F449969

General Info

Members Datasets Scaffolds Average Seq Length
468 349 936 203

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10137594|Ga0070677_101375942
Length 221
Sequence MSTIISDVIDHLAGIQPGSSLDRLRDQRPQARENAQKSYLALFEPEFPGHVTAIERYAVATFVAGLHRQPNVTEFYAASLERLGHPRLTDAIRGEIARGSVEGPYGRYPQGPLTVEDREGSVYQVSTDNRERLGSRLAAALEHAHLLVFHPRDASPAALQRLLDAGWSTTDIVTLSQLVAFLSFQIRVVAGLRVLVGASSRASADADQTQIFTGVLASGAV

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
285 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
286 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
292 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
296 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
300 2508501050 Microvirga lupini Lut6 Isolate Nodule
301 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
302 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
303 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
304 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
305 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
306 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
307 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
308 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
309 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
310 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
311 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
312 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
313 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
314 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
315 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
316 2643221629 Devosia sp. Root105 Isolate Unclassified
317 2643221649 Leifsonia sp. Root4 Isolate Unclassified
318 2643221662 Devosia sp. Root413D1 Isolate Unclassified
319 2738541277 Variovorax sp. GV051 Isolate Unclassified
320 2738541293 Rhizobium sp. GV031 Isolate Unclassified
321 2738541307 Variovorax sp. GV008 Isolate Unclassified
322 2738543013 Variovorax sp. BT01 Isolate Unclassified
323 2738543019 Variovorax sp. GV040 Isolate Unclassified
324 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
325 2773857925 Microvirga vignae BR3299 Isolate Unclassified
326 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
327 2818991446 Variovorax sp. 1180 Isolate Unclassified
328 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
329 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
330 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
331 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
332 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
333 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
334 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
335 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
336 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
337 2899924645 Variovorax sp. 369 Isolate Unclassified
338 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
339 2928037797 Variovorax sp. 1126 Isolate Unclassified
340 2928044640 Variovorax sp. 1128 Isolate Unclassified
341 2928051484 Variovorax sp. 1133 Isolate Unclassified
342 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
343 2928070936 Variovorax gossypii 1167 Isolate Unclassified
344 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
345 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
346 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
347 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
348 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
349 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 0
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.57
Nodule 3.42
Rhizoplane 2.14
Rhizosphere 52.99
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10137594 3300005333 Bacteria 1122
