F449941

General Info

Members Datasets Scaffolds Average Seq Length
467 295 935 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221611|2644074493
Length 363
Sequence STVCGSPPGYPIECQSAWEHLSTDPCIYLEPCLVSELHKFLFDGLPVRGMLVRLTDAWTDILARRAGNSATGAYAAPVTELLGEMAAAGVLMQSNIKFNGALVLQVFGDGPVKLAVAEVQSDLSLRATATVTGEVPADARLSQMVNVGGGGRCAITLDPKNRHPGQQPYQGVVPLHGDHHEKLDRLSDVLQHYMLQSEQLDTVLVLGANDKVAAGLLIQRMPIKGEGNLASGLSHRENEDQIGHNEDYNRIAHLAASLTREELLSLDVDTILRRLFWEEKLVRFEPQQGETGPRFACTCSRERVSAMLRNLGAEEAESILAERGEIEVGCEFCGQQYRFDAVDAAQIFVEPAIIQPPAPTGMQ

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
249 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
252 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
269 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 2643221611 Acidovorax sp. Root219 Isolate Unclassified
274 2547132374 Acidovorax radicis N35 Isolate Unclassified
275 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
276 2643221570 Acidovorax sp. Root568 Isolate Unclassified
277 2643221596 Acidovorax sp. Root70 Isolate Unclassified
278 2643221609 Acidovorax sp. Root217 Isolate Unclassified
279 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
280 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
281 2643221652 Acidovorax sp. Root402 Isolate Unclassified
282 2643221660 Methylibium sp. Root1272 Isolate Unclassified
283 2643221717 Acidovorax sp. Root267 Isolate Unclassified
284 2721755523 Delftia sp. HK171 Isolate Unclassified
285 2738543012 Acidovorax sp. CF301 Isolate Unclassified
286 2738543013 Variovorax sp. BT01 Isolate Unclassified
287 2816332133 Acidovorax radicis 2721A Isolate Unclassified
288 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
289 2842677519 Variovorax sp. R-72495 Isolate Unclassified
290 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
291 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
292 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
293 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
294 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
295 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0.21
Isolates 4.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0.43
Rhizoplane 1.07
Rhizosphere 67.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000107 3300002705 Bacteria 59945
2 JGI25156J39149_1000421 3300002705 Bacteria 26329
3 JGI25154J39366_1000529 3300002738 Bacteria 19186
4 JGI25157J39369_1000020 3300002741 Bacteria 173287
5 JGI25153J46596_10005247 3300003215 Bacteria 6812
6 rootH1_10014123 3300003316 Bacteria 10366
7 rootH1_10001754 3300003316 Bacteria 7739
8 rootH1_10001754 3300003323 Bacteria 12269
9 Ga0006562J51391_1061276 3300003578 Bacteria 2330
10 Ga0055539_1000155 3300003752 Bacteria 65927
11 Ga0055533_1000028 3300003756 Bacteria 311012
12 Ga0055525_1000021 3300003759 Bacteria 370802
13 Ga0055525_1000795 3300003759 Bacteria 9960
14 Ga0055535_1000167 3300003761 Bacteria 71096
15 Ga0055529_1000151 3300003763 Bacteria 98866
16 Ga0055534_1002844 3300003784 Bacteria 5764
17 Ga0055531_10000051 3300003794 Bacteria 130125
18 Ga0065704_10123419 3300005289 Bacteria 1734
19 Ga0065712_10127186 3300005290 Bacteria 1593
20 Ga0070658_10012989 3300005327 Bacteria 6683
21 Ga0070658_10071311 3300005327 Bacteria 2845
22 Ga0070676_10035705 3300005328 Bacteria 2860
23 Ga0070676_10051762 3300005328 Bacteria 2412
24 Ga0070683_100122677 3300005329 Bacteria 2455
25 Ga0070690_100105241 3300005330 Bacteria 1875
26 Ga0070670_100049613 3300005331 Bacteria 3609
27 Ga0070670_100049753 3300005331 Bacteria 3603
28 Ga0070670_100060956 3300005331 Bacteria 3239
29 Ga0070677_10005435 3300005333 Bacteria 4199
30 Ga0068869_100013561 3300005334 Bacteria 5424
31 Ga0068869_100127021 3300005334 Bacteria 1957
32 Ga0068868_100005383 3300005338 Bacteria 8993
33 Ga0068868_100018577 3300005338 Bacteria 5201
34 Ga0068868_100065930 3300005338 Bacteria 2878
35 Ga0070668_100279471 3300005347 Bacteria 1394
36 Ga0070669_100006105 3300005353 Bacteria 8694
37 Ga0070675_100001535 3300005354 Bacteria 17078
38 Ga0070675_100005184 3300005354 Bacteria 9937
39 Ga0070671_100028948 3300005355 Bacteria 4565
40 Ga0070671_100049582 3300005355 Bacteria 3493
41 Ga0070671_100130598 3300005355 Bacteria 2116
42 Ga0070674_100009036 3300005356 Bacteria 5957
43 Ga0070674_100014666 3300005356 Bacteria 4875
44 Ga0070674_100198646 3300005356 Bacteria 1547
45 Ga0070673_100013924 3300005364 Bacteria 5584
46 Ga0070673_100031808 3300005364 Bacteria 3964
47 Ga0070667_100175874 3300005367 Bacteria 1892
48 Ga0070678_100100359 3300005456 Bacteria 2242
49 Ga0070678_100128147 3300005456 Bacteria 2012
