F449916

General Info

Members Datasets Scaffolds Average Seq Length
467 191 934 219

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0128782|Ga0501031_0128782_779_1489
Length 236
Sequence MTGAGVGARQASPGLGVDALLALADDELVLGWRDSEWTGIAPFLEEDVAFSSIAQTEIGHARAFYELAAAELGTTADALAFDRAPAEYRSAPLVELRLVHDWGRTIARHWLYETADAIRIAELAESSSADVAGLARKIQSEEAYHALHAQMWADRLAETDEGRRRLLDGLEALWPYALGLLEGGQRERFVAETAARLPFFAAPETEPAERGAHLPEWSELWEEMTMVRRSAPGREW

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0128782 3300049568 Bacteria 1653
2 JGI24746J21847_1017652 3300001977 Bacteria 1013
3 JGI25407J50210_10016200 3300003373 Bacteria 1930
4 Ga0070676_10292064 3300005328 Bacteria 1102
5 Ga0070676_10331265 3300005328 Bacteria 1041
6 Ga0070683_100023556 3300005329 Bacteria 5508
7 Ga0070683_100163514 3300005329 Bacteria 2111
8 Ga0070683_100462006 3300005329 Bacteria 1211
9 Ga0070670_100120488 3300005331 Bacteria 2263
10 Ga0068869_100285811 3300005334 Bacteria 1327
11 Ga0070680_100272193 3300005336 Bacteria 1434
12 Ga0070682_100403970 3300005337 Bacteria 1034
13 Ga0070689_100044358 3300005340 Bacteria 3420
14 Ga0070691_10113333 3300005341 Bacteria 1358
15 Ga0070687_100103970 3300005343 Bacteria 1596
16 Ga0070692_10016311 3300005345 Bacteria 3532
17 Ga0070692_10024800 3300005345 Bacteria 2951
18 Ga0070668_100151192 3300005347 Unclassified 1877
19 Ga0070668_100296638 3300005347 Bacteria 1354
20 Ga0070669_100597926 3300005353 Bacteria 924
21 Ga0070675_100069423 3300005354 Bacteria 2919
22 Ga0070675_100466141 3300005354 Bacteria 1135
23 Ga0070674_100140786 3300005356 Bacteria 1810
24 Ga0070674_100334568 3300005356 Bacteria 1218
25 Ga0070674_100558678 3300005356 Unclassified 961
26 Ga0070659_100080144 3300005366 Bacteria 2606
27 Ga0070659_100299919 3300005366 Bacteria 1340
28 Ga0070701_10438796 3300005438 Unclassified 835
29 Ga0070705_100128991 3300005440 Unclassified 1646
30 Ga0070700_100026250 3300005441 Bacteria 3438
31 Ga0070678_100172386 3300005456 Unclassified 1763
32 Ga0070662_100045015 3300005457 Bacteria 3164
33 Ga0070662_100105861 3300005457 Bacteria 2136
34 Ga0070662_100247839 3300005457 Bacteria 1431
35 Ga0070681_10027816 3300005458 Bacteria 5686
36 Ga0070681_10178613 3300005458 Bacteria 2044
37 Ga0068867_100182682 3300005459 Unclassified 1668
38 Ga0070685_10084505 3300005466 Bacteria 1909
39 Ga0070698_100026391 3300005471 Bacteria 6046
40 Ga0070699_100416457 3300005518 Bacteria 1216
41 Ga0070699_100579121 3300005518 Bacteria 1023
42 Ga0070684_100137657 3300005535 Bacteria 2206
43 Ga0068853_101042395 3300005539 Bacteria 788
44 Ga0070672_100283717 3300005543 Bacteria 1401
45 Ga0070686_100277365 3300005544 Bacteria 1235
46 Ga0070693_100056657 3300005547 Unclassified 2263
47 Ga0070693_100098686 3300005547 Bacteria 1775
48 Ga0070664_100178730 3300005564 Bacteria 1885
49 Ga0070664_100894043 3300005564 Bacteria 833
50 Ga0068857_100277896 3300005577 Bacteria 1540
51 Ga0068857_100398334 3300005577 Bacteria 1281
52 Ga0068857_100756610 3300005577 Bacteria 926
53 Ga0068854_100063479 3300005578 Bacteria 2681
54 Ga0070702_100087850 3300005615 Bacteria 1879
55 Ga0068859_100186927 3300005617 Bacteria 2155
56 Ga0068864_100276381 3300005618 Unclassified 1566
57 Ga0068870_10136049 3300005840 Bacteria 1433
58 Ga0068863_100052988 3300005841 Bacteria 3845
59 Ga0068858_100262483 3300005842 Bacteria 1642
60 Ga0068862_100680474 3300005844 Bacteria 995
61 Ga0081455_10008193 3300005937 Bacteria 10897
62 Ga0081455_10030419 3300005937 Bacteria 4903
63 Ga0081455_10031407 3300005937 Bacteria 4807
64 Ga0081455_10202537 3300005937 Bacteria 1485
65 Ga0081538_10001074 3300005981 Bacteria 29047
66 Ga0081538_10011827 3300005981 Bacteria 7045
67 Ga0081538_10012019 3300005981 Bacteria 6973
68 Ga0081538_10031898 3300005981 Bacteria 3543
69 Ga0081538_10141641 3300005981 Bacteria 1107
70 Ga0097621_100165127 3300006237 Unclassified 1906
71 Ga0068871_100708008 3300006358 Bacteria 923
72 Ga0075428_100297815 3300006844 Bacteria 1734
73 Ga0075430_100015416 3300006846 Bacteria 6506
74 Ga0075430_100035041 3300006846 Bacteria 4261
75 Ga0075430_100114375 3300006846 Bacteria 2248
76 Ga0075431_100581970 3300006847 Bacteria 1105
77 Ga0075433_10085070 3300006852 Bacteria 2792
78 Ga0075433_10120770 3300006852 Bacteria 2326
79 Ga0075434_100014163 3300006871 Bacteria 7617
80 Ga0075434_100313179 3300006871 Bacteria 1590
81 Ga0075434_100368314 3300006871 Bacteria 1458