2 JGI24740J21852_10037958 3300001979 Bacteria 1482
3 JGI25162J39368_1000440 3300002737 Bacteria 33441
4 JGI25158J39367_1014613 3300002739 Bacteria 1012
5 JGI25152J39213_1000351 3300002773 Bacteria 28906
6 JGI25152J39213_1013240 3300002773 Bacteria 1728
7 JGI25150J39212_1000026 3300002774 Bacteria 107804
8 JGI25150J39212_1000292 3300002774 Bacteria 25686
9 JGI25159J45721_1000047 3300002987 Bacteria 59191
10 JGI25151J46595_10000053 3300003187 Bacteria 156841
11 JGI25151J46595_10000674 3300003187 Bacteria 28906
12 JGI25165J46597_1000494 3300003214 Bacteria 38065
13 JGI25153J46596_10000402 3300003215 Bacteria 28906
14 JGI25153J46596_10003066 3300003215 Bacteria 9437
15 rootH2_10099260 3300003320 Bacteria 2412
16 rootH2_10199587 3300003320 Bacteria 1020
17 rootL2_10027034 3300003322 Bacteria 1703
18 rootL2_10058394 3300003322 Bacteria 3152
19 rootH1_10285170 3300003323 Bacteria 2310
20 JGI25160J50197_1000125 3300003354 Bacteria 69558
21 JGI25161J50226_1000147 3300003374 Bacteria 48979
22 Ga0055535_1000696 3300003761 Bacteria 25939
23 Ga0055542_1000027 3300003762 Bacteria 254819
24 Ga0055526_1000153 3300003771 Bacteria 61300
25 Ga0055537_1000082 3300003773 Bacteria 69558
26 Ga0055524_1000548 3300003775 Bacteria 28368
27 Ga0055536_1002460 3300003781 Bacteria 10399
28 Ga0055536_1037850 3300003781 Bacteria 1176
29 Ga0055534_1000133 3300003784 Bacteria 55735
30 Ga0055534_1000301 3300003784 Bacteria 33108
31 Ga0055528_1000558 3300003790 Bacteria 28344
32 Ga0055528_1063204 3300003790 Bacteria 692
33 Ga0055540_1001156 3300003792 Bacteria 16424
34 Ga0055531_10014804 3300003794 Bacteria 3488
35 Ga0055543_1000182 3300004625 Bacteria 51755
36 Ga0065165_1000516 3300005262 Bacteria 59296
37 Ga0070658_10091699 3300005327 Bacteria 2504
38 Ga0070689_100225556 3300005340 Bacteria 1539
39 Ga0070668_100366893 3300005347 Bacteria 1222
40 Ga0070709_10044414 3300005434 Plasmid 2751
41 Ga0070709_10100532 3300005434 Bacteria 1926
42 Ga0070714_100022721 3300005435 Bacteria 5145
43 Ga0070714_100177680 3300005435 Bacteria 1935
44 Ga0070714_100186467 3300005435 Bacteria 1890
45 Ga0070714_100366735 3300005435 Bacteria 1355
46 Ga0070713_100067713 3300005436 Plasmid 3007
47 Ga0070710_10013396 3300005437 Bacteria 4107
48 Ga0070710_10144316 3300005437 Bacteria 1462
49 Ga0070711_100064075 3300005439 Bacteria 2567
50 Ga0070711_100177671 3300005439 Bacteria 1628
51 Ga0070681_10225650 3300005458 Bacteria 1788
52 Ga0070706_100012800 3300005467 Bacteria 7764
53 Ga0070679_100120192 3300005530 Bacteria 2612
54 Ga0068853_100019486 3300005539 Bacteria 5625
55 Ga0070672_100026919 3300005543 Bacteria 4286
56 Ga0070665_100729701 3300005548 Bacteria 1004
57 Ga0068856_100197392 3300005614 Bacteria 2026
58 Ga0068856_100233159 3300005614 Bacteria 1856
59 Ga0068856_100302645 3300005614 Bacteria 1617
60 Ga0068859_100266755 3300005617 Bacteria 1804
61 Ga0068851_10019255 3300005834 Bacteria 3297
62 Ga0068863_100340599 3300005841 Bacteria 1459
63 Ga0068858_100785941 3300005842 Bacteria 928
64 Ga0081455_10408065 3300005937 Bacteria 941
65 Ga0070717_10012817 3300006028 Bacteria 6401
66 Ga0070717_10209618 3300006028 Bacteria 1710
67 Ga0075368_10100278 3300006042 Bacteria 1189
68 Ga0075363_100179480 3300006048 Bacteria 1204
69 Ga0075364_10142626 3300006051 Bacteria 1612
70 Ga0075364_10304563 3300006051 Bacteria 1085
71 Ga0070715_10074065 3300006163 Bacteria 1529
72 Ga0070715_10079850 3300006163 Bacteria 1482
73 Ga0070712_100016011 3300006175 Bacteria 4836
74 Ga0075362_10108643 3300006177 Bacteria 1304
75 Ga0075369_10250715 3300006186 Bacteria 822
76 Ga0075366_10000792 3300006195 Bacteria 15136
77 Ga0075428_100151670 3300006844 Bacteria 2518
78 Ga0075430_100103215 3300006846 Bacteria 2380