50 Ga0070662_100055941 3300005457 Bacteria 2863
51 Ga0070662_100273023 3300005457 Bacteria 1366
52 Ga0068867_100002841 3300005459 Bacteria 12176
53 Ga0068867_100002971 3300005459 Bacteria 11946
54 Ga0068867_100035680 3300005459 Bacteria 3608
55 Ga0070672_100002062 3300005543 Bacteria 12665
56 Ga0070672_100100210 3300005543 Bacteria 2349
57 Ga0070665_100008010 3300005548 Bacteria 10703
58 Ga0068855_100000405 3300005563 Bacteria 53352
59 Ga0068855_100095783 3300005563 Bacteria 3421
60 Ga0068855_100097233 3300005563 Bacteria 3391
61 Ga0070664_100169409 3300005564 Bacteria 1937
62 Ga0068857_100079157 3300005577 Bacteria 2934
63 Ga0068857_100176495 3300005577 Bacteria 1943
64 Ga0068854_100175533 3300005578 Bacteria 1670
65 Ga0068856_100107056 3300005614 Bacteria 2791
66 Ga0068870_10031217 3300005840 Bacteria 2698
67 Ga0068870_10034692 3300005840 Bacteria 2583
68 Ga0068863_100482481 3300005841 Bacteria 1219
69 Ga0068862_100312604 3300005844 Bacteria 1448
70 Ga0068862_100336055 3300005844 Bacteria 1398
71 Ga0075365_10173261 3300006038 Bacteria 1507
72 Ga0075363_100053323 3300006048 Bacteria 2161
73 Ga0075362_10132251 3300006177 Bacteria 1188
74 Ga0075362_10152263 3300006177 Bacteria 1110
75 Ga0075367_10063374 3300006178 Bacteria 2209
76 Ga0075367_10066519 3300006178 Bacteria 2159
77 Ga0075366_10001775 3300006195 Bacteria 10886
78 Ga0075366_10010236 3300006195 Bacteria 5261
79 Ga0075366_10011230 3300006195 Bacteria 5053
80 Ga0075366_10012381 3300006195 Bacteria 4839
81 Ga0075366_10014071 3300006195 Bacteria 4565
82 Ga0075366_10042380 3300006195 Bacteria 2695
83 Ga0075370_10005894 3300006353 Bacteria 6128
84 Ga0075370_10012283 3300006353 Bacteria 4521
85 Ga0075370_10022729 3300006353 Bacteria 3447
86 Ga0075370_10072478 3300006353 Bacteria 1972
87 Ga0068871_100007609 3300006358 Bacteria 7747
88 Ga0068865_100039848 3300006881 Bacteria 3189
89 Ga0079104_1000002 3300006946 Bacteria 514469
90 Ga0105250_10001691 3300009092 Bacteria 11652
91 Ga0105240_10003241 3300009093 Bacteria 25466
92 Ga0105245_10030579 3300009098 Bacteria 4762
93 Ga0114129_10104062 3300009147 Bacteria 3923
94 Ga0105243_10004780 3300009148 Bacteria 10647
95 Ga0105243_10160714 3300009148 Bacteria 1937
96 Ga0105241_10201009 3300009174 Bacteria 1664
97 Ga0105242_10000656 3300009176 Bacteria 27099
98 Ga0105242_10135941 3300009176 Bacteria 2127
99 Ga0105242_10600316 3300009176 Bacteria 1063
100 Ga0105248_10443335 3300009177 Bacteria 1463
101 Ga0105237_10036055 3300009545 Bacteria 5004
102 Ga0105237_10103686 3300009545 Bacteria 2836
103 Ga0105238_10095358 3300009551 Bacteria 2962
104 Ga0105239_10012269 3300010375 Bacteria 9545
105 Ga0105246_10305681 3300011119 Bacteria 1286
106 Ga0157369_10039806 3300013105 Bacteria 5136
107 Ga0163162_10108773 3300013306 Bacteria 2869
108 Ga0157372_10287117 3300013307 Bacteria 1913
109 Ga0157375_10220662 3300013308 Bacteria 2054
110 Ga0157379_10016805 3300014968 Bacteria 6440
111 Ga0163161_10053518 3300017792 Bacteria 2927
112 Ga0213872_10000011 3300021361 Bacteria 194139
113 Ga0213872_10000172 3300021361 Bacteria 58334
114 Ga0213872_10000359 3300021361 Bacteria 38340
115 Ga0209674_100007 3300025226 Bacteria 1077082
116 Ga0209674_101662 3300025226 Bacteria 5539
117 Ga0209563_100033 3300025230 Bacteria 457883
118 Ga0207427_100912 3300025231 Bacteria 12733
119 Ga0209258_100146 3300025242 Bacteria 163331
120 Ga0209258_100499 3300025242 Bacteria 38873
121 Ga0209646_1000062 3300025246 Bacteria 252045
122 Ga0209026_1000026 3300025250 Bacteria 352109
123 Ga0209677_100082 3300025253 Bacteria 118875
124 Ga0209677_100116 3300025253 Bacteria 82606
125 Ga0209148_1015030 3300025254 Bacteria 1361
126 Ga0209759_1000050 3300025256 Bacteria 215979
127 Ga0209759_1000855 3300025256 Bacteria 23683
128 Ga0209759_1012293 3300025256 Bacteria 2380
129 Ga0209759_1020127 3300025256 Bacteria 1560
130 Ga0209455_1000059 3300025272 Bacteria 339995
131 Ga0209673_1033474 3300025273 Bacteria 1566
132 Ga0209130_1001702 3300025284 Bacteria 13299
133 Ga0209675_1002145 3300025291 Bacteria 10408
134 Ga0209676_1034220 3300025292 Bacteria 1504
135 Ga0209025_1028509 3300025294 Bacteria 2732
136 Ga0209758_1000045 3300025297 Bacteria 369174
137 Ga0209050_1003330 3300025298 Bacteria 11984
138 Ga0209050_1027799 3300025298 Bacteria 1853
139 Ga0209051_1000320 3300025303 Bacteria 72764
140 Ga0209051_1003268 3300025303 Bacteria 10758
141 Ga0209051_1004347 3300025303 Bacteria 8779
142 Ga0209051_1004802 3300025303 Bacteria 8151
143 Ga0209257_1000017 3300025304 Bacteria 866287
144 Ga0209257_1000161 3300025304 Bacteria 176089
145 Ga0207682_10001523 3300025893 Bacteria 10677