82 Ga0068865_100090754 3300006881 Bacteria 2216
83 Ga0097620_100186926 3300006931 Bacteria 2155
84 Ga0075435_100024445 3300007076 Bacteria 4689
85 Ga0075435_100135536 3300007076 Unclassified 2062
86 Ga0111539_10089928 3300009094 Bacteria 3608
87 Ga0111539_10184605 3300009094 Unclassified 2436
88 Ga0111539_10287111 3300009094 Bacteria 1915
89 Ga0105245_10027996 3300009098 Bacteria 4967
90 Ga0105245_10266904 3300009098 Bacteria 1668
91 Ga0105245_10394568 3300009098 Bacteria 1381
92 Ga0114129_10165507 3300009147 Bacteria 3018
93 Ga0114129_10280445 3300009147 Bacteria 2226
94 Ga0114129_10284371 3300009147 Bacteria 2209
95 Ga0114129_10460184 3300009147 Bacteria 1667
96 Ga0105243_10097342 3300009148 Bacteria 2435
97 Ga0105249_11603557 3300009553 Bacteria 723
98 Ga0105030_102620 3300009987 Bacteria 1561
99 Ga0105239_10146892 3300010375 Bacteria 2630
100 Ga0105239_10219084 3300010375 Bacteria 2134
101 Ga0105246_10103409 3300011119 Bacteria 2078
102 Ga0105246_10156737 3300011119 Bacteria 1730
103 Ga0105246_10187038 3300011119 Bacteria 1600
104 Ga0157378_10280808 3300013297 Bacteria 1605
105 Ga0163162_10267151 3300013306 Unclassified 1842
106 Ga0163162_11532663 3300013306 Unclassified 760
107 Ga0157372_10276687 3300013307 Unclassified 1951
108 Ga0157372_10697794 3300013307 Unclassified 1181
109 Ga0157375_10263655 3300013308 Bacteria 1884
110 Ga0163163_10045555 3300014325 Bacteria 4306
111 Ga0157380_10878291 3300014326 Unclassified 921
112 Ga0157377_10010043 3300014745 Bacteria 4671
113 Ga0157377_10069793 3300014745 Bacteria 2028
114 Ga0157376_10391077 3300014969 Bacteria 1342
115 Ga0157376_10468521 3300014969 Bacteria 1232
116 Ga0163161_10092974 3300017792 Bacteria 2234
117 Ga0207656_10298516 3300025321 Bacteria 797
118 Ga0207653_10044992 3300025885 Unclassified 1457
119 Ga0207688_10020821 3300025901 Bacteria 3580
120 Ga0207688_10033061 3300025901 Bacteria 2859
121 Ga0207688_10091233 3300025901 Bacteria 1750
122 Ga0207645_10062257 3300025907 Bacteria 2384
123 Ga0207645_10424125 3300025907 Bacteria 896
124 Ga0207643_10001664 3300025908 Bacteria 12493
125 Ga0207643_10041400 3300025908 Bacteria 2596
126 Ga0207643_10088515 3300025908 Unclassified 1802
127 Ga0207705_10266392 3300025909 Unclassified 1309
128 Ga0207654_10121025 3300025911 Bacteria 1643
129 Ga0207663_10178148 3300025916 Bacteria 1516
130 Ga0207660_10392973 3300025917 Unclassified 1116
131 Ga0207660_10414220 3300025917 Bacteria 1086
132 Ga0207662_10285477 3300025918 Bacteria 1093
133 Ga0207681_10051911 3300025923 Bacteria 2779
134 Ga0207694_10376657 3300025924 Bacteria 1178
135 Ga0207650_10059292 3300025925 Bacteria 2852
136 Ga0207659_10084962 3300025926 Bacteria 2350
137 Ga0207659_10328560 3300025926 Bacteria 1263
138 Ga0207687_10047736 3300025927 Bacteria 2969
139 Ga0207690_10071982 3300025932 Bacteria 2386
140 Ga0207690_10368693 3300025932 Bacteria 1139
141 Ga0207690_10392520 3300025932 Bacteria 1105
142 Ga0207706_10008191 3300025933 Bacteria 9641
143 Ga0207706_10008361 3300025933 Bacteria 9548
144 Ga0207706_10011008 3300025933 Bacteria 8248
145 Ga0207706_10509101 3300025933 Bacteria 1039
146 Ga0207709_10130009 3300025935 Unclassified 1715
147 Ga0207670_10140666 3300025936 Bacteria 1780
148 Ga0207669_10088700 3300025937 Bacteria 2007
149 Ga0207669_10108026 3300025937 Bacteria 1857
150 Ga0207669_10146729 3300025937 Bacteria 1646
151 Ga0207669_10426585 3300025937 Bacteria 1045
152 Ga0207704_10038609 3300025938 Bacteria 2771
153 Ga0207704_10153704 3300025938 Bacteria 1627
154 Ga0207689_10190214 3300025942 Bacteria 1693
155 Ga0207689_10200258 3300025942 Bacteria 1648
156 Ga0207661_10044162 3300025944 Unclassified 3521
157 Ga0207661_10126368 3300025944 Bacteria 2184
158 Ga0207661_10128689 3300025944 Bacteria 2165
159 Ga0207661_10553993 3300025944 Bacteria 1053
160 Ga0207668_10311837 3300025972 Unclassified 1302
161 Ga0207640_10098835 3300025981 Unclassified 2041
162 Ga0207640_10750551 3300025981 Bacteria 841
163 Ga0207677_10012357 3300026023 Bacteria 4905
164 Ga0207677_10210143 3300026023 Bacteria 1553
165 Ga0207703_10633970 3300026035 Bacteria 1013
166 Ga0207678_10096824 3300026067 Bacteria 2522
167 Ga0207678_10312821 3300026067 Bacteria 1350
168 Ga0207708_10019067 3300026075 Bacteria 5165
169 Ga0207708_10110826 3300026075 Unclassified 2130
170 Ga0207708_10402024 3300026075 Bacteria 1133