79 Ga0075431_100196111 3300006847 Bacteria 2067
80 Ga0075429_100009302 3300006880 Bacteria 8529
81 Ga0075429_100237670 3300006880 Bacteria 1596
82 Ga0075436_100856397 3300006914 Bacteria 679
83 Ga0097620_100266769 3300006931 Bacteria 1804
84 Ga0105244_10090231 3300009036 Bacteria 1508
85 Ga0105240_10004352 3300009093 Bacteria 21620
86 Ga0105240_10109201 3300009093 Bacteria 3351
87 Ga0111539_11030389 3300009094 Bacteria 957
88 Ga0114129_10424940 3300009147 Bacteria 1747
89 Ga0105243_10001557 3300009148 Bacteria 20059
90 Ga0105243_10684761 3300009148 Bacteria 997
91 Ga0105033_109710 3300009986 Bacteria 844
92 Ga0105239_10318703 3300010375 Bacteria 1753
93 Ga0105239_10541977 3300010375 Bacteria 1325
94 Ga0105246_10266341 3300011119 Bacteria 1367
95 Ga0105246_10440126 3300011119 Bacteria 1093
96 Ga0157371_10103963 3300013102 Bacteria 2015
97 Ga0157370_10005682 3300013104 Bacteria 13941
98 Ga0157370_10384862 3300013104 Bacteria 1292
99 Ga0157369_10548529 3300013105 Bacteria 1195
100 Ga0157374_10377291 3300013296 Bacteria 1412
101 Ga0157378_10914522 3300013297 Bacteria 909
102 Ga0157375_10266274 3300013308 Bacteria 1875
103 Ga0163163_10138347 3300014325 Bacteria 2477
104 Ga0157380_10034141 3300014326 Bacteria 3922
105 Ga0157380_10353624 3300014326 Bacteria 1376
106 Ga0182008_10085841 3300014497 Bacteria 1550
107 Ga0157379_10322138 3300014968 Bacteria 1411
108 Ga0163161_10028844 3300017792 Bacteria 3943
109 Ga0163161_10301653 3300017792 Bacteria 1262
110 Ga0213874_10022673 3300021377 Bacteria 1745
111 Ga0213874_10073820 3300021377 Bacteria 1093
112 Ga0213875_10000421 3300021388 Bacteria 37100
113 Ga0209436_103609 3300025208 Bacteria 4040
114 Ga0209672_101497 3300025228 Bacteria 8163
115 Ga0209147_102265 3300025229 Bacteria 5062
116 Ga0209437_100064 3300025233 Bacteria 334360
117 Ga0209258_100048 3300025242 Bacteria 365881
118 Ga0207425_1000104 3300025245 Bacteria 79793
119 Ga0207425_1000187 3300025245 Bacteria 50439
120 Ga0209148_1000040 3300025254 Bacteria 473531
121 Ga0209129_1000007 3300025258 Bacteria 771325
122 Ga0209129_1000213 3300025258 Bacteria 67041
123 Ga0209233_1000081 3300025261 Bacteria 336832
124 Ga0209565_1000105 3300025263 Bacteria 122895
125 Ga0209673_1001154 3300025273 Bacteria 28838
126 Ga0209673_1017575 3300025273 Bacteria 2633
127 Ga0209130_1000070 3300025284 Bacteria 179057
128 Ga0209130_1000160 3300025284 Bacteria 100965
129 Ga0209675_1000161 3300025291 Bacteria 86003
130 Ga0209676_1000785 3300025292 Bacteria 42175
131 Ga0209676_1002015 3300025292 Bacteria 15993
132 Ga0209025_1000111 3300025294 Bacteria 218982
133 Ga0209025_1000181 3300025294 Bacteria 156894
134 Ga0209025_1072954 3300025294 Bacteria 1207
135 Ga0209564_1000153 3300025295 Bacteria 166910
136 Ga0209758_1000025 3300025297 Bacteria 586687
137 Ga0209758_1000156 3300025297 Bacteria 156894
138 Ga0209758_1030633 3300025297 Bacteria 2225
139 Ga0209256_1000971 3300025299 Bacteria 34474
140 Ga0207426_1000001 3300025302 Bacteria 1341301
141 Ga0207426_1000098 3300025302 Bacteria 264264
142 Ga0209051_1000398 3300025303 Bacteria 60408
143 Ga0209051_1002681 3300025303 Bacteria 12435
144 Ga0209051_1038431 3300025303 Bacteria 1742
145 Ga0209257_1000905 3300025304 Bacteria 41519
146 Ga0209257_1009161 3300025304 Bacteria 5388
147 Ga0207656_10108512 3300025321 Bacteria 1280
148 Ga0207692_10214336 3300025898 Bacteria 1138
149 Ga0207688_10147290 3300025901 Bacteria 1389
150 Ga0207680_10076178 3300025903 Bacteria 2094
151 Ga0207699_10021837 3300025906 Bacteria 3458
152 Ga0207705_10086662 3300025909 Bacteria 2289
153 Ga0207693_10013748 3300025915 Bacteria 6520
154 Ga0207693_10235775 3300025915 Bacteria 1437
155 Ga0207663_10057429 3300025916 Bacteria 2452
156 Ga0207663_10859612 3300025916 Bacteria 724