146 Ga0207645_10008686 3300025907 Bacteria 7073
147 Ga0207645_10021380 3300025907 Bacteria 4219
148 Ga0207645_10050483 3300025907 Bacteria 2656
149 Ga0207643_10037250 3300025908 Bacteria 2729
150 Ga0207705_10012186 3300025909 Bacteria 6215
151 Ga0207705_10084335 3300025909 Bacteria 2320
152 Ga0207654_10020266 3300025911 Bacteria 3522
153 Ga0207695_10075501 3300025913 Bacteria 3429
154 Ga0207695_10242082 3300025913 Bacteria 1705
155 Ga0207652_10171367 3300025921 Bacteria 1948
156 Ga0207681_10071740 3300025923 Bacteria 2416
157 Ga0207694_10065552 3300025924 Bacteria 2832
158 Ga0207650_10002460 3300025925 Bacteria 12887
159 Ga0207650_10069254 3300025925 Bacteria 2650
160 Ga0207659_10001118 3300025926 Bacteria 15897
161 Ga0207659_10006295 3300025926 Bacteria 7260
162 Ga0207687_10246298 3300025927 Bacteria 1419
163 Ga0207687_10506932 3300025927 Bacteria 1008
164 Ga0207644_10034911 3300025931 Bacteria 3521
165 Ga0207706_10017618 3300025933 Bacteria 6435
166 Ga0207706_10323890 3300025933 Bacteria 1341
167 Ga0207686_10024745 3300025934 Bacteria 3483
168 Ga0207709_10000015 3300025935 Bacteria 493221
169 Ga0207709_10151732 3300025935 Bacteria 1605
170 Ga0207669_10078565 3300025937 Bacteria 2103
171 Ga0207704_10039057 3300025938 Bacteria 2760
172 Ga0207691_10006082 3300025940 Bacteria 11664
173 Ga0207691_10007915 3300025940 Bacteria 10231
174 Ga0207691_10054596 3300025940 Bacteria 3644
175 Ga0207689_10014862 3300025942 Bacteria 6607
176 Ga0207689_10041667 3300025942 Bacteria 3799
177 Ga0207679_10013263 3300025945 Bacteria 5400
178 Ga0207679_10145579 3300025945 Bacteria 1921
179 Ga0207667_10002900 3300025949 Bacteria 21297
180 Ga0207667_10025190 3300025949 Bacteria 6518
181 Ga0207651_10006687 3300025960 Bacteria 6069
182 Ga0207651_10008923 3300025960 Bacteria 5446
183 Ga0207668_10204384 3300025972 Bacteria 1575
184 Ga0207640_10015753 3300025981 Bacteria 4382
185 Ga0207677_10002779 3300026023 Bacteria 9244
186 Ga0207677_10020394 3300026023 Bacteria 4024
187 Ga0207677_10085330 3300026023 Bacteria 2279
188 Ga0207677_10086774 3300026023 Bacteria 2263
189 Ga0207639_10139682 3300026041 Bacteria 2017
190 Ga0207639_10163917 3300026041 Bacteria 1876
191 Ga0207702_10000225 3300026078 Bacteria 65968
192 Ga0207702_10260757 3300026078 Bacteria 1632
193 Ga0207641_10079866 3300026088 Bacteria 2837
194 Ga0207648_10002848 3300026089 Bacteria 18311
195 Ga0207648_10010781 3300026089 Bacteria 8636
196 Ga0207648_10026360 3300026089 Bacteria 5166
197 Ga0207674_10006381 3300026116 Bacteria 13881
198 Ga0207674_10008218 3300026116 Bacteria 12093
199 Ga0207675_100239110 3300026118 Bacteria 1754
200 Ga0207683_10006663 3300026121 Bacteria 9879
201 Ga0207683_10098567 3300026121 Bacteria 2608
202 Ga0207683_10163110 3300026121 Bacteria 2016
203 Ga0207698_10391690 3300026142 Bacteria 1325
204 Ga0209281_1000007 3300027111 Bacteria 938265
205 Ga0209970_1001451 3300027614 Bacteria 4143
206 Ga0209974_10028570 3300027876 Bacteria 1847
207 Ga0268266_10048458 3300028379 Bacteria 3642
208 Ga0268265_10343402 3300028380 Bacteria 1360
209 Ga0265336_10000016 3300028666 Bacteria 238832
210 Ga0307517_10001871 3300028786 Bacteria 34464
211 Ga0307515_10000020 3300028794 Bacteria 411735
212 Ga0307515_10000051 3300028794 Bacteria 272100
213 Ga0307515_10000991 3300028794 Bacteria 64898
214 Ga0307515_10001283 3300028794 Bacteria 57022
215 Ga0307515_10007242 3300028794 Bacteria 21968
216 Ga0307515_10008378 3300028794 Bacteria 20167
217 Ga0307515_10206057 3300028794 Bacteria 1826
218 Ga0307515_10246446 3300028794 Bacteria 1547
219 Ga0265324_10000951 3300029957 Bacteria 18083
220 Ga0307512_10032669 3300030522 Bacteria 4488
221 Ga0314311_1144639 3300030733 Bacteria 4757
222 Ga0316179_1070123 3300030734 Bacteria 2410
223 Ga0316183_1037305 3300030742 Bacteria 2432
224 Ga0265330_10000033 3300031235 Bacteria 126931
225 Ga0265332_10000001 3300031238 Bacteria 863783
226 Ga0265332_10000009 3300031238 Bacteria 295760
227 Ga0265332_10086402 3300031238 Bacteria 1329
228 Ga0265328_10005588 3300031239 Bacteria 5377
229 Ga0265320_10070162 3300031240 Bacteria 1653
230 Ga0265340_10015080 3300031247 Bacteria 4022
231 Ga0265331_10002981 3300031250 Bacteria 11141
232 Ga0265327_10001098 3300031251 Bacteria 37523
233 Ga0265316_10000115 3300031344 Bacteria 86934
234 Ga0307513_10001123 3300031456 Bacteria 38793
235 Ga0307513_10078229 3300031456 Bacteria 3421
236 Ga0307509_10014210 3300031507 Bacteria 9377
237 Ga0307509_10095501 3300031507 Bacteria 3028
238 Ga0307509_10119740 3300031507 Bacteria 2613
239 Ga0307509_10124868 3300031507 Bacteria 2542
240 Ga0307408_100000079 3300031548 Bacteria 108053
