F449929

General Info

Members Datasets Scaffolds Average Seq Length
467 263 934 393

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_7159_c1|nmdc:mga0yw44_7159_c1_32_1345
Length 422
Sequence MRKRHVEETDMRSTGRILTTHVGSLVRPAQLVSFLKQQQNHESYDPAGHEECLRRSVVEVVQRQTEVGIDIVSDGEFGKSISWSRYVLERISGFEERVDHTAGFRPAIAGKDRFAGMGKDSAQLGTWVITAPIRYIGHQALQRDIATLKAAMKEAGAQHGFLPVVAPASVVPARKDEHYRSEEEALFAIADALREEYQAIVDAGLTVQVDDAFLASSYDVMVPPRSLADYRKWAAVRVEAVNHALRGIPAEQSRYHLCWGSWNGPHTNDVAIKDIIDLVLRIRVGGYSLEMANPRHEHEWRVWEKVRLPKGRVLIPGLVSHSTNVVEHPELVAERIIRLARLVGRDNVIASTDCGFAQGPFARRVHPSIMWAKLRAVVDGARLATRELWRRSDEGTQAGLGEEEAELDGASAQEETNGGLVG

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 5.14
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_7159_c1 3300050492 Bacteria 5463
2 JGI24749J21850_1004349 3300002076 Bacteria 1980
3 JGI24744J21845_10009532 3300002077 Bacteria 1992
4 JGI24033J26618_1004699 3300002155 Bacteria 1481
5 JGI24742J22300_10009826 3300002244 Bacteria 1580
6 JGI25406J46586_10004797 3300003203 Bacteria 6289
7 JGI25406J46586_10008850 3300003203 Plasmid 4533
8 JGI25406J46586_10020792 3300003203 Bacteria 2646
9 Ga0070676_10005886 3300005328 Bacteria 6545
10 Ga0068869_100014483 3300005334 Bacteria 5268
11 Ga0068869_100095492 3300005334 Bacteria 2243
12 Ga0070666_10003833 3300005335 Bacteria 9119
13 Ga0070680_100234922 3300005336 Bacteria 1549
14 Ga0068868_100074856 3300005338 Bacteria 2705
15 Ga0070689_100213982 3300005340 Bacteria 1578
16 Ga0070691_10066279 3300005341 Bacteria 1745
17 Ga0070661_100116593 3300005344 Unclassified 1998
18 Ga0070692_10011953 3300005345 Bacteria 4002
19 Ga0070669_100013985 3300005353 Bacteria 5707
20 Ga0070669_100032817 3300005353 Bacteria 3751
21 Ga0070669_100190022 3300005353 Bacteria 1610
22 Ga0070675_100038899 3300005354 Bacteria 3879
23 Ga0070675_100118634 3300005354 Bacteria 2246
24 Ga0070671_100003112 3300005355 Bacteria 12921
25 Ga0070671_100036193 3300005355 Bacteria 4092
26 Ga0070674_100004836 3300005356 Bacteria 7723
27 Ga0070673_100000963 3300005364 Bacteria 16323
28 Ga0070673_100017854 3300005364 Bacteria 5056
29 Ga0070673_100146231 3300005364 Bacteria 1998
30 Ga0070659_100110901 3300005366 Bacteria 2214
31 Ga0070659_100243104 3300005366 Bacteria 1490
32 Ga0070667_100075115 3300005367 Bacteria 2885
33 Ga0070667_100076101 3300005367 Bacteria 2866
34 Ga0070667_100301218 3300005367 Unclassified 1443
35 Ga0070714_100006783 3300005435 Bacteria 8875
36 Ga0070713_100020431 3300005436 Bacteria 5077
37 Ga0070710_10037119 3300005437 Bacteria 2668
38 Ga0070701_10048621 3300005438 Bacteria 2190
39 Ga0070711_100049876 3300005439 Bacteria 2867
40 Ga0070705_100138832 3300005440 Bacteria 1597
41 Ga0070705_100252892 3300005440 Bacteria 1238
42 Ga0070700_100004815 3300005441 Bacteria 7081
43 Ga0070700_100077403 3300005441 Bacteria 2138
44 Ga0070694_100130366 3300005444 Bacteria 1816
45 Ga0070663_100166794 3300005455 Bacteria 1699
46 Ga0070678_100164407 3300005456 Bacteria 1801
47 Ga0070678_100171508 3300005456 Unclassified 1767
48 Ga0070662_100076046 3300005457 Bacteria 2488
49 Ga0070662_100149380 3300005457 Bacteria 1817
50 Ga0070681_10273974 3300005458 Bacteria 1599
51 Ga0068867_100018376 3300005459 Bacteria 4969
52 Ga0068867_100169337 3300005459 Bacteria 1729
53 Ga0070685_10080940 3300005466 Bacteria 1947
54 Ga0070706_100082107 3300005467 Bacteria 2985
55 Ga0070706_100141291 3300005467 Bacteria 2248
56 Ga0070698_100108645 3300005471 Bacteria 2741
57 Ga0070679_100100726 3300005530 Bacteria 2875
58 Ga0070679_100228482 3300005530 Unclassified 1820
59 Ga0070697_100191461 3300005536 Bacteria 1736
60 Ga0068853_100079568 3300005539 Bacteria 2866
61 Ga0070672_100222678 3300005543 Bacteria 1583
62 Ga0070686_100051551 3300005544 Bacteria 2620
63 Ga0070665_100030332 3300005548 Bacteria 5443
64 Ga0070665_100167092 3300005548 Bacteria 2202
65 Ga0068855_100077909 3300005563 Unclassified 3846
66 Ga0068855_100382708 3300005563 Bacteria 1544
67 Ga0070664_100024835 3300005564 Bacteria 4963
68 Ga0068857_100001987 3300005577 Bacteria 16559
69 Ga0068857_100080039 3300005577 Bacteria 2917
70 Ga0068857_100144581 3300005577 Bacteria 2151
71 Ga0068854_100327546 3300005578 Bacteria 1247
72 Ga0068852_100349876 3300005616 Bacteria 1443
73 Ga0068859_100074551 3300005617 Bacteria 3432
74 Ga0068859_100257305 3300005617 Bacteria 1836
75 Ga0068859_100325761 3300005617 Bacteria 1630
76 Ga0068864_100097309 3300005618 Bacteria 2605
77 Ga0068864_100280863 3300005618 Bacteria 1554