157 Ga0207652_10077226 3300025921 Bacteria 2906
158 Ga0207700_10052371 3300025928 Bacteria 3051
159 Ga0207700_10234830 3300025928 Bacteria 1561
160 Ga0207664_10013278 3300025929 Bacteria 5906
161 Ga0207664_10363120 3300025929 Bacteria 1283
162 Ga0207664_10370463 3300025929 Bacteria 1270
163 Ga0207706_10105761 3300025933 Bacteria 2476
164 Ga0207706_10210768 3300025933 Bacteria 1703
165 Ga0207709_10000295 3300025935 Bacteria 55888
166 Ga0207665_10022925 3300025939 Bacteria 4110
167 Ga0207691_10034628 3300025940 Bacteria 4695
168 Ga0207691_10464015 3300025940 Bacteria 1077
169 Ga0207668_10451389 3300025972 Bacteria 1097
170 Ga0207677_10299600 3300026023 Bacteria 1327
171 Ga0207703_10641873 3300026035 Bacteria 1007
172 Ga0207702_10316317 3300026078 Bacteria 1486
173 Ga0207674_10443275 3300026116 Bacteria 1255
174 Ga0207683_10865334 3300026121 Bacteria 839
175 Ga0207428_10221766 3300027907 Bacteria 1417
176 Ga0207428_10356718 3300027907 Bacteria 1075
177 Ga0265334_10007467 3300028573 Bacteria 4688
178 Ga0307515_10000734 3300028794 Bacteria 75701
179 Ga0265330_10023925 3300031235 Bacteria 2771
180 Ga0265340_10006640 3300031247 Bacteria 6346
181 Ga0265340_10058642 3300031247 Bacteria 1848
182 Ga0265339_10080465 3300031249 Bacteria 1723
183 Ga0307508_10259885 3300031616 Bacteria 1331
184 Ga0307405_10000692 3300031731 Bacteria 13042
185 Ga0307405_10031248 3300031731 Bacteria 3132
186 Ga0307405_10242599 3300031731 Bacteria 1336
187 Ga0307413_10303964 3300031824 Bacteria 1211
188 Ga0307410_10029869 3300031852 Bacteria 3476
189 Ga0307407_10054286 3300031903 Bacteria 2310
190 Ga0307412_10001472 3300031911 Bacteria 13075
191 Ga0307416_100363509 3300032002 Bacteria 1470
192 Ga0307411_10061373 3300032005 Bacteria 2502
193 Ga0307411_10120180 3300032005 Bacteria 1899
194 Ga0307415_100188605 3300032126 Bacteria 1625
195 Ga0307510_10056863 3300033180 Bacteria 4067
196 Ga0373934_0054742 3300035086 Bacteria 1584
197 Ga0373923_0000665 3300035111 Bacteria 8726
198 Ga0373936_0008498 3300035113 Bacteria 3868
199 Ga0373939_0019884 3300035114 Bacteria 1817
200 Ga0373945_0030583 3300035116 Bacteria 1899
201 Ga0373953_0155826 3300035117 Bacteria 980
202 Ga0373954_0031538 3300035118 Unclassified 2447
203 Ga0373956_0028794 3300035119 Bacteria 2418
204 Ga0373943_0110343 3300035170 Bacteria 1450
205 Ga0373946_0008138 3300035171 Bacteria 3849
206 Ga0373924_0002958 3300035410 Bacteria 5772
207 Ga0373931_0029945 3300035691 Bacteria 2799
208 Ga0373935_0129135 3300035692 Bacteria 1696
209 Ga0373927_0031293 3300035695 Bacteria 3469
210 Ga0373927_0425958 3300035695 Bacteria 876
211 Ga0373933_0024223 3300035724 Bacteria 3474
212 Ga0373933_0454037 3300035724 Unclassified 838
213 Ga0373947_0082161 3300035725 Bacteria 1996
214 Ga0373937_0013781 3300036401 Bacteria 7124
215 Ga0395900_0162024 3300037418 Bacteria 2281
216 Ga0436364_0189042 3300037853 Bacteria 18054
217 Ga0436364_0907328 3300037853 Bacteria 907
218 Ga0436364_1077066 3300037853 Bacteria 6497
219 Ga0395901_0000429 3300038443 Bacteria 49524
220 Ga0436365_0386367 3300039437 Bacteria 1718
221 Ga0436365_1270831 3300039437 Bacteria 2377
222 Ga0436365_1361371 3300039437 Bacteria 4277
223 Ga0436365_1484954 3300039437 Bacteria 2569
224 Ga0436361_0763867 3300039447 Bacteria 2811
225 Ga0436363_0053010 3300039450 Unclassified 704
226 Ga0436363_0110353 3300039450 Bacteria 3489
227 Ga0439461_0059598 3300041410 Bacteria 864
228 Ga0450909_015400 3300042185 Bacteria 1129
229 Ga0439435_0068761 3300042436 Bacteria 1045
230 Ga0466965_0128118 3300044683 Bacteria 1314
231 Ga0466957_0343863 3300044842 Bacteria 1011
232 Ga0466960_0119535 3300044901 Bacteria 1379
233 Ga0466967_0316767 3300045976 Bacteria 1504
234 Ga0466967_0702978 3300045976 Bacteria 1001