241 Ga0307408_100072360 3300031548 Bacteria 2552
242 Ga0307408_100191962 3300031548 Bacteria 1646
243 Ga0307508_10000007 3300031616 Bacteria 268359
244 Ga0307508_10000227 3300031616 Bacteria 68533
245 Ga0307508_10000945 3300031616 Bacteria 33844
246 Ga0307508_10174098 3300031616 Bacteria 1755
247 Ga0307514_10055368 3300031649 Bacteria 3049
248 Ga0307514_10057028 3300031649 Bacteria 2994
249 Ga0265314_10000022 3300031711 Bacteria 297299
250 Ga0265314_10012971 3300031711 Bacteria 6767
251 Ga0307516_10004946 3300031730 Bacteria 16201
252 Ga0307516_10005605 3300031730 Bacteria 14948
253 Ga0307405_10056697 3300031731 Bacteria 2458
254 Ga0307405_10072245 3300031731 Bacteria 2223
255 Ga0307413_10081974 3300031824 Bacteria 2070
256 Ga0307410_10037721 3300031852 Bacteria 3159
257 Ga0307410_10054826 3300031852 Bacteria 2704
258 Ga0307406_10002089 3300031901 Bacteria 10892
259 Ga0307406_10028793 3300031901 Bacteria 3358
260 Ga0307411_10023852 3300032005 Bacteria 3634
261 Ga0307411_10164140 3300032005 Bacteria 1668
262 Ga0307507_10154160 3300033179 Bacteria 1718
263 Ga0307510_10008187 3300033180 Bacteria 12453
264 Ga0307510_10020701 3300033180 Bacteria 7681
265 Ga0373931_0105899 3300035691 Bacteria 1589
266 Ga0395899_0016898 3300037312 Bacteria 5562
267 Ga0395900_0015251 3300037418 Bacteria 7836
268 Ga0395900_0058546 3300037418 Bacteria 3966
269 Ga0395900_0126397 3300037418 Bacteria 2622
270 Ga0395900_0147136 3300037418 Bacteria 2409
271 Ga0395898_0000868 3300037466 Bacteria 49428
272 Ga0395898_0025754 3300037466 Bacteria 5924
273 Ga0395898_0135515 3300037466 Bacteria 2357
274 Ga0395905_0000431 3300037471 Bacteria 58717
275 Ga0395905_0002875 3300037471 Bacteria 18810
276 Ga0395905_0005832 3300037471 Bacteria 12515
277 Ga0395905_0016129 3300037471 Bacteria 7102
278 Ga0395905_0022443 3300037471 Bacteria 5968
279 Ga0395905_0045834 3300037471 Bacteria 4101
280 Ga0395905_0067410 3300037471 Bacteria 3352
281 Ga0395905_0200214 3300037471 Bacteria 1872
282 Ga0395905_0382765 3300037471 Bacteria 1301
283 Ga0395901_0005416 3300038443 Bacteria 12913
284 Ga0395901_0167448 3300038443 Bacteria 2307
285 Ga0395901_0206903 3300038443 Bacteria 2055
286 Ga0436361_0167979 3300039447 Bacteria 86419
287 Ga0436361_0296121 3300039447 Bacteria 160237
288 Ga0436361_0311557 3300039447 Bacteria 5807
289 Ga0436361_0383238 3300039447 Bacteria 5889
290 Ga0436361_0657686 3300039447 Bacteria 74387
291 Ga0436361_0932343 3300039447 Bacteria 25287
292 Ga0451800_1171317 3300041459 Bacteria 2388
293 Ga0451855_0341822 3300041511 Bacteria 1014
294 Ga0439445_0005530 3300042004 Bacteria 2880
295 Ga0439449_0023209 3300042007 Bacteria 2321
296 Ga0439462_0013555 3300042015 Bacteria 2090
297 Ga0450911_000167 3300042115 Bacteria 25715
298 Ga0450911_008451 3300042115 Bacteria 1464
299 Ga0450898_011237 3300042134 Bacteria 1463
300 Ga0466969_0003346 3300044656 Bacteria 8535
301 Ga0466969_0032542 3300044656 Bacteria 2650
302 Ga0466969_0081365 3300044656 Bacteria 1545
303 Ga0466969_0117311 3300044656 Bacteria 1241
304 Ga0466972_0000570 3300044658 Bacteria 17989
305 Ga0466972_0006707 3300044658 Bacteria 5778
306 Ga0453683_0007448 3300044673 Bacteria 7424
307 Ga0466966_0009505 3300044684 Bacteria 6437
308 Ga0466966_0015011 3300044684 Bacteria 5124
309 Ga0466966_0023128 3300044684 Bacteria 4070
310 Ga0466966_0050807 3300044684 Bacteria 2637
311 Ga0466961_0002458 3300044693 Bacteria 11494
312 Ga0466961_0011288 3300044693 Bacteria 5712
313 Ga0466961_0079331 3300044693 Bacteria 2079
314 Ga0466961_0090248 3300044693 Bacteria 1935
315 Ga0466963_0198886 3300044694 Bacteria 1401
316 Ga0466964_0142993 3300044706 Bacteria 1101
317 Ga0453684_0005559 3300044712 Bacteria 24865
318 Ga0453684_0034874 3300044712 Bacteria 6971
319 Ga0466971_0144551 3300044719 Bacteria 1108
320 Ga0466957_0060938 3300044842 Bacteria 2314
321 Ga0466960_0079342 3300044901 Bacteria 1650
322 Ga0466959_0107148 3300045049 Bacteria 1997
323 Ga0451576_0018197 3300045051 Bacteria 7707
324 Ga0451576_0278551 3300045051 Bacteria 1749
325 Ga0451576_0492033 3300045051 Bacteria 1288
326 Ga0466967_0067263 3300045976 Bacteria 3195
327 Ga0495603_0129504 3300046455 Bacteria 1470
328 Ga0495590_0010206 3300046457 Bacteria 3537
329 Ga0495629_0136822 3300046459 Bacteria 1705
330 Ga0495650_0008764 3300046471 Bacteria 5853
331 Ga0495582_0175817 3300046473 Bacteria 1219
332 Ga0495584_0000305 3300046491 Bacteria 34730
333 Ga0495584_0012779 3300046491 Bacteria 4285
334 Ga0495584_0014172 3300046491 Bacteria 4062
335 Ga0495584_0021124 3300046491 Bacteria 3306
336 Ga0495585_0016183 3300046492 Bacteria 4322
337 Ga0495594_0037877 3300046499 Bacteria 2632