78 Ga0068866_10093685 3300005718 Bacteria 1641
79 Ga0068861_100010452 3300005719 Bacteria 6442
80 Ga0068861_100202153 3300005719 Bacteria 1668
81 Ga0068863_100143475 3300005841 Bacteria 2283
82 Ga0068858_100040254 3300005842 Bacteria 4333
83 Ga0068858_100043151 3300005842 Bacteria 4181
84 Ga0068858_100246319 3300005842 Bacteria 1697
85 Ga0068860_100004039 3300005843 Bacteria 15072
86 Ga0068862_100014226 3300005844 Bacteria 6598
87 Ga0081455_10000010 3300005937 Bacteria 248212
88 Ga0081455_10004650 3300005937 Bacteria 15288
89 Ga0081455_10009295 3300005937 Bacteria 10123
90 Ga0081455_10013847 3300005937 Bacteria 7933
91 Ga0081455_10061809 3300005937 Bacteria 3150
92 Ga0081540_1001486 3300005983 Bacteria 20247
93 Ga0081540_1009406 3300005983 Bacteria 6735
94 Ga0081539_10000045 3300005985 Bacteria 277027
95 Ga0081539_10000209 3300005985 Bacteria 136637
96 Ga0081539_10003137 3300005985 Bacteria 21063
97 Ga0081539_10003965 3300005985 Bacteria 17133
98 Ga0070717_10008496 3300006028 Bacteria 7669
99 Ga0075365_10046979 3300006038 Bacteria 2837
100 Ga0075365_10068853 3300006038 Bacteria 2378
101 Ga0075365_10117902 3300006038 Unclassified 1829
102 Ga0070715_10043582 3300006163 Bacteria 1893
103 Ga0070712_100030292 3300006175 Bacteria 3634
104 Ga0070712_100032024 3300006175 Bacteria 3547
105 Ga0070712_100173020 3300006175 Unclassified 1677
106 Ga0075362_10004433 3300006177 Bacteria 5045
107 Ga0075362_10059391 3300006177 Unclassified 1727
108 Ga0075367_10013802 3300006178 Bacteria 4357
109 Ga0075369_10012777 3300006186 Bacteria 3319
110 Ga0075366_10006068 3300006195 Bacteria 6583
111 Ga0097621_100020994 3300006237 Bacteria 5041
112 Ga0097621_100022262 3300006237 Bacteria 4918
113 Ga0068871_100042306 3300006358 Bacteria 3657
114 Ga0068871_100064143 3300006358 Bacteria 3007
115 Ga0068871_100087247 3300006358 Bacteria 2594
116 Ga0075428_100031818 3300006844 Bacteria 5828
117 Ga0075428_100207843 3300006844 Bacteria 2116
118 Ga0075428_100290712 3300006844 Bacteria 1758
119 Ga0075430_100005721 3300006846 Bacteria 10485
120 Ga0075430_100238506 3300006846 Bacteria 1507
121 Ga0075431_100035120 3300006847 Bacteria 5163
122 Ga0075431_100242515 3300006847 Bacteria 1833
123 Ga0075434_100025939 3300006871 Bacteria 5737
124 Ga0075434_100045248 3300006871 Bacteria 4366
125 Ga0075429_100165178 3300006880 Bacteria 1939
126 Ga0075429_100203184 3300006880 Bacteria 1736
127 Ga0068865_100138802 3300006881 Bacteria 1830
128 Ga0097620_100074553 3300006931 Bacteria 3432
129 Ga0097620_100257289 3300006931 Bacteria 1836
130 Ga0097620_100325756 3300006931 Bacteria 1630
131 Ga0075435_100115746 3300007076 Bacteria 2232
132 Ga0105240_10234063 3300009093 Unclassified 2133
133 Ga0105240_10319320 3300009093 Unclassified 1771
134 Ga0105240_10434101 3300009093 Unclassified 1473
135 Ga0111539_10103497 3300009094 Bacteria 3341
136 Ga0111539_10330085 3300009094 Bacteria 1776
137 Ga0105245_10007608 3300009098 Bacteria 9485
138 Ga0105245_10018989 3300009098 Bacteria 6017
139 Ga0105245_10027618 3300009098 Bacteria 5001
140 Ga0105245_10052381 3300009098 Bacteria 3660
141 Ga0105247_10005149 3300009101 Bacteria 8271
142 Ga0114129_10014369 3300009147 Bacteria 11286
143 Ga0114129_10137178 3300009147 Bacteria 3356
144 Ga0114129_10288365 3300009147 Bacteria 2191
145 Ga0114129_10301215 3300009147 Unclassified 2136
146 Ga0105243_10004481 3300009148 Bacteria 11041
147 Ga0105241_10115919 3300009174 Unclassified 2151
148 Ga0105241_10310658 3300009174 Unclassified 1356
149 Ga0105242_10087545 3300009176 Bacteria 2615
150 Ga0105242_10117439 3300009176 Bacteria 2277
151 Ga0105242_10326236 3300009176 Bacteria 1410
152 Ga0105248_10040587 3300009177 Bacteria 5217
153 Ga0105248_10054561 3300009177 Bacteria 4482
154 Ga0105248_10216581 3300009177 Unclassified 2157
155 Ga0105248_10227713 3300009177 Bacteria 2098
156 Ga0105237_10038219 3300009545 Bacteria 4848
157 Ga0105237_10117010 3300009545 Bacteria 2659
158 Ga0105237_10122742 3300009545 Bacteria 2592
159 Ga0105238_10010578 3300009551 Bacteria 9264
160 Ga0105249_10037880 3300009553 Bacteria 4376
161 Ga0105239_10034263 3300010375 Bacteria 5574
162 Ga0105239_10230073 3300010375 Bacteria 2080
163 Ga0105239_10260047 3300010375 Unclassified 1950
164 Ga0105246_10166732 3300011119 Bacteria 1683
165 Ga0157370_10021182 3300013104 Bacteria 6481
166 Ga0157369_10005478 3300013105 Bacteria 14753
167 Ga0157374_10243634 3300013296 Bacteria 1768
168 Ga0157374_10328895 3300013296 Bacteria 1516