171 Ga0207702_10097039 3300026078 Bacteria 2593
172 Ga0207648_10311470 3300026089 Bacteria 1413
173 Ga0207674_10128635 3300026116 Bacteria 2497
174 Ga0207674_10254379 3300026116 Bacteria 1703
175 Ga0207675_100207526 3300026118 Bacteria 1883
176 Ga0207675_100281554 3300026118 Bacteria 1616
177 Ga0207683_10014724 3300026121 Bacteria 6661
178 Ga0207683_10173489 3300026121 Unclassified 1953
179 Ga0207683_10553538 3300026121 Bacteria 1064
180 Ga0207698_10326544 3300026142 Unclassified 1439
181 Ga0207698_10378336 3300026142 Unclassified 1346
182 Ga0207428_10012330 3300027907 Bacteria 7514
183 Ga0207428_10019100 3300027907 Bacteria 5845
184 Ga0268266_10404896 3300028379 Bacteria 1291
185 Ga0268265_10417874 3300028380 Bacteria 1244
186 Ga0268265_11266013 3300028380 Unclassified 737
187 Ga0268264_11111349 3300028381 Bacteria 799
188 Ga0265338_10004874 3300028800 Bacteria 17878
189 Ga0265316_10032338 3300031344 Bacteria 4269
190 Ga0265313_10006371 3300031595 Bacteria 8387
191 Ga0265314_10007593 3300031711 Bacteria 9388
192 Ga0307405_10055590 3300031731 Bacteria 2478
193 Ga0307413_10180552 3300031824 Unclassified 1504
194 Ga0307406_10006667 3300031901 Bacteria 6385
195 Ga0307412_10541607 3300031911 Bacteria 976
196 Ga0307409_100078443 3300031995 Bacteria 2657
197 Ga0307416_100036077 3300032002 Bacteria 3787
198 Ga0307415_100000841 3300032126 Bacteria 14034
199 Ga0307415_100659528 3300032126 Unclassified 939
200 Ga0373943_0178224 3300035170 Bacteria 1167
201 Ga0373942_0173309 3300035207 Bacteria 704
202 Ga0373962_0055576 3300035242 Bacteria 1150
203 Ga0373962_0056906 3300035242 Bacteria 1140
204 Ga0395899_0003229 3300037312 Bacteria 12929
205 Ga0395899_0139646 3300037312 Bacteria 1725
206 Ga0395900_0035267 3300037418 Bacteria 5153
207 Ga0395900_0050049 3300037418 Bacteria 4304
208 Ga0395900_0150693 3300037418 Unclassified 2376
209 Ga0395900_0221163 3300037418 Bacteria 1908
210 Ga0395898_0003973 3300037466 Bacteria 16276
211 Ga0395898_0083644 3300037466 Bacteria 3076
212 Ga0395898_0269674 3300037466 Bacteria 1623
213 Ga0395905_0005224 3300037471 Bacteria 13290
214 Ga0395905_0051148 3300037471 Bacteria 3869
215 Ga0395905_0059239 3300037471 Bacteria 3580
216 Ga0395905_0082279 3300037471 Bacteria 3017
217 Ga0395905_0348440 3300037471 Bacteria 1373
218 Ga0395901_0066360 3300038443 Bacteria 3759
219 Ga0450920_021206 3300042122 Bacteria 1255
220 Ga0439460_0066564 3300042461 Bacteria 1109
221 Ga0495603_0064469 3300046455 Bacteria 2160
222 Ga0495603_0275657 3300046455 Bacteria 967
223 Ga0495641_0130180 3300046461 Bacteria 1123
224 Ga0495582_0005996 3300046473 Bacteria 6775
225 Ga0495588_0191917 3300046674 Bacteria 1079
226 Ga0496100_0044778 3300048903 Bacteria 2836
227 Ga0496100_0511533 3300048903 Bacteria 926
228 Ga0496101_0515512 3300048904 Unclassified 945
229 Ga0496102_0057075 3300048905 Bacteria 3563
230 Ga0496106_0293818 3300048909 Unclassified 1303
231 Ga0496106_0305502 3300048909 Unclassified 1276
232 Ga0496107_0057162 3300048910 Bacteria 2820
233 Ga0496107_0408104 3300048910 Bacteria 1010
234 Ga0496108_0061715 3300048911 Bacteria 3155
235 Ga0496108_0510425 3300048911 Bacteria 1050
236 Ga0496109_0055665 3300048912 Bacteria 3608
237 Ga0496109_0147370 3300048912 Bacteria 2203
238 Ga0496109_0231320 3300048912 Bacteria 1739
239 Ga0496109_0862939 3300048912 Bacteria 843
240 Ga0496110_0382791 3300048913 Unclassified 1282
241 Ga0496110_0643803 3300048913 Bacteria 960
242 Ga0496110_0709788 3300048913 Bacteria 907
243 Ga0496111_0147365 3300048914 Bacteria 1745
244 Ga0496112_0091046 3300048915 Bacteria 3019
245 Ga0496114_0078614 3300048917 Bacteria 2783
246 Ga0496114_0099814 3300048917 Bacteria 2476
247 Ga0496114_0261049 3300048917 Unclassified 1525
248 Ga0501031_0000303 3300049568 Bacteria 28129
249 Ga0501031_0004224 3300049568 Bacteria 9281
250 Ga0501031_0046141 3300049568 Bacteria 2842
251 Ga0501031_0077822 3300049568 Bacteria 2160
252 Ga0501031_0094774 3300049568 Bacteria 1947
253 Ga0501032_0001265 3300049569 Bacteria 20279
254 Ga0501032_0017068 3300049569 Bacteria 5100
255 Ga0501033_0000196 3300049570 Bacteria 57814
256 Ga0501033_0167102 3300049570 Bacteria 1581
257 Ga0501033_0170756 3300049570 Bacteria 1562
258 Ga0501033_0235356 3300049570 Bacteria 1300
259 Ga0501033_0302544 3300049570 Bacteria 1125
260 Ga0501034_0020092 3300049571 Bacteria 6820
261 Ga0501034_0027411 3300049571 Bacteria 5794