235 Ga0495627_009766 3300046453 Bacteria 3518
236 Ga0495592_0065348 3300046454 Bacteria 2663
237 Ga0495629_0127318 3300046459 Bacteria 1774
238 Ga0495638_0005667 3300046460 Bacteria 9201
239 Ga0495638_0076592 3300046460 Bacteria 2038
240 Ga0495638_0410056 3300046460 Unclassified 701
241 Ga0495651_0010673 3300046462 Bacteria 7067
242 Ga0495662_0119120 3300046476 Bacteria 1295
243 Ga0495664_0001055 3300046477 Bacteria 14235
244 Ga0495585_0033136 3300046492 Bacteria 2926
245 Ga0495594_0158043 3300046499 Bacteria 1288
246 Ga0495607_0043228 3300046501 Bacteria 2666
247 Ga0495583_0152994 3300046506 Bacteria 955
248 Ga0495606_0000286 3300046507 Bacteria 87736
249 Ga0495606_0058611 3300046507 Bacteria 2474
250 Ga0495606_0328306 3300046507 Bacteria 819
251 Ga0495608_0104176 3300046511 Bacteria 1827
252 Ga0495610_0064734 3300046512 Bacteria 1727
253 Ga0495616_0005580 3300046513 Bacteria 7714
254 Ga0495616_0171689 3300046513 Bacteria 969
255 Ga0495618_0072399 3300046514 Bacteria 2193
256 Ga0495620_0003772 3300046515 Bacteria 8652
257 Ga0495628_0034861 3300046516 Bacteria 4046
258 Ga0495630_0071797 3300046517 Bacteria 2606
259 Ga0495631_0000135 3300046518 Bacteria 50021
260 Ga0495637_0006294 3300046520 Bacteria 5975
261 Ga0495643_0005026 3300046522 Bacteria 9058
262 Ga0495587_0004246 3300046536 Bacteria 9474
263 Ga0495621_0023947 3300046539 Bacteria 2034
264 Ga0495645_0000621 3300046543 Bacteria 24430
265 Ga0495622_0141077 3300046557 Bacteria 1094
266 Ga0495667_0037769 3300046559 Bacteria 3217
267 Ga0495656_0000768 3300046615 Bacteria 10345
268 Ga0495656_0028109 3300046615 Bacteria 2253
269 Ga0495668_0032774 3300046616 Bacteria 2921
270 Ga0495668_0201195 3300046616 Bacteria 1090
271 Ga0495625_0074868 3300046660 Bacteria 2370
272 Ga0495625_0207561 3300046660 Bacteria 1289
273 Ga0495635_0011990 3300046663 Bacteria 6074
274 Ga0495588_0019333 3300046674 Bacteria 3336
275 Ga0495588_0267767 3300046674 Bacteria 900
276 Ga0495588_0298851 3300046674 Bacteria 848
277 Ga0495657_0059497 3300046675 Bacteria 2534
278 Ga0495599_0024941 3300046678 Bacteria 3740
279 Ga0495623_0227519 3300046679 Bacteria 1059
280 Ga0495646_0033870 3300046680 Bacteria 3175
281 Ga0495613_0190860 3300046689 Bacteria 1448
282 Ga0495624_0039603 3300046690 Bacteria 3021
283 Ga0495670_0313817 3300046691 Unclassified 841
284 Ga0495671_0069322 3300046692 Bacteria 1733
285 Ga0495600_0014376 3300046809 Bacteria 4987
286 Ga0495660_0213769 3300046810 Bacteria 913
287 Ga0495581_0160962 3300047315 Bacteria 1312
288 Ga0495604_0024163 3300047317 Bacteria 4850
289 Ga0495604_0243500 3300047317 Bacteria 1228
290 Ga0495674_0177694 3300047319 Bacteria 1774
291 Ga0495676_0017468 3300047321 Bacteria 6342
292 Ga0495680_0048773 3300047322 Bacteria 3323
293 Ga0495675_0005107 3300047444 Bacteria 7988
294 Ga0495681_0114837 3300047470 Bacteria 1162
295 Ga0495686_0000301 3300047472 Bacteria 84924
296 Ga0495686_0008318 3300047472 Bacteria 7627
297 Ga0495593_0003733 3300047673 Bacteria 9084
298 Ga0495602_0027115 3300048088 Bacteria 5513
299 Ga0495602_0046211 3300048088 Bacteria 3935
300 Ga0495614_0000628 3300048089 Bacteria 14772
301 Ga0496100_0158536 3300048903 Bacteria 1620
302 Ga0496101_0002024 3300048904 Bacteria 12315
303 Ga0496105_0025100 3300048908 Bacteria 4847
304 Ga0496106_0416968 3300048909 Bacteria 1079
305 Ga0496113_0100149 3300048916 Bacteria 2245
306 Ga0496114_0384046 3300048917 Bacteria 1243
307 Ga0496114_0554710 3300048917 Bacteria 1015
308 Ga0496116_0003414 3300048919 Bacteria 15708
309 Ga0496117_0040615 3300048920 Bacteria 3418
310 Ga0496117_0128993 3300048920 Bacteria 1537
311 Ga0496117_0273687 3300048920 Bacteria 908
312 Ga0496118_0005495 3300048921 Bacteria 14383
313 Ga0496118_0009108 3300048921 Bacteria 10105
314 Ga0496118_0046702 3300048921 Bacteria 3365