169 Ga0157378_10139580 3300013297 Bacteria 2249
170 Ga0163162_10040613 3300013306 Bacteria 4653
171 Ga0163162_10302173 3300013306 Unclassified 1732
172 Ga0157375_10155374 3300013308 Bacteria 2426
173 Ga0163163_10041505 3300014325 Bacteria 4499
174 Ga0163163_10135156 3300014325 Bacteria 2507
175 Ga0163163_10136599 3300014325 Bacteria 2493
176 Ga0157380_10032530 3300014326 Bacteria 4013
177 Ga0157380_10053689 3300014326 Bacteria 3196
178 Ga0182008_10004840 3300014497 Bacteria 7780
179 Ga0157377_10013559 3300014745 Bacteria 4127
180 Ga0157379_10025091 3300014968 Bacteria 5293
181 Ga0157376_10112015 3300014969 Bacteria 2404
182 Ga0157376_10353162 3300014969 Bacteria 1408
183 Ga0213872_10032277 3300021361 Bacteria 2400
184 Ga0213876_10005372 3300021384 Bacteria 7049
185 Ga0213876_10008572 3300021384 Bacteria 5535
186 Ga0213876_10056486 3300021384 Bacteria 2072
187 Ga0213875_10005457 3300021388 Bacteria 6824
188 Ga0213875_10044689 3300021388 Bacteria 2080
189 Ga0213875_10074949 3300021388 Bacteria 1579
190 Ga0207692_10001521 3300025898 Bacteria 8711
191 Ga0207692_10023406 3300025898 Bacteria 2856
192 Ga0207688_10002043 3300025901 Bacteria 10842
193 Ga0207680_10003757 3300025903 Bacteria 7144
194 Ga0207647_10026402 3300025904 Bacteria 3801
195 Ga0207685_10026239 3300025905 Bacteria 2023
196 Ga0207699_10080199 3300025906 Bacteria 2021
197 Ga0207645_10105292 3300025907 Bacteria 1822
198 Ga0207643_10001049 3300025908 Bacteria 16394
199 Ga0207643_10005091 3300025908 Bacteria 7036
200 Ga0207684_10114477 3300025910 Bacteria 2309
201 Ga0207707_10238815 3300025912 Bacteria 1580
202 Ga0207695_10376562 3300025913 Unclassified 1305
203 Ga0207693_10012043 3300025915 Bacteria 6994
204 Ga0207693_10044144 3300025915 Bacteria 3503
205 Ga0207693_10061522 3300025915 Bacteria 2940
206 Ga0207693_10170423 3300025915 Bacteria 1714
207 Ga0207693_10224063 3300025915 Bacteria 1477
208 Ga0207663_10033327 3300025916 Bacteria 3068
209 Ga0207660_10040936 3300025917 Bacteria 3246
210 Ga0207660_10187524 3300025917 Unclassified 1609
211 Ga0207657_10022093 3300025919 Bacteria 5971
212 Ga0207652_10101710 3300025921 Bacteria 2539
213 Ga0207646_10102388 3300025922 Bacteria 2567
214 Ga0207681_10022348 3300025923 Bacteria 4034
215 Ga0207681_10030571 3300025923 Bacteria 3511
216 Ga0207681_10070448 3300025923 Bacteria 2435
217 Ga0207694_10003974 3300025924 Bacteria 11663
218 Ga0207659_10049017 3300025926 Bacteria 2994
219 Ga0207687_10006328 3300025927 Bacteria 7825
220 Ga0207687_10023584 3300025927 Bacteria 4104
221 Ga0207700_10003226 3300025928 Bacteria 9420
222 Ga0207700_10004420 3300025928 Bacteria 8287
223 Ga0207700_10210599 3300025928 Bacteria 1643
224 Ga0207644_10003904 3300025931 Bacteria 9666
225 Ga0207644_10121732 3300025931 Bacteria 1987
226 Ga0207644_10272117 3300025931 Bacteria 1357
227 Ga0207690_10071343 3300025932 Bacteria 2395
228 Ga0207690_10139724 3300025932 Bacteria 1783
229 Ga0207706_10019022 3300025933 Bacteria 6178
230 Ga0207706_10049284 3300025933 Bacteria 3722
231 Ga0207686_10004367 3300025934 Bacteria 7578
232 Ga0207686_10041406 3300025934 Bacteria 2808
233 Ga0207670_10029894 3300025936 Bacteria 3475
234 Ga0207669_10003728 3300025937 Bacteria 6625
235 Ga0207704_10007169 3300025938 Bacteria 5246
236 Ga0207704_10014627 3300025938 Bacteria 3969
237 Ga0207704_10029243 3300025938 Bacteria 3069
238 Ga0207665_10000206 3300025939 Bacteria 39664
239 Ga0207691_10007584 3300025940 Bacteria 10444
240 Ga0207691_10056107 3300025940 Bacteria 3589
241 Ga0207691_10081186 3300025940 Bacteria 2915
242 Ga0207711_10045386 3300025941 Bacteria 3756
243 Ga0207711_10105993 3300025941 Bacteria 2493
244 Ga0207689_10015069 3300025942 Bacteria 6554
245 Ga0207689_10018396 3300025942 Bacteria 5895
246 Ga0207689_10092471 3300025942 Bacteria 2485
247 Ga0207661_10210922 3300025944 Bacteria 1712
248 Ga0207667_10170585 3300025949 Bacteria 2236
249 Ga0207651_10013775 3300025960 Bacteria 4642
250 Ga0207651_10039864 3300025960 Bacteria 3101
251 Ga0207651_10057650 3300025960 Bacteria 2680
252 Ga0207712_10003798 3300025961 Bacteria 9527
253 Ga0207712_10088414 3300025961 Bacteria 2275
254 Ga0207668_10063627 3300025972 Bacteria 2603
255 Ga0207658_10007450 3300025986 Bacteria 7460
256 Ga0207658_10150562 3300025986 Bacteria 1895
257 Ga0207677_10036333 3300026023 Bacteria 3210
258 Ga0207677_10199419 3300026023 Bacteria 1589
259 Ga0207703_10105105 3300026035 Bacteria 2400
260 Ga0207703_10163689 3300026035 Bacteria 1950