262 Ga0501036_0000532 3300049572 Bacteria 27334
263 Ga0501036_0188741 3300049572 Bacteria 1734
264 Ga0501036_0204570 3300049572 Bacteria 1660
265 Ga0501036_0231209 3300049572 Bacteria 1552
266 Ga0501036_0388803 3300049572 Bacteria 1164
267 Ga0501036_0514547 3300049572 Bacteria 995
268 Ga0501036_0548603 3300049572 Unclassified 961
269 Ga0501037_0000254 3300049573 Bacteria 45796
270 Ga0501037_0263979 3300049573 Bacteria 1203
271 Ga0501037_0336684 3300049573 Unclassified 1043
272 Ga0501037_0417540 3300049573 Bacteria 918
273 Ga0501038_0000266 3300049574 Bacteria 44169
274 Ga0501038_0006388 3300049574 Bacteria 10916
275 Ga0501038_0095493 3300049574 Bacteria 2483
276 Ga0501039_0000178 3300049575 Bacteria 45220
277 Ga0501039_0018144 3300049575 Bacteria 5400
278 Ga0501039_0024450 3300049575 Bacteria 4640
279 Ga0501039_0043704 3300049575 Bacteria 3460
280 Ga0501039_0054868 3300049575 Bacteria 3085
281 Ga0501039_0056272 3300049575 Bacteria 3046
282 Ga0501039_0061633 3300049575 Bacteria 2905
283 Ga0501040_0000647 3300049576 Bacteria 21381
284 Ga0501040_0004249 3300049576 Bacteria 9323
285 Ga0501040_0010867 3300049576 Bacteria 5951
286 Ga0501040_0015422 3300049576 Bacteria 5052
287 Ga0501040_0017084 3300049576 Bacteria 4814
288 Ga0501040_0032028 3300049576 Bacteria 3556
289 Ga0501040_0039161 3300049576 Bacteria 3223
290 Ga0501040_0370861 3300049576 Bacteria 1026
291 Ga0501040_0506447 3300049576 Bacteria 870
292 Ga0501041_0004909 3300049577 Bacteria 7768
293 Ga0501041_0006907 3300049577 Bacteria 6656
294 Ga0501041_0006925 3300049577 Bacteria 6651
295 Ga0501041_0014481 3300049577 Bacteria 4683
296 Ga0501041_0046975 3300049577 Bacteria 2627
297 Ga0501041_0299907 3300049577 Bacteria 1012
298 Ga0501042_0001328 3300049578 Bacteria 14426
299 Ga0501042_0007145 3300049578 Bacteria 7305
300 Ga0501042_0022591 3300049578 Bacteria 4395
301 Ga0501042_0029760 3300049578 Bacteria 3852
302 Ga0501042_0057551 3300049578 Bacteria 2774
303 Ga0501042_0085912 3300049578 Bacteria 2256
304 Ga0501042_0253963 3300049578 Bacteria 1269
305 Ga0501043_0005225 3300049579 Bacteria 10508
306 Ga0501043_0135335 3300049579 Bacteria 1930
307 Ga0501043_0490772 3300049579 Bacteria 918
308 Ga0501046_0000640 3300049580 Bacteria 34263
309 Ga0501046_0073590 3300049580 Bacteria 2651
310 Ga0501046_0096164 3300049580 Bacteria 2275
311 Ga0501047_0000991 3300049581 Bacteria 28652
312 Ga0501047_0536063 3300049581 Bacteria 995
313 Ga0501048_0000164 3300049582 Bacteria 41709
314 Ga0501048_0006073 3300049582 Bacteria 9198
315 Ga0501048_0008376 3300049582 Bacteria 7816
316 Ga0501048_0040551 3300049582 Bacteria 3336
317 Ga0501048_0077231 3300049582 Bacteria 2350
318 Ga0501067_0000039 3300049583 Bacteria 81137
319 Ga0501067_0076359 3300049583 Bacteria 1856
320 Ga0501067_0093504 3300049583 Bacteria 1669
321 Ga0501067_0319029 3300049583 Bacteria 865
322 Ga0501068_0000002 3300049584 Bacteria 98998
323 Ga0501068_0000009 3300049584 Bacteria 67122
324 Ga0501068_0006962 3300049584 Bacteria 6255
325 Ga0501068_0017124 3300049584 Bacteria 4188
326 Ga0501068_0099886 3300049584 Bacteria 1798
327 Ga0501068_0462600 3300049584 Bacteria 821
328 Ga0501069_0000082 3300049585 Bacteria 47021
329 Ga0501069_0048471 3300049585 Bacteria 2359
330 Ga0501070_0000808 3300049586 Bacteria 28444
331 Ga0501070_0209336 3300049586 Bacteria 1601
332 Ga0501070_0845248 3300049586 Bacteria 716
333 Ga0501071_0000195 3300049587 Bacteria 27326
334 Ga0501071_0004951 3300049587 Bacteria 8509
335 Ga0501071_0021636 3300049587 Bacteria 4480
336 Ga0501071_0037295 3300049587 Bacteria 3470
337 Ga0501071_0115927 3300049587 Unclassified 1983
338 Ga0501071_0197195 3300049587 Bacteria 1511
339 Ga0501071_0235202 3300049587 Bacteria 1381
340 Ga0501071_0330970 3300049587 Bacteria 1158
341 Ga0501071_0362587 3300049587 Bacteria 1104
342 Ga0501071_0502236 3300049587 Bacteria 930
343 Ga0501072_0001130 3300049588 Bacteria 19825
344 Ga0501072_0012706 3300049588 Bacteria 6438
345 Ga0501072_0017410 3300049588 Bacteria 5521
346 Ga0501072_0019585 3300049588 Bacteria 5232
347 Ga0501072_0034109 3300049588 Bacteria 3988
348 Ga0501072_0108998 3300049588 Bacteria 2203
349 Ga0501072_0115386 3300049588 Bacteria 2138
350 Ga0501072_0200383 3300049588 Bacteria 1591
351 Ga0501072_0487531 3300049588 Bacteria 975
352 Ga0501073_0000932 3300049589 Bacteria 20979
353 Ga0501073_0015530 3300049589 Bacteria 5523