315 Ga0496118_0164025 3300048921 Bacteria 1369
316 Ga0496119_0010494 3300048922 Bacteria 7787
317 Ga0496119_0016180 3300048922 Bacteria 5697
318 Ga0496119_0021616 3300048922 Bacteria 4640
319 Ga0496119_0210264 3300048922 Bacteria 1001
320 Ga0496121_0005293 3300048924 Bacteria 16613
321 Ga0496121_0017118 3300048924 Bacteria 7428
322 Ga0496121_0019634 3300048924 Bacteria 6749
323 Ga0496121_0063117 3300048924 Bacteria 3029
324 Ga0496121_0093985 3300048924 Bacteria 2333
325 Ga0496121_0114352 3300048924 Bacteria 2051
326 Ga0496121_0151254 3300048924 Bacteria 1707
327 Ga0496121_0167716 3300048924 Bacteria 1598
328 Ga0496121_0168353 3300048924 Bacteria 1595
329 Ga0496122_0017844 3300048925 Bacteria 6599
330 Ga0496122_0031377 3300048925 Bacteria 4424
331 Ga0496122_0086217 3300048925 Bacteria 2162
332 Ga0496122_0197503 3300048925 Bacteria 1180
333 Ga0496123_0012165 3300048926 Bacteria 7366
334 Ga0496123_0092108 3300048926 Bacteria 1795
335 Ga0496123_0108658 3300048926 Bacteria 1591
336 Ga0496123_0121497 3300048926 Bacteria 1468
337 Ga0496124_0004534 3300048927 Bacteria 16169
338 Ga0496124_0015745 3300048927 Bacteria 7230
339 Ga0496124_0368617 3300048927 Bacteria 1009
340 Ga0496125_0026113 3300048928 Bacteria 5333
341 Ga0496125_0060927 3300048928 Bacteria 3029
342 Ga0496125_0085397 3300048928 Bacteria 2392
343 Ga0496125_0141403 3300048928 Bacteria 1673
344 Ga0496126_0018511 3300048929 Bacteria 6897
345 Ga0496126_0088408 3300048929 Bacteria 2729
346 Ga0496126_0490083 3300048929 Unclassified 984
347 Ga0501036_0327538 3300049572 Bacteria 1280
348 Ga0501038_0043906 3300049574 Bacteria 3886
349 Ga0501039_1254254 3300049575 Bacteria 572
350 Ga0501041_0113459 3300049577 Bacteria 1682
351 Ga0501042_0185391 3300049578 Bacteria 1501
352 Ga0501043_0190959 3300049579 Bacteria 1593
353 Ga0501048_0045305 3300049582 Bacteria 3142
354 Ga0501069_0418781 3300049585 Bacteria 794
355 Ga0501072_0063548 3300049588 Bacteria 2912
356 Ga0501074_0020311 3300049590 Bacteria 4828
357 Ga0501075_0200680 3300049591 Bacteria 1521
358 Ga0501077_0203426 3300049593 Bacteria 1258
359 Ga0501079_0295330 3300049741 Bacteria 1267
360 Ga0501080_0257175 3300049742 Bacteria 1591
361 Ga0501081_0290335 3300049743 Bacteria 1198
362 Ga0501035_0255546 3300049822 Bacteria 1487
363 Ga0501045_0123650 3300049824 Bacteria 1921
364 nmdc:mga03683_131136_c1 3300050489 Bacteria 1121
365 nmdc:mga03n38_105640_c1 3300050490 Bacteria 1364
366 nmdc:mga00v17_291778_c1 3300050491 Bacteria 1059
367 nmdc:mga00v17_76569_c1 3300050491 Bacteria 2081
368 nmdc:mga0k408_8213_c1 3300050493 Bacteria 5595
369 nmdc:mga07m45_210447_c1 3300050496 Bacteria 1131
370 nmdc:mga05p37_557652_c1 3300050507 Bacteria 1303
371 nmdc:mga09592_306408_c1 3300050508 Bacteria 1377
372 nmdc:mga09592_38415_c1 3300050508 Bacteria 4019
373 nmdc:mga0qj67_23148_c1 3300050509 Bacteria 4776
374 nmdc:mga06r32_6170_c1 3300050510 Bacteria 10761
375 nmdc:mga0sz30_196881_c1 3300050516 Bacteria 894
376 Ga0495601_0003004 3300053077 Bacteria 9611
377 Ga0495612_0000926 3300053078 Bacteria 12019
378 Ga0500610_0007049 3300053079 Bacteria 4775
379 Ga0500610_0054019 3300053079 Bacteria 2094
380 Ga0495595_0075712 3300053084 Bacteria 1596
381 Ga0495619_0005491 3300053085 Bacteria 8039
382 Ga0500578_0177543 3300053086 Bacteria 1314
383 Ga0500651_0000042 3300053093 Bacteria 87895
384 Ga0500651_0031665 3300053093 Bacteria 3330
385 Ga0500566_0007251 3300053094 Bacteria 6571
386 Ga0500566_0221237 3300053094 Bacteria 941
387 Ga0500571_000075 3300053110 Bacteria 31313
388 Ga0500572_006892 3300053111 Bacteria 2616
389 Ga0500592_013976 3300053116 Bacteria 1287
390 Ga0500594_0000588 3300053118 Bacteria 7789
391 Ga0500594_0076782 3300053118 Bacteria 992
392 Ga0500595_000443 3300053119 Bacteria 25930