261 Ga0207639_10045583 3300026041 Bacteria 3304
262 Ga0207678_10050766 3300026067 Bacteria 3583
263 Ga0207678_10186182 3300026067 Unclassified 1773
264 Ga0207708_10002189 3300026075 Bacteria 14429
265 Ga0207708_10009944 3300026075 Bacteria 7062
266 Ga0207641_10022101 3300026088 Bacteria 5234
267 Ga0207641_10044339 3300026088 Bacteria 3740
268 Ga0207641_10181855 3300026088 Bacteria 1926
269 Ga0207648_10001591 3300026089 Bacteria 24877
270 Ga0207648_10002083 3300026089 Bacteria 21780
271 Ga0207648_10075053 3300026089 Bacteria 2948
272 Ga0207648_10180129 3300026089 Bacteria 1870
273 Ga0207676_10046099 3300026095 Bacteria 3371
274 Ga0207676_10231448 3300026095 Bacteria 1652
275 Ga0207674_10010224 3300026116 Bacteria 10659
276 Ga0207674_10040002 3300026116 Bacteria 4858
277 Ga0207674_10098029 3300026116 Bacteria 2915
278 Ga0207674_10264634 3300026116 Bacteria 1667
279 Ga0207675_100000915 3300026118 Bacteria 29452
280 Ga0207675_100005864 3300026118 Bacteria 11731
281 Ga0207675_100008812 3300026118 Bacteria 9470
282 Ga0207675_100145103 3300026118 Bacteria 2256
283 Ga0207675_100233141 3300026118 Bacteria 1776
284 Ga0207683_10021684 3300026121 Bacteria 5505
285 Ga0207683_10029430 3300026121 Bacteria 4755
286 Ga0207428_10063219 3300027907 Bacteria 2925
287 Ga0207428_10067226 3300027907 Bacteria 2822
288 Ga0268266_10242045 3300028379 Bacteria 1666
289 Ga0268266_10341131 3300028379 Bacteria 1406
290 Ga0268265_10005556 3300028380 Bacteria 8607
291 Ga0268264_10001793 3300028381 Bacteria 19629
292 Ga0268264_10163156 3300028381 Bacteria 2009
293 Ga0265338_10190980 3300028800 Bacteria 1553
294 Ga0373926_0022029 3300035083 Bacteria 2210
295 Ga0373934_0086532 3300035086 Bacteria 1261
296 Ga0373923_0012432 3300035111 Unclassified 3147
297 Ga0373923_0077655 3300035111 Bacteria 1436
298 Ga0373954_0003716 3300035118 Bacteria 6500
299 Ga0373956_0041017 3300035119 Bacteria 2054
300 Ga0373955_0004302 3300035172 Bacteria 6290
301 Ga0373955_0123467 3300035172 Bacteria 1507
302 Ga0373935_0008315 3300035692 Bacteria 6207
303 Ga0373935_0082633 3300035692 Bacteria 2090
304 Ga0373935_0191301 3300035692 Bacteria 1410
305 Ga0373927_0034082 3300035695 Bacteria 3313
306 Ga0373927_0130962 3300035695 Bacteria 1638
307 Ga0373933_0002686 3300035724 Bacteria 9961
308 Ga0373933_0062747 3300035724 Bacteria 2245
309 Ga0373947_0096807 3300035725 Bacteria 1849
310 Ga0373937_0002070 3300036401 Bacteria 16777
311 Ga0373937_0002127 3300036401 Bacteria 16559
312 Ga0373937_0005434 3300036401 Bacteria 10906
313 Ga0373937_0076316 3300036401 Bacteria 3095
314 Ga0316584_0046844 3300036712 Unclassified 3230
315 Ga0395898_0147083 3300037466 Bacteria 2255
316 Ga0395905_0127436 3300037471 Bacteria 2394
317 Ga0436364_0109292 3300037853 Bacteria 7653
318 Ga0436364_0260948 3300037853 Bacteria 2837
319 Ga0436364_0475360 3300037853 Bacteria 19007
320 Ga0436364_0755138 3300037853 Bacteria 7864
321 Ga0436364_0794783 3300037853 Bacteria 2380
322 Ga0436364_0817345 3300037853 Bacteria 1867
323 Ga0436364_1393458 3300037853 Bacteria 4257
324 Ga0436365_0135564 3300039437 Bacteria 5201
325 Ga0436365_0469579 3300039437 Bacteria 37854
326 Ga0436365_0673881 3300039437 Bacteria 51528
327 Ga0436365_0675328 3300039437 Bacteria 4476
328 Ga0436365_0844216 3300039437 Bacteria 2965
329 Ga0436365_1048248 3300039437 Bacteria 5757
330 Ga0436365_1076160 3300039437 Bacteria 1201
331 Ga0436365_1135173 3300039437 Bacteria 5463
332 Ga0436361_0050562 3300039447 Bacteria 9791
333 Ga0451804_0827105 3300041463 Bacteria 1180
334 Ga0466971_0018951 3300044719 Bacteria 3052
335 Ga0495592_0028726 3300046454 Bacteria 4209
336 Ga0495629_0003032 3300046459 Bacteria 12766
337 Ga0495629_0086133 3300046459 Bacteria 2192
338 Ga0495641_0069661 3300046461 Bacteria 1580
339 Ga0495651_0001252 3300046462 Bacteria 19677
340 Ga0495651_0087740 3300046462 Bacteria 2339
341 Ga0495653_0010652 3300046463 Bacteria 7526
342 Ga0495653_0182214 3300046463 Unclassified 1440
343 Ga0495580_0002005 3300046472 Bacteria 17922
344 Ga0495639_0013254 3300046475 Bacteria 3557
345 Ga0495664_0001635 3300046477 Bacteria 11895
346 Ga0495664_0026411 3300046477 Bacteria 3382
347 Ga0495585_0080871 3300046492 Bacteria 1761
348 Ga0495594_0017085 3300046499 Bacteria 3830
349 Ga0495608_0000889 3300046511 Bacteria 20929
350 Ga0495618_0009250 3300046514 Bacteria 5945
351 Ga0495628_0007666 3300046516 Bacteria 9332
352 Ga0495628_0030426 3300046516 Bacteria 4370
353 Ga0495628_0171632 3300046516 Unclassified 1644