354 Ga0501073_0218734 3300049589 Bacteria 1316
355 Ga0501073_0352153 3300049589 Bacteria 1017
356 Ga0501074_0000249 3300049590 Bacteria 30332
357 Ga0501074_0022584 3300049590 Bacteria 4572
358 Ga0501074_0028874 3300049590 Bacteria 4018
359 Ga0501074_0166369 3300049590 Bacteria 1574
360 Ga0501074_0205488 3300049590 Bacteria 1403
361 Ga0501074_0427909 3300049590 Bacteria 939
362 Ga0501075_0000310 3300049591 Bacteria 27255
363 Ga0501075_0002178 3300049591 Bacteria 12967
364 Ga0501075_0002739 3300049591 Bacteria 11796
365 Ga0501075_0009249 3300049591 Bacteria 6890
366 Ga0501075_0050497 3300049591 Bacteria 3126
367 Ga0501075_0055546 3300049591 Bacteria 2979
368 Ga0501075_0123399 3300049591 Bacteria 1971
369 Ga0501075_0584629 3300049591 Unclassified 852
370 Ga0501076_0000083 3300049592 Bacteria 49438
371 Ga0501076_0003053 3300049592 Bacteria 11651
372 Ga0501076_0003895 3300049592 Bacteria 10516
373 Ga0501076_0014961 3300049592 Bacteria 5856
374 Ga0501076_0028042 3300049592 Bacteria 4369
375 Ga0501076_0032772 3300049592 Bacteria 4056
376 Ga0501076_0036688 3300049592 Bacteria 3841
377 Ga0501076_0039140 3300049592 Bacteria 3723
378 Ga0501076_0157071 3300049592 Bacteria 1852
379 Ga0501076_0243252 3300049592 Bacteria 1472
380 Ga0501076_0724221 3300049592 Bacteria 821
381 Ga0501077_0000048 3300049593 Bacteria 61935
382 Ga0501077_0007102 3300049593 Bacteria 6905
383 Ga0501077_0008225 3300049593 Bacteria 6450
384 Ga0501077_0097098 3300049593 Bacteria 1867
385 Ga0501077_0244469 3300049593 Bacteria 1141
386 Ga0501077_0311232 3300049593 Bacteria 1004
387 Ga0501077_0313743 3300049593 Bacteria 999
388 Ga0501079_0000430 3300049741 Bacteria 27322
389 Ga0501079_0002092 3300049741 Bacteria 14316
390 Ga0501079_0017391 3300049741 Bacteria 5491
391 Ga0501079_0052882 3300049741 Bacteria 3133
392 Ga0501079_0081601 3300049741 Bacteria 2501
393 Ga0501079_0098718 3300049741 Bacteria 2263
394 Ga0501079_0107418 3300049741 Bacteria 2166
395 Ga0501079_0675920 3300049741 Bacteria 813
396 Ga0501080_0000026 3300049742 Bacteria 89548
397 Ga0501080_0024671 3300049742 Bacteria 5577
398 Ga0501080_0033678 3300049742 Bacteria 4782
399 Ga0501080_0287874 3300049742 Bacteria 1492
400 Ga0501080_0737147 3300049742 Bacteria 867
401 Ga0501081_0000117 3300049743 Bacteria 34303
402 Ga0501081_0004787 3300049743 Bacteria 8714
403 Ga0501081_0046172 3300049743 Bacteria 2993
404 Ga0501081_0057457 3300049743 Bacteria 2690
405 Ga0501081_0070579 3300049743 Bacteria 2434
406 Ga0501081_0099505 3300049743 Bacteria 2054
407 Ga0501081_0203124 3300049743 Bacteria 1437
408 Ga0501081_0349711 3300049743 Bacteria 1089
409 Ga0501081_0388597 3300049743 Bacteria 1032
410 Ga0501081_0447902 3300049743 Unclassified 959
411 Ga0501083_0000136 3300049744 Bacteria 49859
412 Ga0501083_0058579 3300049744 Bacteria 2577
413 Ga0501083_0205133 3300049744 Bacteria 1285
414 Ga0501083_0228545 3300049744 Bacteria 1212
415 Ga0501035_0001888 3300049822 Bacteria 21086
416 Ga0501035_0036816 3300049822 Bacteria 4434
417 Ga0501035_0070230 3300049822 Bacteria 3103
418 Ga0501035_0093666 3300049822 Bacteria 2643
419 Ga0501035_0108366 3300049822 Bacteria 2435
420 Ga0501035_0160233 3300049822 Bacteria 1948
421 Ga0501035_0783877 3300049822 Bacteria 763
422 Ga0501044_0008926 3300049823 Bacteria 10958
423 Ga0501044_0621953 3300049823 Bacteria 971
424 Ga0501045_0000199 3300049824 Bacteria 34181
425 Ga0501045_0006593 3300049824 Bacteria 8043
426 Ga0501045_0007794 3300049824 Bacteria 7447
427 Ga0501045_0010369 3300049824 Bacteria 6525
428 Ga0501045_0017780 3300049824 Bacteria 5049
429 Ga0501045_0034825 3300049824 Bacteria 3655
430 Ga0501045_0144170 3300049824 Bacteria 1771
431 nmdc:mga05p37_155678_c1 3300050507 Bacteria 2793
432 nmdc:mga05p37_196207_c1 3300050507 Unclassified 2448
433 nmdc:mga05p37_3481_c1 3300050507 Bacteria 18399
434 nmdc:mga05p37_881294_c1 3300050507 Bacteria 968
435 nmdc:mga09592_42083_c1 3300050508 Bacteria 3843
436 nmdc:mga0qj67_134927_c1 3300050509 Bacteria 2000
437 nmdc:mga06r32_22681_c1 3300050510 Bacteria 5805
438 nmdc:mga06r32_92055_c1 3300050510 Bacteria 2964
439 nmdc:mga08y16_174674_c1 3300050511 Unclassified 2231
440 nmdc:mga08y16_223358_c1 3300050511 Bacteria 1949
441 nmdc:mga08y16_465662_c1 3300050511 Bacteria 1287
442 nmdc:mga08y16_664864_c1 3300050511 Bacteria 1045
443 nmdc:mga08y16_72373_c1 3300050511 Bacteria 3592