393 Ga0500595_018050 3300053119 Bacteria 2588
394 Ga0500607_039572 3300053121 Bacteria 2559
395 Ga0500608_007382 3300053122 Bacteria 4545
396 Ga0500618_000405 3300053125 Bacteria 29227
397 Ga0500626_020349 3300053128 Bacteria 2951
398 Ga0500628_025356 3300053129 Bacteria 1240
399 Ga0500655_000155 3300053133 Bacteria 17130
400 Ga0500658_0000134 3300053134 Bacteria 34937
401 Ga0500658_0000142 3300053134 Bacteria 34080
402 Ga0500559_0005546 3300053136 Bacteria 5791
403 Ga0500564_006845 3300053138 Bacteria 4791
404 Ga0500568_0000983 3300053139 Bacteria 19591
405 Ga0500568_0016920 3300053139 Bacteria 3229
406 Ga0500574_000142 3300053141 Bacteria 8167
407 Ga0500588_0025830 3300053146 Bacteria 1637
408 Ga0500604_0019579 3300053151 Bacteria 1897
409 Ga0500616_0075817 3300053153 Bacteria 1701
410 Ga0500616_0100128 3300053153 Bacteria 1418
411 Ga0500624_002913 3300053157 Bacteria 2264
412 Ga0500638_064602 3300053162 Bacteria 1755
413 Ga0500638_075940 3300053162 Bacteria 1600
414 Ga0500636_0069704 3300053177 Bacteria 2040
415 Ga0500636_0114460 3300053177 Bacteria 1520
416 Ga0500636_0158740 3300053177 Bacteria 1235
417 Ga0501084_0306547 3300054114 Bacteria 1341
418 Ga0530510_0405539 3300061734 Bacteria 1028
419 2508728761 2508501050 Bacteria 9633614
420 2509078336 2508501114 Bacteria 7082538
421 2511194681 2510917030 Bacteria 7460662
422 2513912064 2513237144 Bacteria 7530820
423 2513927370 2513237146 Bacteria 7166346
424 2585169082 2582581283 Bacteria 6030556
425 2585222119 2582581298 Bacteria 7315509
426 2585334565 2582581316 Bacteria 7774528
427 2585544928 2585427529 Bacteria 7395659
428 2585846062 2585427594 Bacteria 6180594
429 2599415187 2599185170 Bacteria 7295545
430 2599625085 2599185214 Bacteria 8209958
431 2599673098 2599185226 Bacteria 8233575
432 2599682452 2599185227 Bacteria 8246414
433 2599694706 2599185229 Bacteria 8216126
434 2617382134 2617270742 Bacteria 6808054
435 2644168121 2643221629 Bacteria 5850260
436 2644278503 2643221649 Bacteria 3867359
437 2644348817 2643221662 Bacteria 5851492
438 2738717871 2738541277 Bacteria 7458140
439 2738801457 2738541293 Bacteria 7065685
440 2738879525 2738541307 Bacteria 8606193
441 2739248423 2738543013 Bacteria 5618633
442 2739278557 2738543019 Bacteria 7459457
443 2745082253 2744054633 Bacteria 8678936
444 2774868686 2773857925 Bacteria 6472445
445 2776262480 2775506901 Bacteria 9631051
446 2819597022 2818991446 Bacteria 7757362
447 2835316194 2835312727 Bacteria 7413381
448 2838039088 2838035591 Bacteria 7166484
449 2838664320 2838661181 Bacteria 7385261
450 2841913587 2841911363 Bacteria 6173697
451 2841919334 2841917233 Bacteria 6173500
452 2842484345 2842482326 Bacteria 7212537
453 2844536920 2844533157 Bacteria 7517899
454 2894233126 2894232714 Bacteria 8834183
455 2894774011 2894772417 Bacteria 5305674
456 2899930237 2899924645 Bacteria 7487985
457 2904547611 2904541872 Bacteria 8915136
458 2928039350 2928037797 Bacteria 7273642
459 2928045045 2928044640 Bacteria 7271509
460 2928052851 2928051484 Bacteria 7773759
461 2928064478 2928064002 Bacteria 7419480
462 2928075123 2928070936 Bacteria 8062541
463 2928088301 2928084124 Bacteria 7159212
464 2929167148 2929160207 Bacteria 9075316
465 2933019445 2933016740 Bacteria 6355406
466 2936058033 2936055302 Bacteria 8785755
467 2945948139 2945945610 Bacteria 5951079
468 8024490415 8024486573 Bacteria 6540512
469 Ga0070677_10137594
470 JGI24740J21852_10037958
471 JGI25162J39368_1000440
472 JGI25158J39367_1014613
473 JGI25152J39213_1000351
474 JGI25152J39213_1013240
475 JGI25150J39212_1000026
476 JGI25150J39212_1000292
477 JGI25159J45721_1000047
478 JGI25151J46595_10000053
479 JGI25151J46595_10000674
480 JGI25165J46597_1000494
481 JGI25153J46596_10000402