354 Ga0495630_0233290 3300046517 Bacteria 1406
355 Ga0495652_0020146 3300046529 Bacteria 5929
356 Ga0495640_0004694 3300046533 Bacteria 10888
357 Ga0495587_0006669 3300046536 Bacteria 7521
358 Ga0495587_0014806 3300046536 Unclassified 4881
359 Ga0495598_0013771 3300046537 Bacteria 2012
360 Ga0495598_0016495 3300046537 Bacteria 1885
361 Ga0495645_0003844 3300046543 Bacteria 10219
362 Ga0495645_0048117 3300046543 Bacteria 3106
363 Ga0495667_0001552 3300046559 Bacteria 15239
364 Ga0495667_0111935 3300046559 Bacteria 1764
365 Ga0495668_0075069 3300046616 Bacteria 1857
366 Ga0495634_0003689 3300046642 Bacteria 12216
367 Ga0495635_0001622 3300046663 Bacteria 15144
368 Ga0495657_0007942 3300046675 Bacteria 8137
369 Ga0495657_0051506 3300046675 Bacteria 2764
370 Ga0495599_0003285 3300046678 Bacteria 9429
371 Ga0495599_0024812 3300046678 Bacteria 3750
372 Ga0495599_0109102 3300046678 Bacteria 1724
373 Ga0495623_0026627 3300046679 Bacteria 3721
374 Ga0495646_0008232 3300046680 Bacteria 6629
375 Ga0495646_0036334 3300046680 Bacteria 3052
376 Ga0495600_0003041 3300046809 Bacteria 9796
377 Ga0495604_0001327 3300047317 Bacteria 20201
378 Ga0495604_0084719 3300047317 Bacteria 2366
379 Ga0495674_0001719 3300047319 Bacteria 21540
380 Ga0495674_0020007 3300047319 Bacteria 6205
381 Ga0495680_0001084 3300047322 Bacteria 30182
382 Ga0495680_0063372 3300047322 Bacteria 2839
383 Ga0495680_0075009 3300047322 Unclassified 2567
384 Ga0495675_0015101 3300047444 Bacteria 4883
385 Ga0495675_0020588 3300047444 Bacteria 4198
386 Ga0495681_0082487 3300047470 Bacteria 1433
387 Ga0495684_0012418 3300047471 Bacteria 6569
388 Ga0495684_0015315 3300047471 Bacteria 5905
389 Ga0495686_0128346 3300047472 Bacteria 1506
390 Ga0495593_0007778 3300047673 Bacteria 6249
391 Ga0495593_0034383 3300047673 Bacteria 2757
392 Ga0495602_0004186 3300048088 Bacteria 15012
393 Ga0495602_0014910 3300048088 Bacteria 7866
394 Ga0496100_0083238 3300048903 Bacteria 2165
395 Ga0496101_0157301 3300048904 Bacteria 1741
396 Ga0496102_0021154 3300048905 Bacteria 5752
397 Ga0496102_0248888 3300048905 Unclassified 1675
398 Ga0496103_0006759 3300048906 Bacteria 6845
399 Ga0496104_0003216 3300048907 Bacteria 14052
400 Ga0496105_0003033 3300048908 Bacteria 12347
401 Ga0496105_0027208 3300048908 Bacteria 4669
402 Ga0496106_0020546 3300048909 Bacteria 4902
403 Ga0496106_0073451 3300048909 Bacteria 2617
404 Ga0496106_0094083 3300048909 Bacteria 2316
405 Ga0496107_0028113 3300048910 Bacteria 3995
406 Ga0496108_0000400 3300048911 Bacteria 35840
407 Ga0496108_0166437 3300048911 Bacteria 1906
408 Ga0496109_0000460 3300048912 Bacteria 34832
409 Ga0496110_0003272 3300048913 Bacteria 12355
410 Ga0496110_0227917 3300048913 Bacteria 1694
411 Ga0496111_0007827 3300048914 Bacteria 7038
412 Ga0496111_0027296 3300048914 Bacteria 4037
413 Ga0496112_0150590 3300048915 Bacteria 2293
414 Ga0496112_0160374 3300048915 Bacteria 2215
415 Ga0496113_0001550 3300048916 Bacteria 12889
416 Ga0496114_0032592 3300048917 Bacteria 4289
417 Ga0501034_0231193 3300049571 Bacteria 1798
418 Ga0501034_0487258 3300049571 Bacteria 1148
419 Ga0501070_0164241 3300049586 Bacteria 1830
420 Ga0501070_0290279 3300049586 Bacteria 1333
421 Ga0501072_0079859 3300049588 Unclassified 2591
422 Ga0501073_0150570 3300049589 Bacteria 1613
423 Ga0501075_0064934 3300049591 Unclassified 2753
424 Ga0501077_0006370 3300049593 Bacteria 7236
425 Ga0501080_0068518 3300049742 Bacteria 3301
426 Ga0501080_0120400 3300049742 Bacteria 2433
427 Ga0501080_0160652 3300049742 Bacteria 2075
428 Ga0501044_0241315 3300049823 Bacteria 1751
429 Ga0501044_0249654 3300049823 Bacteria 1716
430 nmdc:mga03683_3744_c1 3300050489 Bacteria 4958
431 nmdc:mga00v17_5725_c1 3300050491 Bacteria 6565
432 nmdc:mga0yw44_8132_c1 3300050492 Bacteria 5209
433 nmdc:mga0k408_1902_c1 3300050493 Bacteria 11169
434 nmdc:mga06z11_34213_c1 3300050494 Bacteria 2493
435 nmdc:mga05p37_107366_c1 3300050507 Bacteria 3434
436 nmdc:mga05p37_152177_c1 3300050507 Bacteria 2829
437 nmdc:mga05p37_28474_c1 3300050507 Bacteria 6811
438 nmdc:mga05p37_28678_c1 3300050507 Bacteria 6790
439 nmdc:mga09592_109138_c1 3300050508 Bacteria 2374
440 nmdc:mga0qj67_162896_c1 3300050509 Bacteria 1810
441 nmdc:mga0qj67_225966_c1 3300050509 Bacteria 1519
442 nmdc:mga0qj67_68148_c1 3300050509 Bacteria 2836
443 nmdc:mga06r32_219585_c1 3300050510 Bacteria 1889
444 nmdc:mga06r32_25561_c1 3300050510 Bacteria 5494
445 nmdc:mga06r32_32864_c1 3300050510 Bacteria 4884