444 nmdc:mga0n895_137462_c1 3300050512 Unclassified 2471
445 nmdc:mga0n895_69803_c1 3300050512 Bacteria 3482
446 nmdc:mga0rr50_119782_c1 3300050513 Bacteria 2093
447 nmdc:mga0a205_131607_c1 3300050515 Bacteria 1220
448 nmdc:mga0a205_7514_c1 3300050515 Bacteria 9871
449 Ga0501084_0000105 3300054114 Bacteria 62464
450 Ga0501084_0018678 3300054114 Bacteria 5772
451 Ga0501084_0031972 3300054114 Bacteria 4401
452 Ga0590077_023266 3300059426 Bacteria 1325
453 Ga0501082_0000897 3300060353 Bacteria 26250
454 Ga0501082_0001243 3300060353 Bacteria 22391
455 Ga0501082_0002954 3300060353 Bacteria 14836
456 Ga0501082_0021003 3300060353 Bacteria 5632
457 Ga0501082_0029958 3300060353 Bacteria 4689
458 Ga0501082_0125287 3300060353 Bacteria 2228
459 Ga0501082_0326785 3300060353 Bacteria 1336
460 Ga0501082_0582019 3300060353 Bacteria 979
461 Ga0501082_0612479 3300060353 Unclassified 953
462 Ga0530510_0000145 3300061734 Bacteria 41886
463 Ga0530510_0000434 3300061734 Bacteria 26970
464 Ga0530510_0090847 3300061734 Bacteria 2228
465 Ga0530510_0095250 3300061734 Bacteria 2174
466 Ga0530510_0098042 3300061734 Bacteria 2143
467 Ga0530510_0102848 3300061734 Bacteria 2089
468 Ga0501031_0128782
469 JGI24746J21847_1017652
470 JGI25407J50210_10016200
471 Ga0070676_10292064
472 Ga0070676_10331265
473 Ga0070683_100023556
474 Ga0070683_100163514
475 Ga0070683_100462006
476 Ga0070670_100120488
477 Ga0068869_100285811
478 Ga0070680_100272193
479 Ga0070682_100403970
480 Ga0070689_100044358
481 Ga0070691_10113333
482 Ga0070687_100103970
483 Ga0070692_10016311
484 Ga0070692_10024800
485 Ga0070668_100151192
486 Ga0070668_100296638
487 Ga0070669_100597926
488 Ga0070675_100069423
489 Ga0070675_100466141
490 Ga0070674_100140786
491 Ga0070674_100334568
492 Ga0070674_100558678
493 Ga0070659_100080144
494 Ga0070659_100299919
495 Ga0070701_10438796
496 Ga0070705_100128991
497 Ga0070700_100026250
498 Ga0070678_100172386
499 Ga0070662_100045015
500 Ga0070662_100105861
501 Ga0070662_100247839
502 Ga0070681_10027816
503 Ga0070681_10178613
504 Ga0068867_100182682
505 Ga0070685_10084505
506 Ga0070698_100026391
507 Ga0070699_100416457
508 Ga0070699_100579121
509 Ga0070684_100137657
510 Ga0068853_101042395
511 Ga0070672_100283717
512 Ga0070686_100277365
513 Ga0070693_100056657
514 Ga0070693_100098686
515 Ga0070664_100178730
516 Ga0070664_100894043
517 Ga0068857_100277896
518 Ga0068857_100398334
519 Ga0068857_100756610
520 Ga0068854_100063479
521 Ga0070702_100087850
522 Ga0068859_100186927
523 Ga0068864_100276381
524 Ga0068870_10136049
525 Ga0068863_100052988
526 Ga0068858_100262483
527 Ga0068862_100680474
528 Ga0081455_10008193
529 Ga0081455_10030419
530 Ga0081455_10031407
531 Ga0081455_10202537
532 Ga0081538_10001074
533 Ga0081538_10011827
534 Ga0081538_10012019
535 Ga0081538_10031898
536 Ga0081538_10141641
537 Ga0097621_100165127
538 Ga0068871_100708008
539 Ga0075428_100297815
540 Ga0075430_100015416
541 Ga0075430_100035041
542 Ga0075430_100114375
543 Ga0075431_100581970
544 Ga0075433_10085070
545 Ga0075433_10120770
546 Ga0075434_100014163
547 Ga0075434_100313179
548 Ga0075434_100368314
549 Ga0068865_100090754
550 Ga0097620_100186926
551 Ga0075435_100024445
552 Ga0075435_100135536
553 Ga0111539_10089928
554 Ga0111539_10184605
555 Ga0111539_10287111
556 Ga0105245_10027996
557 Ga0105245_10266904
558 Ga0105245_10394568
559 Ga0114129_10165507
560 Ga0114129_10280445
561 Ga0114129_10284371
562 Ga0114129_10460184
563 Ga0105243_10097342
564 Ga0105249_11603557
565 Ga0105030_102620
566 Ga0105239_10146892
567 Ga0105239_10219084
568 Ga0105246_10103409
569 Ga0105246_10156737
570 Ga0105246_10187038
571 Ga0157378_10280808
572 Ga0163162_10267151
573 Ga0163162_11532663
574 Ga0157372_10276687
575 Ga0157372_10697794
576 Ga0157375_10263655
577 Ga0163163_10045555
578 Ga0157380_10878291
579 Ga0157377_10010043
580 Ga0157377_10069793
581 Ga0157376_10391077
582 Ga0157376_10468521
583 Ga0163161_10092974
584 Ga0207656_10298516
585 Ga0207653_10044992
586 Ga0207688_10020821
587 Ga0207688_10033061
588 Ga0207688_10091233
589 Ga0207645_10062257
590 Ga0207645_10424125
591 Ga0207643_10001664
592 Ga0207643_10041400
593 Ga0207643_10088515
594 Ga0207705_10266392
595 Ga0207654_10121025
596 Ga0207663_10178148
597 Ga0207660_10392973
598 Ga0207660_10414220
599 Ga0207662_10285477
600 Ga0207681_10051911
601 Ga0207694_10376657
602 Ga0207650_10059292
603 Ga0207659_10084962