338 Ga0495583_0000245 3300046506 Bacteria 89398
339 Ga0495606_0001063 3300046507 Bacteria 39705
340 Ga0495606_0010710 3300046507 Bacteria 7565
341 Ga0495610_0012793 3300046512 Bacteria 5021
342 Ga0495631_0039969 3300046518 Bacteria 2079
343 Ga0495632_0022945 3300046519 Bacteria 3339
344 Ga0495643_0060878 3300046522 Bacteria 2003
345 Ga0495648_0174900 3300046524 Bacteria 1097
346 Ga0495663_0040361 3300046525 Bacteria 1417
347 Ga0495642_0020056 3300046528 Bacteria 2622
348 Ga0495654_0022190 3300046530 Bacteria 3299
349 Ga0495665_0027919 3300046531 Bacteria 3029
350 Ga0495665_0129943 3300046531 Bacteria 1318
351 Ga0495586_0002903 3300046535 Bacteria 9249
352 Ga0495587_0012984 3300046536 Bacteria 5237
353 Ga0495609_0046155 3300046538 Bacteria 1951
354 Ga0495597_0009246 3300046542 Bacteria 4879
355 Ga0495597_0021198 3300046542 Bacteria 3022
356 Ga0495622_0006179 3300046557 Bacteria 5562
357 Ga0495622_0126778 3300046557 Bacteria 1164
358 Ga0495633_0010622 3300046558 Bacteria 5017
359 Ga0495668_0021998 3300046616 Bacteria 3649
360 Ga0495611_0005650 3300046648 Bacteria 5334
361 Ga0495625_0003938 3300046660 Bacteria 14272
362 Ga0495625_0022014 3300046660 Bacteria 4894
363 Ga0495661_0092396 3300046665 Bacteria 1719
364 Ga0495588_0086792 3300046674 Bacteria 1636
365 Ga0495623_0112362 3300046679 Bacteria 1649
366 Ga0495623_0127370 3300046679 Bacteria 1528
367 Ga0495646_0038034 3300046680 Bacteria 2973
368 Ga0495658_0126807 3300046683 Bacteria 1550
369 Ga0495669_0016980 3300046684 Bacteria 3122
370 Ga0495624_0070443 3300046690 Bacteria 2177
371 Ga0495670_0010748 3300046691 Bacteria 4498
372 Ga0495671_0031546 3300046692 Bacteria 2709
373 Ga0495671_0137014 3300046692 Bacteria 1193
374 Ga0495649_0001703 3300046694 Bacteria 16293
375 Ga0495600_0024235 3300046809 Bacteria 3905
376 Ga0495581_0104819 3300047315 Bacteria 1643
377 Ga0495604_0019008 3300047317 Bacteria 5502
378 Ga0495636_0004666 3300047318 Bacteria 5375
379 Ga0495674_0010832 3300047319 Bacteria 8625
380 Ga0495674_0298574 3300047319 Bacteria 1316
381 Ga0495676_0105869 3300047321 Bacteria 2073
382 Ga0495681_0037030 3300047470 Bacteria 2407
383 Ga0495686_0066112 3300047472 Bacteria 2235
384 Ga0495593_0140447 3300047673 Bacteria 1223
385 Ga0495593_0144659 3300047673 Bacteria 1203
386 Ga0495626_0004416 3300048091 Bacteria 8647
387 Ga0495626_0008978 3300048091 Bacteria 5423
388 Ga0496105_0150937 3300048908 Bacteria 1910
389 Ga0496115_0015563 3300048918 Bacteria 5772
390 Ga0496115_0043202 3300048918 Bacteria 3594
391 Ga0496115_0045583 3300048918 Bacteria 3501
392 Ga0496121_0026536 3300048924 Bacteria 5454
393 Ga0496122_0036349 3300048925 Bacteria 3984
394 Ga0496123_0038943 3300048926 Bacteria 3332
395 Ga0496123_0107472 3300048926 Bacteria 1605
396 Ga0496124_0000317 3300048927 Bacteria 89188
397 Ga0496124_0089694 3300048927 Bacteria 2510
398 Ga0496125_0000812 3300048928 Bacteria 50762
399 Ga0496125_0004097 3300048928 Bacteria 17057
400 Ga0496125_0007837 3300048928 Bacteria 11286
401 Ga0496125_0022403 3300048928 Bacteria 5867
402 Ga0496125_0079090 3300048928 Bacteria 2524
403 Ga0496126_0030775 3300048929 Bacteria 5081
404 Ga0496126_0044430 3300048929 Bacteria 4092
405 Ga0501034_0197322 3300049571 Bacteria 1972
406 Ga0501043_0022740 3300049579 Bacteria 4917
407 Ga0501046_0044252 3300049580 Bacteria 3541
408 Ga0501198_000005 3300049649 Bacteria 156657
409 Ga0501222_000003 3300049662 Bacteria 157406
410 Ga0501249_004687 3300049679 Bacteria 2782
411 Ga0501262_000342 3300049759 Bacteria 5654
412 Ga0501266_000446 3300049763 Bacteria 5442
413 Ga0501044_0074406 3300049823 Bacteria 3451
414 nmdc:mga03683_39112_c1 3300050489 Bacteria 1940
415 nmdc:mga00v17_41021_c1 3300050491 Bacteria 2778
416 nmdc:mga0k408_103242_c1 3300050493 Bacteria 1682
417 nmdc:mga0k408_182605_c1 3300050493 Bacteria 1251
418 nmdc:mga0k408_294133_c1 3300050493 Bacteria 969
419 nmdc:mga0k408_3614_c1 3300050493 Bacteria 8180
420 nmdc:mga0k408_42211_c1 3300050493 Bacteria 2627
421 nmdc:mga0k408_6608_c1 3300050493 Bacteria 6180
422 nmdc:mga06z11_30996_c1 3300050494 Bacteria 2593
423 nmdc:mga07m45_578_c1 3300050496 Bacteria 7656
424 nmdc:mga07m45_7805_c1 3300050496 Bacteria 5476
425 nmdc:mga07m45_8912_c1 3300050496 Bacteria 5181
426 nmdc:mga07m45_9857_c1 3300050496 Bacteria 4968
427 nmdc:mga05p37_87741_c1 3300050507 Bacteria 3834
428 Ga0500635_0000265 3300053080 Bacteria 20897
429 Ga0500635_0065489 3300053080 Bacteria 1278
430 Ga0500644_0013437 3300053088 Bacteria 2287
431 Ga0500644_0065044 3300053088 Bacteria 1297
432 Ga0500651_0018498 3300053093 Bacteria 4313
433 Ga0500651_0033728 3300053093 Bacteria 3227