446 nmdc:mga08y16_145070_c1 3300050511 Bacteria 2468
447 nmdc:mga08y16_484195_c1 3300050511 Bacteria 1259
448 nmdc:mga0n895_210959_c1 3300050512 Bacteria 1972
449 nmdc:mga0n895_32483_c1 3300050512 Bacteria 5010
450 nmdc:mga0a205_175315_c1 3300050515 Bacteria 2039
451 Ga0495601_0001288 3300053077 Bacteria 13771
452 Ga0495601_0043264 3300053077 Bacteria 2828
453 Ga0495601_0073405 3300053077 Bacteria 2187
454 Ga0495601_0102933 3300053077 Bacteria 1845
455 Ga0495612_0002454 3300053078 Bacteria 7636
456 Ga0495595_0008118 3300053084 Bacteria 4305
457 Ga0495595_0019356 3300053084 Bacteria 2953
458 Ga0495619_0006811 3300053085 Bacteria 7225
459 Ga0495619_0029193 3300053085 Bacteria 3562
460 Ga0495619_0172756 3300053085 Bacteria 1495
461 Ga0500595_005005 3300053119 Bacteria 5843
462 Ga0500652_000068 3300053131 Bacteria 45116
463 Ga0500636_0040493 3300053177 Bacteria 2755
464 Ga0501084_0007892 3300054114 Bacteria 8762
465 Ga0501082_0062076 3300060353 Bacteria 3216
466 Ga0466962_0009407 3300061719 Bacteria 4684
467 Ga0530510_0158202 3300061734 Bacteria 1675
468 nmdc:mga0yw44_7159_c1
469 JGI24749J21850_1004349
470 JGI24744J21845_10009532
471 JGI24033J26618_1004699
472 JGI24742J22300_10009826
473 JGI25406J46586_10004797
474 JGI25406J46586_10008850
475 JGI25406J46586_10020792
476 Ga0070676_10005886
477 Ga0068869_100014483
478 Ga0068869_100095492
479 Ga0070666_10003833
480 Ga0070680_100234922
481 Ga0068868_100074856
482 Ga0070689_100213982
483 Ga0070691_10066279
484 Ga0070661_100116593
485 Ga0070692_10011953
486 Ga0070669_100013985
487 Ga0070669_100032817
488 Ga0070669_100190022
489 Ga0070675_100038899
490 Ga0070675_100118634
491 Ga0070671_100003112
492 Ga0070671_100036193
493 Ga0070674_100004836
494 Ga0070673_100000963
495 Ga0070673_100017854
496 Ga0070673_100146231
497 Ga0070659_100110901
498 Ga0070659_100243104
499 Ga0070667_100075115
500 Ga0070667_100076101
501 Ga0070667_100301218
502 Ga0070714_100006783
503 Ga0070713_100020431
504 Ga0070710_10037119
505 Ga0070701_10048621
506 Ga0070711_100049876
507 Ga0070705_100138832
508 Ga0070705_100252892
509 Ga0070700_100004815
510 Ga0070700_100077403
511 Ga0070694_100130366
512 Ga0070663_100166794
513 Ga0070678_100164407
514 Ga0070678_100171508
515 Ga0070662_100076046
516 Ga0070662_100149380
517 Ga0070681_10273974
518 Ga0068867_100018376
519 Ga0068867_100169337
520 Ga0070685_10080940
521 Ga0070706_100082107
522 Ga0070706_100141291
523 Ga0070698_100108645
524 Ga0070679_100100726
525 Ga0070679_100228482
526 Ga0070697_100191461
527 Ga0068853_100079568
528 Ga0070672_100222678
529 Ga0070686_100051551
530 Ga0070665_100030332
531 Ga0070665_100167092
532 Ga0068855_100077909
533 Ga0068855_100382708
534 Ga0070664_100024835
535 Ga0068857_100001987
536 Ga0068857_100080039
537 Ga0068857_100144581
538 Ga0068854_100327546
539 Ga0068852_100349876
540 Ga0068859_100074551
541 Ga0068859_100257305
542 Ga0068859_100325761
543 Ga0068864_100097309
544 Ga0068864_100280863
545 Ga0068866_10093685
546 Ga0068861_100010452
547 Ga0068861_100202153
548 Ga0068863_100143475
549 Ga0068858_100040254
550 Ga0068858_100043151
551 Ga0068858_100246319
552 Ga0068860_100004039
553 Ga0068862_100014226
554 Ga0081455_10000010
555 Ga0081455_10004650
556 Ga0081455_10009295
557 Ga0081455_10013847
558 Ga0081455_10061809
559 Ga0081540_1001486
560 Ga0081540_1009406
561 Ga0081539_10000045
562 Ga0081539_10000209
563 Ga0081539_10003137
564 Ga0081539_10003965
565 Ga0070717_10008496
566 Ga0075365_10046979
567 Ga0075365_10068853
568 Ga0075365_10117902
569 Ga0070715_10043582
570 Ga0070712_100030292
571 Ga0070712_100032024
572 Ga0070712_100173020
573 Ga0075362_10004433
574 Ga0075362_10059391
575 Ga0075367_10013802
576 Ga0075369_10012777
577 Ga0075366_10006068
578 Ga0097621_100020994
579 Ga0097621_100022262
580 Ga0068871_100042306
581 Ga0068871_100064143
582 Ga0068871_100087247
583 Ga0075428_100031818
584 Ga0075428_100207843
585 Ga0075428_100290712
586 Ga0075430_100005721
587 Ga0075430_100238506
588 Ga0075431_100035120
589 Ga0075431_100242515
590 Ga0075434_100025939
591 Ga0075434_100045248
592 Ga0075429_100165178
593 Ga0075429_100203184
594 Ga0068865_100138802
595 Ga0097620_100074553
596 Ga0097620_100257289
597 Ga0097620_100325756
598 Ga0075435_100115746
599 Ga0105240_10234063
600 Ga0105240_10319320
601 Ga0105240_10434101
602 Ga0111539_10103497
603 Ga0111539_10330085
604 Ga0105245_10007608
605 Ga0105245_10018989
606 Ga0105245_10027618
607 Ga0105245_10052381
608 Ga0105247_10005149
609 Ga0114129_10014369