604 Ga0207659_10328560
605 Ga0207687_10047736
606 Ga0207690_10071982
607 Ga0207690_10368693
608 Ga0207690_10392520
609 Ga0207706_10008191
610 Ga0207706_10008361
611 Ga0207706_10011008
612 Ga0207706_10509101
613 Ga0207709_10130009
614 Ga0207670_10140666
615 Ga0207669_10088700
616 Ga0207669_10108026
617 Ga0207669_10146729
618 Ga0207669_10426585
619 Ga0207704_10038609
620 Ga0207704_10153704
621 Ga0207689_10190214
622 Ga0207689_10200258
623 Ga0207661_10044162
624 Ga0207661_10126368
625 Ga0207661_10128689
626 Ga0207661_10553993
627 Ga0207668_10311837
628 Ga0207640_10098835
629 Ga0207640_10750551
630 Ga0207677_10012357
631 Ga0207677_10210143
632 Ga0207703_10633970
633 Ga0207678_10096824
634 Ga0207678_10312821
635 Ga0207708_10019067
636 Ga0207708_10110826
637 Ga0207708_10402024
638 Ga0207702_10097039
639 Ga0207648_10311470
640 Ga0207674_10128635
641 Ga0207674_10254379
642 Ga0207675_100207526
643 Ga0207675_100281554
644 Ga0207683_10014724
645 Ga0207683_10173489
646 Ga0207683_10553538
647 Ga0207698_10326544
648 Ga0207698_10378336
649 Ga0207428_10012330
650 Ga0207428_10019100
651 Ga0268266_10404896
652 Ga0268265_10417874
653 Ga0268265_11266013
654 Ga0268264_11111349
655 Ga0265338_10004874
656 Ga0265316_10032338
657 Ga0265313_10006371
658 Ga0265314_10007593
659 Ga0307405_10055590
660 Ga0307413_10180552
661 Ga0307406_10006667
662 Ga0307412_10541607
663 Ga0307409_100078443
664 Ga0307416_100036077
665 Ga0307415_100000841
666 Ga0307415_100659528
667 Ga0373943_0178224
668 Ga0373942_0173309
669 Ga0373962_0055576
670 Ga0373962_0056906
671 Ga0395899_0003229
672 Ga0395899_0139646
673 Ga0395900_0035267
674 Ga0395900_0050049
675 Ga0395900_0150693
676 Ga0395900_0221163
677 Ga0395898_0003973
678 Ga0395898_0083644
679 Ga0395898_0269674
680 Ga0395905_0005224
681 Ga0395905_0051148
682 Ga0395905_0059239
683 Ga0395905_0082279
684 Ga0395905_0348440
685 Ga0395901_0066360
686 Ga0450920_021206
687 Ga0439460_0066564
688 Ga0495603_0064469
689 Ga0495603_0275657
690 Ga0495641_0130180
691 Ga0495582_0005996
692 Ga0495588_0191917
693 Ga0496100_0044778
694 Ga0496100_0511533
695 Ga0496101_0515512
696 Ga0496102_0057075
697 Ga0496106_0293818
698 Ga0496106_0305502
699 Ga0496107_0057162
700 Ga0496107_0408104
701 Ga0496108_0061715
702 Ga0496108_0510425
703 Ga0496109_0055665
704 Ga0496109_0147370
705 Ga0496109_0231320
706 Ga0496109_0862939
707 Ga0496110_0382791
708 Ga0496110_0643803
709 Ga0496110_0709788
710 Ga0496111_0147365
711 Ga0496112_0091046
712 Ga0496114_0078614
713 Ga0496114_0099814
714 Ga0496114_0261049
715 Ga0501031_0000303
716 Ga0501031_0004224
717 Ga0501031_0046141
718 Ga0501031_0077822
719 Ga0501031_0094774
720 Ga0501032_0001265
721 Ga0501032_0017068
722 Ga0501033_0000196
723 Ga0501033_0167102
724 Ga0501033_0170756
725 Ga0501033_0235356
726 Ga0501033_0302544
727 Ga0501034_0020092
728 Ga0501034_0027411
729 Ga0501036_0000532
730 Ga0501036_0188741
731 Ga0501036_0204570
732 Ga0501036_0231209
733 Ga0501036_0388803
734 Ga0501036_0514547
735 Ga0501036_0548603
736 Ga0501037_0000254
737 Ga0501037_0263979
738 Ga0501037_0336684
739 Ga0501037_0417540
740 Ga0501038_0000266
741 Ga0501038_0006388
742 Ga0501038_0095493
743 Ga0501039_0000178
744 Ga0501039_0018144
745 Ga0501039_0024450
746 Ga0501039_0043704
747 Ga0501039_0054868
748 Ga0501039_0056272
749 Ga0501039_0061633
750 Ga0501040_0000647
751 Ga0501040_0004249
752 Ga0501040_0010867
753 Ga0501040_0015422
754 Ga0501040_0017084
755 Ga0501040_0032028
756 Ga0501040_0039161
757 Ga0501040_0370861
758 Ga0501040_0506447
759 Ga0501041_0004909
760 Ga0501041_0006907
761 Ga0501041_0006925
762 Ga0501041_0014481
763 Ga0501041_0046975
764 Ga0501041_0299907
765 Ga0501042_0001328
766 Ga0501042_0007145
767 Ga0501042_0022591
768 Ga0501042_0029760
769 Ga0501042_0057551
770 Ga0501042_0085912
771 Ga0501042_0253963
772 Ga0501043_0005225
773 Ga0501043_0135335
774 Ga0501043_0490772
775 Ga0501046_0000640
776 Ga0501046_0073590
777 Ga0501046_0096164
778 Ga0501047_0000991
779 Ga0501047_0536063
780 Ga0501048_0000164
781 Ga0501048_0006073
782 Ga0501048_0008376
783 Ga0501048_0040551
784 Ga0501048_0077231
785 Ga0501067_0000039
786 Ga0501067_0076359
787 Ga0501067_0093504
788 Ga0501067_0319029
789 Ga0501068_0000002
790 Ga0501068_0000009
791 Ga0501068_0006962
792 Ga0501068_0017124
793 Ga0501068_0099886
794 Ga0501068_0462600
795 Ga0501069_0000082
796 Ga0501069_0048471
797 Ga0501070_0000808
798 Ga0501070_0209336