434 Ga0500562_010037 3300053108 Bacteria 2396
435 Ga0500652_024600 3300053131 Bacteria 2300
436 Ga0500559_0000141 3300053136 Bacteria 56026
437 Ga0500559_0060991 3300053136 Bacteria 1681
438 Ga0500559_0137323 3300053136 Bacteria 1144
439 Ga0500622_0042102 3300053156 Bacteria 2374
440 Ga0500636_0023334 3300053177 Bacteria 3659
441 Ga0500587_000298 3300053739 Bacteria 5554
442 Ga0590071_011447 3300059421 Bacteria 2075
443 Ga0590075_017231 3300059424 Bacteria 1780
444 Ga0590077_026602 3300059426 Bacteria 1251
445 Ga0466962_0012970 3300061719 Bacteria 4009
446 2644074493 2643221611 Bacteria 6820941
447 2548500106 2547132374 Bacteria 5530232
448 2587755589 2585428062 Bacteria 6842168
449 2643864854 2643221570 Bacteria 5103772
450 2643991216 2643221596 Bacteria 5006805
451 2644059886 2643221609 Bacteria 6756331
452 2644221390 2643221639 Bacteria 6649903
453 2644257853 2643221646 Bacteria 6433402
454 2644293910 2643221652 Bacteria 5140275
455 2644337598 2643221660 Bacteria 4208257
456 2644644574 2643221717 Bacteria 5676132
457 2722882378 2721755523 Bacteria 6430384
458 2739241411 2738543012 Bacteria 7115078
459 2739249872 2738543013 Bacteria 5618633
460 2816473575 2816332133 Bacteria 7249298
461 2839142155 2839138175 Bacteria 6549354
462 2842682601 2842677519 Bacteria 5615038
463 2842719019 2842718218 Bacteria 4560148
464 2904479998 2904479285 Bacteria 5073931
465 2919464020 2919462493 Bacteria 5817112
466 2932425095 2932422444 Bacteria 4678430
467 2974324355 2974320154 Bacteria 4571377
468 2990711701 2990710928 Bacteria 5002431
469 JGI25156J39149_1000107
470 JGI25156J39149_1000421
471 JGI25154J39366_1000529
472 JGI25157J39369_1000020
473 JGI25153J46596_10005247
474 rootH1_10014123
475 rootH1_10001754
476 Ga0006562J51391_1061276
477 Ga0055539_1000155
478 Ga0055533_1000028
479 Ga0055525_1000021
480 Ga0055525_1000795
481 Ga0055535_1000167
482 Ga0055529_1000151
483 Ga0055534_1002844
484 Ga0055531_10000051
485 Ga0065704_10123419
486 Ga0065712_10127186
487 Ga0070658_10012989
488 Ga0070658_10071311
489 Ga0070676_10035705
490 Ga0070676_10051762
491 Ga0070683_100122677
492 Ga0070690_100105241
493 Ga0070670_100049613
494 Ga0070670_100049753
495 Ga0070670_100060956
496 Ga0070677_10005435
497 Ga0068869_100013561
498 Ga0068869_100127021
499 Ga0068868_100005383
500 Ga0068868_100018577
501 Ga0068868_100065930
502 Ga0070668_100279471
503 Ga0070669_100006105
504 Ga0070675_100001535
505 Ga0070675_100005184
506 Ga0070671_100028948
507 Ga0070671_100049582
508 Ga0070671_100130598
509 Ga0070674_100009036
510 Ga0070674_100014666
511 Ga0070674_100198646
512 Ga0070673_100013924
513 Ga0070673_100031808
514 Ga0070667_100175874
515 Ga0070678_100100359
516 Ga0070678_100128147
517 Ga0070662_100055941
518 Ga0070662_100273023
519 Ga0068867_100002841
520 Ga0068867_100002971
521 Ga0068867_100035680
522 Ga0070672_100002062
523 Ga0070672_100100210
524 Ga0070665_100008010
525 Ga0068855_100000405
526 Ga0068855_100095783
527 Ga0068855_100097233
528 Ga0070664_100169409
529 Ga0068857_100079157
530 Ga0068857_100176495
531 Ga0068854_100175533
532 Ga0068856_100107056
533 Ga0068870_10031217
534 Ga0068870_10034692
535 Ga0068863_100482481
536 Ga0068862_100312604
537 Ga0068862_100336055
538 Ga0075365_10173261
539 Ga0075363_100053323
540 Ga0075362_10132251
541 Ga0075362_10152263
542 Ga0075367_10063374
543 Ga0075367_10066519
544 Ga0075366_10001775
545 Ga0075366_10010236
546 Ga0075366_10011230
547 Ga0075366_10012381
548 Ga0075366_10014071
549 Ga0075366_10042380
550 Ga0075370_10005894
551 Ga0075370_10012283
552 Ga0075370_10022729
553 Ga0075370_10072478
554 Ga0068871_100007609
555 Ga0068865_100039848
556 Ga0079104_1000002
557 Ga0105250_10001691
558 Ga0105240_10003241
559 Ga0105245_10030579
560 Ga0114129_10104062
561 Ga0105243_10004780
562 Ga0105243_10160714
563 Ga0105241_10201009
564 Ga0105242_10000656
565 Ga0105242_10135941
566 Ga0105242_10600316
567 Ga0105248_10443335
568 Ga0105237_10036055
569 Ga0105237_10103686
570 Ga0105238_10095358
571 Ga0105239_10012269
572 Ga0105246_10305681
573 Ga0157369_10039806
574 Ga0163162_10108773
575 Ga0157372_10287117
576 Ga0157375_10220662
577 Ga0157379_10016805
578 Ga0163161_10053518
579 Ga0213872_10000011
580 Ga0213872_10000172
581 Ga0213872_10000359
582 Ga0209674_100007
583 Ga0209674_101662
584 Ga0209563_100033
585 Ga0207427_100912
586 Ga0209258_100146
587 Ga0209258_100499
588 Ga0209646_1000062
589 Ga0209026_1000026
590 Ga0209677_100082
591 Ga0209677_100116
592 Ga0209148_1015030
593 Ga0209759_1000050
594 Ga0209759_1000855
595 Ga0209759_1012293
596 Ga0209759_1020127
597 Ga0209455_1000059
598 Ga0209673_1033474
