 Ga0068871_100012320
609 Ga0068871_100048348
610 Ga0075434_100102147
611 Ga0075429_100000320
612 Ga0068865_100022697
613 Ga0068865_100033142
614 Ga0097620_100027104
615 Ga0097620_100073598
616 Ga0079104_1004787
617 Ga0075435_100001710
618 Ga0075435_100080165
619 Ga0105240_10002015
620 Ga0105240_10005343
621 Ga0105240_10008689
622 Ga0105240_10015015
623 Ga0105240_10044364
624 Ga0105245_10004092
625 Ga0105245_10008233
626 Ga0105245_10088819
627 Ga0105245_10281290
628 Ga0105247_10069131
629 Ga0114129_10039254
630 Ga0105243_10015745
631 Ga0105241_10004458
632 Ga0105241_10007759
633 Ga0105241_10039667
634 Ga0105241_10105698
635 Ga0105242_10008454
636 Ga0105242_10087057
637 Ga0105242_10123747
638 Ga0105248_10045951
639 Ga0105237_10016720
640 Ga0105237_10031873
641 Ga0105237_10036514
642 Ga0105237_10111587
643 Ga0105238_10000632
644 Ga0105238_10007883
645 Ga0105238_10022892
646 Ga0105238_10052495
647 Ga0105238_10086380
648 Ga0105238_10131300
649 Ga0105238_10149651
650 Ga0105238_10340856
651 Ga0105249_10013998
652 Ga0105249_10017247
653 Ga0105239_10018198
654 Ga0105239_10043254
655 Ga0105239_10075103
656 Ga0105239_10090918
657 Ga0105239_10112133
658 Ga0105239_10141658
659 Ga0105246_10210468
660 Ga0157371_10156577
661 Ga0157370_10032636
662 Ga0157369_10127566
663 Ga0157374_10040727
664 Ga0157374_10122936
665 Ga0157374_10192274
666 Ga0157378_10003424
667 Ga0157378_10041912
668 Ga0157378_10164311
669 Ga0163162_10062755
670 Ga0157375_10055609
671 Ga0157375_10108897
672 Ga0157380_10003649
673 Ga0157380_10012821
674 Ga0157379_10038095
675 Ga0157379_10208631
676 Ga0157379_10210761
677 Ga0157379_10212815
678 Ga0157376_10210496
679 Ga0182006_1015758
680 Ga0209435_100013
681 Ga0209435_100085
682 Ga0209435_100486
683 Ga0209784_100002
684 Ga0209566_100003
685 Ga0209674_100004
686 Ga0209147_100030
687 Ga0209147_100217
688 Ga0209563_100006
689 Ga0209437_100419
690 Ga0209437_100432
691 Ga0209258_100390
692 Ga0209258_100433
693 Ga0209646_1000034
694 Ga0209646_1000204
695 Ga0209646_1000227
696 Ga0209026_1000022
697 Ga0209026_1000340
698 Ga0209026_1004699
699 Ga0209677_100003
700 Ga0209759_1000018
701 Ga0209759_1000298
702 Ga0209759_1000561
703 Ga0209565_1000021
704 Ga0209673_1009563
705 Ga0209675_1000040
706 Ga0209676_1000014
707 Ga0209025_1000092
708 Ga0209025_1048278
709 Ga0209564_1000159
710 Ga0209564_1000218
711 Ga0209564_1000452
712 Ga0209758_1010313
713 Ga0209256_1003336
714 Ga0209051_1000281
715 Ga0209257_1000039
716 Ga0207697_10055030
717 Ga0207642_10000792
718 Ga0207642_10002165
719 Ga0207642_10104498
720 Ga0207680_10034211
721 Ga0207643_10009245
722 Ga0207654_10012729
723 Ga0207654_10058805
724 Ga0207654_10063423
725 Ga0207707_10054717
726 Ga0207707_10102678
727 Ga0207707_10201963
728 Ga0207695_10001105
729 Ga0207695_10001995
730 Ga0207695_10004190
731 Ga0207695_10006194
732 Ga0207695_10012196
733 Ga0207671_10016590
734 Ga0207671_10033225
735 Ga0207671_10049119
736 Ga0207671_10065756
737 Ga0207660_10112139
738 Ga0207649_10055756
739 Ga0207646_10104733
740 Ga0207681_10028175
741 Ga0207694_10000171
742 Ga0207694_10041449
743 Ga0207694_10060031
744 Ga0207659_10068274
745 Ga0207687_10003861
746 Ga0207687_10037391
747 Ga0207664_10004401
748 Ga0207690_10007532
749 Ga0207690_10107217
750 Ga0207686_10001479
751 Ga0207686_10003638
752 Ga0207686_10133108
753 Ga0207670_10003899
754 Ga0207669_10019594
755 Ga0207704_10001625
756 Ga0207711_10003165
757 Ga0207689_10000392
758 Ga0207689_10000550
759 Ga0207689_10001736
760 Ga0207689_10017767
761 Ga0207661_10259608
762 Ga0207667_10000191
763 Ga0207667_10002722
764 Ga0207667_10003921
765 Ga0207667_10020526
766 Ga0207667_10048606
767 Ga0207667_10065049
768 Ga0207667_10078817
769 Ga0207667_10096505
770 Ga0207712_10047240
771 Ga0207640_10072670
772 Ga0207640_10127063
773 Ga0207677_10004108
774 Ga0207677_10033386
775 Ga0207703_10008734
776 Ga0207703_10028026
777 Ga0207703_10030512
778 Ga0207703_10056327
779 Ga0207639_10005658
780 Ga0207639_10008661
781 Ga0207639_10016794
782 Ga0207639_10018667
783 Ga0207678_10014250
784 Ga0207708_10002193
785 Ga0207708_10005789
786 Ga0207708_10015508
787 Ga0207708_10120356
788 Ga0207708_10251138
789 Ga0207702_10083259
790 Ga0207702_10092922
791 Ga0207702_10167390
792 Ga0207702_10241514
793 Ga0207648_10006481
794 Ga0207648_10007807
795 Ga0207648_10092855
796 Ga0207648_10103380
797 Ga0207676_10045564