799 Ga0501070_0845248
800 Ga0501071_0000195
801 Ga0501071_0004951
802 Ga0501071_0021636
803 Ga0501071_0037295
804 Ga0501071_0115927
805 Ga0501071_0197195
806 Ga0501071_0235202
807 Ga0501071_0330970
808 Ga0501071_0362587
809 Ga0501071_0502236
810 Ga0501072_0001130
811 Ga0501072_0012706
812 Ga0501072_0017410
813 Ga0501072_0019585
814 Ga0501072_0034109
815 Ga0501072_0108998
816 Ga0501072_0115386
817 Ga0501072_0200383
818 Ga0501072_0487531
819 Ga0501073_0000932
820 Ga0501073_0015530
821 Ga0501073_0218734
822 Ga0501073_0352153
823 Ga0501074_0000249
824 Ga0501074_0022584
825 Ga0501074_0028874
826 Ga0501074_0166369
827 Ga0501074_0205488
828 Ga0501074_0427909
829 Ga0501075_0000310
830 Ga0501075_0002178
831 Ga0501075_0002739
832 Ga0501075_0009249
833 Ga0501075_0050497
834 Ga0501075_0055546
835 Ga0501075_0123399
836 Ga0501075_0584629
837 Ga0501076_0000083
838 Ga0501076_0003053
839 Ga0501076_0003895
840 Ga0501076_0014961
841 Ga0501076_0028042
842 Ga0501076_0032772
843 Ga0501076_0036688
844 Ga0501076_0039140
845 Ga0501076_0157071
846 Ga0501076_0243252
847 Ga0501076_0724221
848 Ga0501077_0000048
849 Ga0501077_0007102
850 Ga0501077_0008225
851 Ga0501077_0097098
852 Ga0501077_0244469
853 Ga0501077_0311232
854 Ga0501077_0313743
855 Ga0501079_0000430
856 Ga0501079_0002092
857 Ga0501079_0017391
858 Ga0501079_0052882
859 Ga0501079_0081601
860 Ga0501079_0098718
861 Ga0501079_0107418
862 Ga0501079_0675920
863 Ga0501080_0000026
864 Ga0501080_0024671
865 Ga0501080_0033678
866 Ga0501080_0287874
867 Ga0501080_0737147
868 Ga0501081_0000117
869 Ga0501081_0004787
870 Ga0501081_0046172
871 Ga0501081_0057457
872 Ga0501081_0070579
873 Ga0501081_0099505
874 Ga0501081_0203124
875 Ga0501081_0349711
876 Ga0501081_0388597
877 Ga0501081_0447902
878 Ga0501083_0000136
879 Ga0501083_0058579
880 Ga0501083_0205133
881 Ga0501083_0228545
882 Ga0501035_0001888
883 Ga0501035_0036816
884 Ga0501035_0070230
885 Ga0501035_0093666
886 Ga0501035_0108366
887 Ga0501035_0160233
888 Ga0501035_0783877
889 Ga0501044_0008926
890 Ga0501044_0621953
891 Ga0501045_0000199
892 Ga0501045_0006593
893 Ga0501045_0007794
894 Ga0501045_0010369
895 Ga0501045_0017780
896 Ga0501045_0034825
897 Ga0501045_0144170
898 nmdc:mga05p37_155678_c1
899 nmdc:mga05p37_196207_c1
900 nmdc:mga05p37_3481_c1
901 nmdc:mga05p37_881294_c1
902 nmdc:mga09592_42083_c1
903 nmdc:mga0qj67_134927_c1
904 nmdc:mga06r32_22681_c1
905 nmdc:mga06r32_92055_c1
906 nmdc:mga08y16_174674_c1
907 nmdc:mga08y16_223358_c1
908 nmdc:mga08y16_465662_c1
909 nmdc:mga08y16_664864_c1
910 nmdc:mga08y16_72373_c1
911 nmdc:mga0n895_137462_c1
912 nmdc:mga0n895_69803_c1
913 nmdc:mga0rr50_119782_c1
914 nmdc:mga0a205_131607_c1
915 nmdc:mga0a205_7514_c1
916 Ga0501084_0000105
917 Ga0501084_0018678
918 Ga0501084_0031972
919 Ga0590077_023266
920 Ga0501082_0000897
921 Ga0501082_0001243
922 Ga0501082_0002954
923 Ga0501082_0021003
924 Ga0501082_0029958
925 Ga0501082_0125287
926 Ga0501082_0326785
927 Ga0501082_0582019
928 Ga0501082_0612479
929 Ga0530510_0000145
930 Ga0530510_0000434
931 Ga0530510_0090847
932 Ga0530510_0095250
933 Ga0530510_0098042
934 Ga0530510_0102848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

9

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8999 2 223
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8923 2 223
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.8897 7 211
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8847 2 223
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8773 2 223
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8979 2 223 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8903 2 223 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8149 1 216 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7886 1 216 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7654 3 142 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1F2XQP2-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9963 9 161 GO:0005829
GO:0010124
AF-A0A1Q6XFD7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9892 1 146 GO:0005829
GO:0010124
AF-A0A7V9TAG5-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9887 1 72 GO:0005829
GO:0010124
AF-A0A7Z9MQZ8-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9869 5 84 GO:0005829
GO:0010124
AF-A0A1F3B225-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9837 4 166 GO:0005829
GO:0010124

Map