599 Ga0209130_1001702
600 Ga0209675_1002145
601 Ga0209676_1034220
602 Ga0209025_1028509
603 Ga0209758_1000045
604 Ga0209050_1003330
605 Ga0209050_1027799
606 Ga0209051_1000320
607 Ga0209051_1003268
608 Ga0209051_1004347
609 Ga0209051_1004802
610 Ga0209257_1000017
611 Ga0209257_1000161
612 Ga0207682_10001523
613 Ga0207645_10008686
614 Ga0207645_10021380
615 Ga0207645_10050483
616 Ga0207643_10037250
617 Ga0207705_10012186
618 Ga0207705_10084335
619 Ga0207654_10020266
620 Ga0207695_10075501
621 Ga0207695_10242082
622 Ga0207652_10171367
623 Ga0207681_10071740
624 Ga0207694_10065552
625 Ga0207650_10002460
626 Ga0207650_10069254
627 Ga0207659_10001118
628 Ga0207659_10006295
629 Ga0207687_10246298
630 Ga0207687_10506932
631 Ga0207644_10034911
632 Ga0207706_10017618
633 Ga0207706_10323890
634 Ga0207686_10024745
635 Ga0207709_10000015
636 Ga0207709_10151732
637 Ga0207669_10078565
638 Ga0207704_10039057
639 Ga0207691_10006082
640 Ga0207691_10007915
641 Ga0207691_10054596
642 Ga0207689_10014862
643 Ga0207689_10041667
644 Ga0207679_10013263
645 Ga0207679_10145579
646 Ga0207667_10002900
647 Ga0207667_10025190
648 Ga0207651_10006687
649 Ga0207651_10008923
650 Ga0207668_10204384
651 Ga0207640_10015753
652 Ga0207677_10002779
653 Ga0207677_10020394
654 Ga0207677_10085330
655 Ga0207677_10086774
656 Ga0207639_10139682
657 Ga0207639_10163917
658 Ga0207702_10000225
659 Ga0207702_10260757
660 Ga0207641_10079866
661 Ga0207648_10002848
662 Ga0207648_10010781
663 Ga0207648_10026360
664 Ga0207674_10006381
665 Ga0207674_10008218
666 Ga0207675_100239110
667 Ga0207683_10006663
668 Ga0207683_10098567
669 Ga0207683_10163110
670 Ga0207698_10391690
671 Ga0209281_1000007
672 Ga0209970_1001451
673 Ga0209974_10028570
674 Ga0268266_10048458
675 Ga0268265_10343402
676 Ga0265336_10000016
677 Ga0307517_10001871
678 Ga0307515_10000020
679 Ga0307515_10000051
680 Ga0307515_10000991
681 Ga0307515_10001283
682 Ga0307515_10007242
683 Ga0307515_10008378
684 Ga0307515_10206057
685 Ga0307515_10246446
686 Ga0265324_10000951
687 Ga0307512_10032669
688 Ga0314311_1144639
689 Ga0316179_1070123
690 Ga0316183_1037305
691 Ga0265330_10000033
692 Ga0265332_10000001
693 Ga0265332_10000009
694 Ga0265332_10086402
695 Ga0265328_10005588
696 Ga0265320_10070162
697 Ga0265340_10015080
698 Ga0265331_10002981
699 Ga0265327_10001098
700 Ga0265316_10000115
701 Ga0307513_10001123
702 Ga0307513_10078229
703 Ga0307509_10014210
704 Ga0307509_10095501
705 Ga0307509_10119740
706 Ga0307509_10124868
707 Ga0307408_100000079
708 Ga0307408_100072360
709 Ga0307408_100191962
710 Ga0307508_10000007
711 Ga0307508_10000227
712 Ga0307508_10000945
713 Ga0307508_10174098
714 Ga0307514_10055368
715 Ga0307514_10057028
716 Ga0265314_10000022
717 Ga0265314_10012971
718 Ga0307516_10004946
719 Ga0307516_10005605
720 Ga0307405_10056697
721 Ga0307405_10072245
722 Ga0307413_10081974
723 Ga0307410_10037721
724 Ga0307410_10054826
725 Ga0307406_10002089
726 Ga0307406_10028793
727 Ga0307411_10023852
728 Ga0307411_10164140
729 Ga0307507_10154160
730 Ga0307510_10008187
731 Ga0307510_10020701
732 Ga0373931_0105899
733 Ga0395899_0016898
734 Ga0395900_0015251
735 Ga0395900_0058546
736 Ga0395900_0126397
737 Ga0395900_0147136
738 Ga0395898_0000868
739 Ga0395898_0025754
740 Ga0395898_0135515
741 Ga0395905_0000431
742 Ga0395905_0002875
743 Ga0395905_0005832
744 Ga0395905_0016129
745 Ga0395905_0022443
746 Ga0395905_0045834
747 Ga0395905_0067410
748 Ga0395905_0200214
749 Ga0395905_0382765
750 Ga0395901_0005416
751 Ga0395901_0167448
752 Ga0395901_0206903
753 Ga0436361_0167979
754 Ga0436361_0296121
755 Ga0436361_0311557
756 Ga0436361_0383238
757 Ga0436361_0657686
758 Ga0436361_0932343
759 Ga0451800_1171317
760 Ga0451855_0341822
761 Ga0439445_0005530
762 Ga0439449_0023209
763 Ga0439462_0013555
764 Ga0450911_000167
765 Ga0450911_008451
766 Ga0450898_011237
767 Ga0466969_0003346
768 Ga0466969_0032542
769 Ga0466969_0081365
770 Ga0466969_0117311
771 Ga0466972_0000570
772 Ga0466972_0006707
773 Ga0453683_0007448
774 Ga0466966_0009505
775 Ga0466966_0015011
776 Ga0466966_0023128
777 Ga0466966_0050807
778 Ga0466961_0002458
779 Ga0466961_0011288
780 Ga0466961_0079331
781 Ga0466961_0090248
782 Ga0466963_0198886
783 Ga0466964_0142993
784 Ga0453684_0005559
785 Ga0453684_0034874
786 Ga0466971_0144551
787 Ga0466957_0060938
788 Ga0466960_0079342
789 Ga0466959_0107148
790 Ga0451576_0018197
791 Ga0451576_0278551
792 Ga0451576_0492033
793 Ga0466967_0067263
794 Ga0495603_0129504
795 Ga0495590_0010206
796 Ga0495629_0136822
797 Ga0495650_0008764
798 Ga0495582_0175817
799 Ga0495584_0000305
800 Ga0495584_0012779
801 Ga0495584_0014172