798 Ga0207674_10032457
799 Ga0207674_10048785
800 Ga0207674_10154049
801 Ga0207675_100000576
802 Ga0207675_100002917
803 Ga0207675_100004949
804 Ga0207683_10027137
805 Ga0207698_10044122
806 Ga0207698_10060608
807 Ga0268265_10080624
808 Ga0268264_10028804
809 Ga0268264_10107207
810 Ga0265318_10015153
811 Ga0307515_10147648
812 Ga0265338_10163289
813 Ga0265330_10002659
814 Ga0265332_10000694
815 Ga0265332_10003742
816 Ga0265328_10006406
817 Ga0265320_10008016
818 Ga0265325_10011026
819 Ga0265329_10002182
820 Ga0265329_10012724
821 Ga0265331_10001220
822 Ga0265331_10026551
823 Ga0265327_10010221
824 Ga0265327_10042720
825 Ga0265316_10011543
826 Ga0265316_10053784
827 Ga0307513_10023595
828 Ga0265314_10001520
829 Ga0265314_10008184
830 Ga0307414_10007333
831 Ga0316588_1019709
832 Ga0316587_1004378
833 Ga0316596_1023929
834 Ga0373931_0002282
835 Ga0373927_0015575
836 Ga0373937_0189535
837 Ga0373937_0245368
838 Ga0373937_0307643
839 Ga0395900_0032253
840 Ga0395905_0210222
841 Ga0436364_0294446
842 Ga0436361_0532183
843 Ga0436361_0601494
844 Ga0436361_1085109
845 Ga0451577_0048792
846 Ga0451577_0054387
847 Ga0451577_0137460
848 Ga0451577_0207969
849 Ga0453684_0001209
850 Ga0453684_0005063
851 Ga0453684_0018355
852 Ga0453684_0021041
853 Ga0453684_0101689
854 Ga0453684_0111567
855 Ga0495580_0051560
856 Ga0495661_0054250
857 Ga0496101_0051300
858 Ga0496102_0134442
859 Ga0496102_0204335
860 Ga0496104_0114732
861 Ga0496105_0151706
862 Ga0496106_0007766
863 Ga0496106_0237888
864 Ga0496107_0029226
865 Ga0496109_0085898
866 Ga0496110_0088272
867 Ga0496110_0099036
868 Ga0496110_0116386
869 Ga0496110_0193865
870 Ga0496111_0034868
871 Ga0496115_0056798
872 Ga0496116_0014781
873 Ga0496116_0021941
874 Ga0496118_0093284
875 Ga0496121_0003466
876 Ga0496121_0050538
877 Ga0496122_0000134
878 Ga0496122_0000693
879 Ga0496123_0000307
880 Ga0496123_0000433
881 Ga0501037_0183990
882 Ga0501047_0026236
883 Ga0501069_0015512
884 Ga0501069_0063213
885 Ga0501070_0004818
886 Ga0501071_0086812
887 Ga0501073_0082558
888 Ga0501080_0053387
889 Ga0501083_0006285
890 Ga0501083_0053572
891 Ga0501035_0038184
892 Ga0501044_0046382
893 Ga0501044_0162795
894 Ga0501044_0206626
895 nmdc:mga0k408_98177_c1
896 nmdc:mga0n895_124075_c1
897 nmdc:mga0rr50_152524_c1
898 nmdc:mga0rr50_46631_c1
899 Ga0500641_0047674
900 2511252190
901 2511383674
902 2521559295
903 2550694037
904 2550696174
905 2553004094
906 2739612866
907 2765568535
908 2808981268
909 2809128851
910 2809148472
911 2819591833
912 2819595492
913 2819615809
914 2839096586
915 2852621005
916 2881928158
917 2884816755
918 2884817058
919 2884836741
920 2884837638
921 2884853032
922 2884853929
923 2887376939
924 2896154954
925 2896155850
926 2904443704
927 2904532601
928 2904585099
929 2904593448
930 2904605628
931 2919048093
932 2919081423
933 2923512968
934 2928133807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

110

425

0.87

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

103

392

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8639 27 419
5yse-assembly1.cif.gz_A crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose 0.8538 29 423
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8517 27 419
6jai-assembly1.cif.gz_A crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose 0.8347 27 421
6jar-assembly1.cif.gz_A crystal structure of abc transporter alpha-glycoside-binding mutant protein r49a in complex with maltose 0.8347 27 421
ID Description Score Start End Superfamily
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8243 30 140 3.40.190.10
5f7vA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8001 28 420 3.40.190.10
4r9gB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7999 28 359 3.40.190.10
4g68C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7932 29 142 3.40.190.10
5xpjB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7887 28 140 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A258QU41-F1-model_v4 ABC transporter substrate-binding protein 0.9869 20 135 GO:0042597
AF-A0A2H5ZTE3-F1-model_v4 Putative ABC transporter-binding protein 0.9652 20 424
AF-A0A537AUA6-F1-model_v4 Extracellular solute-binding protein 0.965 16 346
AF-A0A2H5ZSB2-F1-model_v4 Putative ABC transporter-binding protein 0.958 197 424
AF-A0A7Y8HH21-F1-model_v4 Extracellular solute-binding protein 0.9542 73 422

Map