610 Ga0114129_10137178
611 Ga0114129_10288365
612 Ga0114129_10301215
613 Ga0105243_10004481
614 Ga0105241_10115919
615 Ga0105241_10310658
616 Ga0105242_10087545
617 Ga0105242_10117439
618 Ga0105242_10326236
619 Ga0105248_10040587
620 Ga0105248_10054561
621 Ga0105248_10216581
622 Ga0105248_10227713
623 Ga0105237_10038219
624 Ga0105237_10117010
625 Ga0105237_10122742
626 Ga0105238_10010578
627 Ga0105249_10037880
628 Ga0105239_10034263
629 Ga0105239_10230073
630 Ga0105239_10260047
631 Ga0105246_10166732
632 Ga0157370_10021182
633 Ga0157369_10005478
634 Ga0157374_10243634
635 Ga0157374_10328895
636 Ga0157378_10139580
637 Ga0163162_10040613
638 Ga0163162_10302173
639 Ga0157375_10155374
640 Ga0163163_10041505
641 Ga0163163_10135156
642 Ga0163163_10136599
643 Ga0157380_10032530
644 Ga0157380_10053689
645 Ga0182008_10004840
646 Ga0157377_10013559
647 Ga0157379_10025091
648 Ga0157376_10112015
649 Ga0157376_10353162
650 Ga0213872_10032277
651 Ga0213876_10005372
652 Ga0213876_10008572
653 Ga0213876_10056486
654 Ga0213875_10005457
655 Ga0213875_10044689
656 Ga0213875_10074949
657 Ga0207692_10001521
658 Ga0207692_10023406
659 Ga0207688_10002043
660 Ga0207680_10003757
661 Ga0207647_10026402
662 Ga0207685_10026239
663 Ga0207699_10080199
664 Ga0207645_10105292
665 Ga0207643_10001049
666 Ga0207643_10005091
667 Ga0207684_10114477
668 Ga0207707_10238815
669 Ga0207695_10376562
670 Ga0207693_10012043
671 Ga0207693_10044144
672 Ga0207693_10061522
673 Ga0207693_10170423
674 Ga0207693_10224063
675 Ga0207663_10033327
676 Ga0207660_10040936
677 Ga0207660_10187524
678 Ga0207657_10022093
679 Ga0207652_10101710
680 Ga0207646_10102388
681 Ga0207681_10022348
682 Ga0207681_10030571
683 Ga0207681_10070448
684 Ga0207694_10003974
685 Ga0207659_10049017
686 Ga0207687_10006328
687 Ga0207687_10023584
688 Ga0207700_10003226
689 Ga0207700_10004420
690 Ga0207700_10210599
691 Ga0207644_10003904
692 Ga0207644_10121732
693 Ga0207644_10272117
694 Ga0207690_10071343
695 Ga0207690_10139724
696 Ga0207706_10019022
697 Ga0207706_10049284
698 Ga0207686_10004367
699 Ga0207686_10041406
700 Ga0207670_10029894
701 Ga0207669_10003728
702 Ga0207704_10007169
703 Ga0207704_10014627
704 Ga0207704_10029243
705 Ga0207665_10000206
706 Ga0207691_10007584
707 Ga0207691_10056107
708 Ga0207691_10081186
709 Ga0207711_10045386
710 Ga0207711_10105993
711 Ga0207689_10015069
712 Ga0207689_10018396
713 Ga0207689_10092471
714 Ga0207661_10210922
715 Ga0207667_10170585
716 Ga0207651_10013775
717 Ga0207651_10039864
718 Ga0207651_10057650
719 Ga0207712_10003798
720 Ga0207712_10088414
721 Ga0207668_10063627
722 Ga0207658_10007450
723 Ga0207658_10150562
724 Ga0207677_10036333
725 Ga0207677_10199419
726 Ga0207703_10105105
727 Ga0207703_10163689
728 Ga0207639_10045583
729 Ga0207678_10050766
730 Ga0207678_10186182
731 Ga0207708_10002189
732 Ga0207708_10009944
733 Ga0207641_10022101
734 Ga0207641_10044339
735 Ga0207641_10181855
736 Ga0207648_10001591
737 Ga0207648_10002083
738 Ga0207648_10075053
739 Ga0207648_10180129
740 Ga0207676_10046099
741 Ga0207676_10231448
742 Ga0207674_10010224
743 Ga0207674_10040002
744 Ga0207674_10098029
745 Ga0207674_10264634
746 Ga0207675_100000915
747 Ga0207675_100005864
748 Ga0207675_100008812
749 Ga0207675_100145103
750 Ga0207675_100233141
751 Ga0207683_10021684
752 Ga0207683_10029430
753 Ga0207428_10063219
754 Ga0207428_10067226
755 Ga0268266_10242045
756 Ga0268266_10341131
757 Ga0268265_10005556
758 Ga0268264_10001793
759 Ga0268264_10163156
760 Ga0265338_10190980
761 Ga0373926_0022029
762 Ga0373934_0086532
763 Ga0373923_0012432
764 Ga0373923_0077655
765 Ga0373954_0003716
766 Ga0373956_0041017
767 Ga0373955_0004302
768 Ga0373955_0123467
769 Ga0373935_0008315
770 Ga0373935_0082633
771 Ga0373935_0191301
772 Ga0373927_0034082
773 Ga0373927_0130962
774 Ga0373933_0002686
775 Ga0373933_0062747
776 Ga0373947_0096807
777 Ga0373937_0002070
778 Ga0373937_0002127
779 Ga0373937_0005434
780 Ga0373937_0076316
781 Ga0316584_0046844
782 Ga0395898_0147083
783 Ga0395905_0127436
784 Ga0436364_0109292
785 Ga0436364_0260948
786 Ga0436364_0475360
787 Ga0436364_0755138
788 Ga0436364_0794783
789 Ga0436364_0817345
790 Ga0436364_1393458
791 Ga0436365_0135564
792 Ga0436365_0469579
793 Ga0436365_0673881
794 Ga0436365_0675328
795 Ga0436365_0844216
796 Ga0436365_1048248
797 Ga0436365_1076160
798 Ga0436365_1135173
799 Ga0436361_0050562
800 Ga0451804_0827105
801 Ga0466971_0018951
802 Ga0495592_0028726
803 Ga0495629_0003032