802 Ga0495584_0021124
803 Ga0495585_0016183
804 Ga0495594_0037877
805 Ga0495583_0000245
806 Ga0495606_0001063
807 Ga0495606_0010710
808 Ga0495610_0012793
809 Ga0495631_0039969
810 Ga0495632_0022945
811 Ga0495643_0060878
812 Ga0495648_0174900
813 Ga0495663_0040361
814 Ga0495642_0020056
815 Ga0495654_0022190
816 Ga0495665_0027919
817 Ga0495665_0129943
818 Ga0495586_0002903
819 Ga0495587_0012984
820 Ga0495609_0046155
821 Ga0495597_0009246
822 Ga0495597_0021198
823 Ga0495622_0006179
824 Ga0495622_0126778
825 Ga0495633_0010622
826 Ga0495668_0021998
827 Ga0495611_0005650
828 Ga0495625_0003938
829 Ga0495625_0022014
830 Ga0495661_0092396
831 Ga0495588_0086792
832 Ga0495623_0112362
833 Ga0495623_0127370
834 Ga0495646_0038034
835 Ga0495658_0126807
836 Ga0495669_0016980
837 Ga0495624_0070443
838 Ga0495670_0010748
839 Ga0495671_0031546
840 Ga0495671_0137014
841 Ga0495649_0001703
842 Ga0495600_0024235
843 Ga0495581_0104819
844 Ga0495604_0019008
845 Ga0495636_0004666
846 Ga0495674_0010832
847 Ga0495674_0298574
848 Ga0495676_0105869
849 Ga0495681_0037030
850 Ga0495686_0066112
851 Ga0495593_0140447
852 Ga0495593_0144659
853 Ga0495626_0004416
854 Ga0495626_0008978
855 Ga0496105_0150937
856 Ga0496115_0015563
857 Ga0496115_0043202
858 Ga0496115_0045583
859 Ga0496121_0026536
860 Ga0496122_0036349
861 Ga0496123_0038943
862 Ga0496123_0107472
863 Ga0496124_0000317
864 Ga0496124_0089694
865 Ga0496125_0000812
866 Ga0496125_0004097
867 Ga0496125_0007837
868 Ga0496125_0022403
869 Ga0496125_0079090
870 Ga0496126_0030775
871 Ga0496126_0044430
872 Ga0501034_0197322
873 Ga0501043_0022740
874 Ga0501046_0044252
875 Ga0501198_000005
876 Ga0501222_000003
877 Ga0501249_004687
878 Ga0501262_000342
879 Ga0501266_000446
880 Ga0501044_0074406
881 nmdc:mga03683_39112_c1
882 nmdc:mga00v17_41021_c1
883 nmdc:mga0k408_103242_c1
884 nmdc:mga0k408_182605_c1
885 nmdc:mga0k408_294133_c1
886 nmdc:mga0k408_3614_c1
887 nmdc:mga0k408_42211_c1
888 nmdc:mga0k408_6608_c1
889 nmdc:mga06z11_30996_c1
890 nmdc:mga07m45_578_c1
891 nmdc:mga07m45_7805_c1
892 nmdc:mga07m45_8912_c1
893 nmdc:mga07m45_9857_c1
894 nmdc:mga05p37_87741_c1
895 Ga0500635_0000265
896 Ga0500635_0065489
897 Ga0500644_0013437
898 Ga0500644_0065044
899 Ga0500651_0018498
900 Ga0500651_0033728
901 Ga0500562_010037
902 Ga0500652_024600
903 Ga0500559_0000141
904 Ga0500559_0060991
905 Ga0500559_0137323
906 Ga0500622_0042102
907 Ga0500636_0023334
908 Ga0500587_000298
909 Ga0590071_011447
910 Ga0590075_017231
911 Ga0590077_026602
912 Ga0466962_0012970
913 2644074493
914 2548500106
915 2587755589
916 2643864854
917 2643991216
918 2644059886
919 2644221390
920 2644257853
921 2644293910
922 2644337598
923 2644644574
924 2722882378
925 2739241411
926 2739249872
927 2816473575
928 2839142155
929 2842682601
930 2842719019
931 2904479998
932 2919464020
933 2932425095
934 2974324355
935 2990711701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01430

HSP33

Hsp33 protein

35

340

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.8903 2 255
3m7m-assembly1.cif.gz_X crystal structure of monomeric hsp33 0.8685 2 255
1vq0-assembly1.cif.gz_B crystal structure of 33 kda chaperonin (heat shock protein 33 homolog) (hsp33) (tm1394) from thermotoga maritima at 2.20 a resolution 0.8176 1 305
1vzy-assembly1.cif.gz_A crystal structure of the bacillus subtilis hsp33 0.8136 1 305
1vzy-assembly1.cif.gz_A crystal structure of the bacillus subtilis hsp33 0.798 1 305
ID Description Score Start End Superfamily
af_P0A6Y5_226_285_3.90.1280.10 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.9664 252 305 3.90.1280.10
1vzyA02 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.9206 255 305 3.90.1280.10
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.8961 1 186 3.55.30.10
1vzyB02 Alpha Beta;Alpha-Beta Complex;CBS domain Like;HSP33 redox switch-like 0.8916 255 304 3.90.1280.10
1i7fA01 Alpha Beta;3-Layer(bab) Sandwich;Hsp33 domain;Hsp33 domain 0.891 1 186 3.55.30.10
ID Description Score Start End GO Terms
AF-A0A520G6E7-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9799 1 161 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A2M8BKY5-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9797 1 123 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A5C7A8U2-F1-model_v4 Hsp33 family molecular chaperone HslO 0.9767 4 142 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A520G6E7-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.974 1 161 GO:0005737
GO:0042026
GO:0044183
GO:0051082
AF-A0A2M8BKY5-F1-model_v4 Redox-regulated molecular chaperone Hsp33 0.9493 1 123 GO:0005737
GO:0042026
GO:0044183
GO:0051082

Map