804 Ga0495629_0086133
805 Ga0495641_0069661
806 Ga0495651_0001252
807 Ga0495651_0087740
808 Ga0495653_0010652
809 Ga0495653_0182214
810 Ga0495580_0002005
811 Ga0495639_0013254
812 Ga0495664_0001635
813 Ga0495664_0026411
814 Ga0495585_0080871
815 Ga0495594_0017085
816 Ga0495608_0000889
817 Ga0495618_0009250
818 Ga0495628_0007666
819 Ga0495628_0030426
820 Ga0495628_0171632
821 Ga0495630_0233290
822 Ga0495652_0020146
823 Ga0495640_0004694
824 Ga0495587_0006669
825 Ga0495587_0014806
826 Ga0495598_0013771
827 Ga0495598_0016495
828 Ga0495645_0003844
829 Ga0495645_0048117
830 Ga0495667_0001552
831 Ga0495667_0111935
832 Ga0495668_0075069
833 Ga0495634_0003689
834 Ga0495635_0001622
835 Ga0495657_0007942
836 Ga0495657_0051506
837 Ga0495599_0003285
838 Ga0495599_0024812
839 Ga0495599_0109102
840 Ga0495623_0026627
841 Ga0495646_0008232
842 Ga0495646_0036334
843 Ga0495600_0003041
844 Ga0495604_0001327
845 Ga0495604_0084719
846 Ga0495674_0001719
847 Ga0495674_0020007
848 Ga0495680_0001084
849 Ga0495680_0063372
850 Ga0495680_0075009
851 Ga0495675_0015101
852 Ga0495675_0020588
853 Ga0495681_0082487
854 Ga0495684_0012418
855 Ga0495684_0015315
856 Ga0495686_0128346
857 Ga0495593_0007778
858 Ga0495593_0034383
859 Ga0495602_0004186
860 Ga0495602_0014910
861 Ga0496100_0083238
862 Ga0496101_0157301
863 Ga0496102_0021154
864 Ga0496102_0248888
865 Ga0496103_0006759
866 Ga0496104_0003216
867 Ga0496105_0003033
868 Ga0496105_0027208
869 Ga0496106_0020546
870 Ga0496106_0073451
871 Ga0496106_0094083
872 Ga0496107_0028113
873 Ga0496108_0000400
874 Ga0496108_0166437
875 Ga0496109_0000460
876 Ga0496110_0003272
877 Ga0496110_0227917
878 Ga0496111_0007827
879 Ga0496111_0027296
880 Ga0496112_0150590
881 Ga0496112_0160374
882 Ga0496113_0001550
883 Ga0496114_0032592
884 Ga0501034_0231193
885 Ga0501034_0487258
886 Ga0501070_0164241
887 Ga0501070_0290279
888 Ga0501072_0079859
889 Ga0501073_0150570
890 Ga0501075_0064934
891 Ga0501077_0006370
892 Ga0501080_0068518
893 Ga0501080_0120400
894 Ga0501080_0160652
895 Ga0501044_0241315
896 Ga0501044_0249654
897 nmdc:mga03683_3744_c1
898 nmdc:mga00v17_5725_c1
899 nmdc:mga0yw44_8132_c1
900 nmdc:mga0k408_1902_c1
901 nmdc:mga06z11_34213_c1
902 nmdc:mga05p37_107366_c1
903 nmdc:mga05p37_152177_c1
904 nmdc:mga05p37_28474_c1
905 nmdc:mga05p37_28678_c1
906 nmdc:mga09592_109138_c1
907 nmdc:mga0qj67_162896_c1
908 nmdc:mga0qj67_225966_c1
909 nmdc:mga0qj67_68148_c1
910 nmdc:mga06r32_219585_c1
911 nmdc:mga06r32_25561_c1
912 nmdc:mga06r32_32864_c1
913 nmdc:mga08y16_145070_c1
914 nmdc:mga08y16_484195_c1
915 nmdc:mga0n895_210959_c1
916 nmdc:mga0n895_32483_c1
917 nmdc:mga0a205_175315_c1
918 Ga0495601_0001288
919 Ga0495601_0043264
920 Ga0495601_0073405
921 Ga0495601_0102933
922 Ga0495612_0002454
923 Ga0495595_0008118
924 Ga0495595_0019356
925 Ga0495619_0006811
926 Ga0495619_0029193
927 Ga0495619_0172756
928 Ga0500595_005005
929 Ga0500652_000068
930 Ga0500636_0040493
931 Ga0501084_0007892
932 Ga0501082_0062076
933 Ga0466962_0009407
934 Ga0530510_0158202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

17

382

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t0c-assembly1.cif.gz_A crystal structure of streptococcus mutans mete complexed with zinc 0.8562 8 384
3rpd-assembly2.cif.gz_B the structure of a b12-independent methionine synthase from shewanella sp. w3-18-1 in complex with selenomethionine. 0.8382 7 386
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8326 8 384
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8317 7 384
3bq6-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8316 8 383
ID Description Score Start End Superfamily
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8914 308 381 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8347 2 386 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8326 7 384 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8249 6 381 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8232 2 386 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A537BYS7-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.994 282 387 GO:0016740
AF-A0A537D100-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9898 157 387 GO:0003871
GO:0008270
GO:0009086
AF-A0A2S6U3H5-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9881 311 387
AF-A0A1F4CUE1-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9869 62 387 GO:0003871
GO:0008270
GO:0009086
AF-A0A537TSJ2-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9869 1 297

Map