482 JGI25153J46596_10003066
483 rootH2_10099260
484 rootH2_10199587
485 rootL2_10027034
486 rootL2_10058394
487 rootH1_10285170
488 JGI25160J50197_1000125
489 JGI25161J50226_1000147
490 Ga0055535_1000696
491 Ga0055542_1000027
492 Ga0055526_1000153
493 Ga0055537_1000082
494 Ga0055524_1000548
495 Ga0055536_1002460
496 Ga0055536_1037850
497 Ga0055534_1000133
498 Ga0055534_1000301
499 Ga0055528_1000558
500 Ga0055528_1063204
501 Ga0055540_1001156
502 Ga0055531_10014804
503 Ga0055543_1000182
504 Ga0065165_1000516
505 Ga0070658_10091699
506 Ga0070689_100225556
507 Ga0070668_100366893
508 Ga0070709_10044414
509 Ga0070709_10100532
510 Ga0070714_100022721
511 Ga0070714_100177680
512 Ga0070714_100186467
513 Ga0070714_100366735
514 Ga0070713_100067713
515 Ga0070710_10013396
516 Ga0070710_10144316
517 Ga0070711_100064075
518 Ga0070711_100177671
519 Ga0070681_10225650
520 Ga0070706_100012800
521 Ga0070679_100120192
522 Ga0068853_100019486
523 Ga0070672_100026919
524 Ga0070665_100729701
525 Ga0068856_100197392
526 Ga0068856_100233159
527 Ga0068856_100302645
528 Ga0068859_100266755
529 Ga0068851_10019255
530 Ga0068863_100340599
531 Ga0068858_100785941
532 Ga0081455_10408065
533 Ga0070717_10012817
534 Ga0070717_10209618
535 Ga0075368_10100278
536 Ga0075363_100179480
537 Ga0075364_10142626
538 Ga0075364_10304563
539 Ga0070715_10074065
540 Ga0070715_10079850
541 Ga0070712_100016011
542 Ga0075362_10108643
543 Ga0075369_10250715
544 Ga0075366_10000792
545 Ga0075428_100151670
546 Ga0075430_100103215
547 Ga0075431_100196111
548 Ga0075429_100009302
549 Ga0075429_100237670
550 Ga0075436_100856397
551 Ga0097620_100266769
552 Ga0105244_10090231
553 Ga0105240_10004352
554 Ga0105240_10109201
555 Ga0111539_11030389
556 Ga0114129_10424940
557 Ga0105243_10001557
558 Ga0105243_10684761
559 Ga0105033_109710
560 Ga0105239_10318703
561 Ga0105239_10541977
562 Ga0105246_10266341
563 Ga0105246_10440126
564 Ga0157371_10103963
565 Ga0157370_10005682
566 Ga0157370_10384862
567 Ga0157369_10548529
568 Ga0157374_10377291
569 Ga0157378_10914522
570 Ga0157375_10266274
571 Ga0163163_10138347
572 Ga0157380_10034141
573 Ga0157380_10353624
574 Ga0182008_10085841
575 Ga0157379_10322138
576 Ga0163161_10028844
577 Ga0163161_10301653
578 Ga0213874_10022673
579 Ga0213874_10073820
580 Ga0213875_10000421
581 Ga0209436_103609
582 Ga0209672_101497
583 Ga0209147_102265
584 Ga0209437_100064
585 Ga0209258_100048
586 Ga0207425_1000104
587 Ga0207425_1000187
588 Ga0209148_1000040
589 Ga0209129_1000007
590 Ga0209129_1000213
591 Ga0209233_1000081
592 Ga0209565_1000105
593 Ga0209673_1001154
594 Ga0209673_1017575
595 Ga0209130_1000070
596 Ga0209130_1000160
597 Ga0209675_1000161
598 Ga0209676_1000785
599 Ga0209676_1002015
600 Ga0209025_1000111
601 Ga0209025_1000181
602 Ga0209025_1072954
603 Ga0209564_1000153
604 Ga0209758_1000025
605 Ga0209758_1000156
606 Ga0209758_1030633
607 Ga0209256_1000971
608 Ga0207426_1000001
609 Ga0207426_1000098
610 Ga0209051_1000398
611 Ga0209051_1002681
612 Ga0209051_1038431
613 Ga0209257_1000905
614 Ga0209257_1009161
615 Ga0207656_10108512
616 Ga0207692_10214336
617 Ga0207688_10147290
618 Ga0207680_10076178
619 Ga0207699_10021837
620 Ga0207705_10086662
621 Ga0207693_10013748
622 Ga0207693_10235775
623 Ga0207663_10057429
624 Ga0207663_10859612
625 Ga0207652_10077226
626 Ga0207700_10052371
627 Ga0207700_10234830
628 Ga0207664_10013278
629 Ga0207664_10363120
630 Ga0207664_10370463
631 Ga0207706_10105761
632 Ga0207706_10210768
633 Ga0207709_10000295
634 Ga0207665_10022925
635 Ga0207691_10034628
636 Ga0207691_10464015
637 Ga0207668_10451389
638 Ga0207677_10299600
639 Ga0207703_10641873
640 Ga0207702_10316317
641 Ga0207674_10443275
642 Ga0207683_10865334
643 Ga0207428_10221766
644 Ga0207428_10356718
645 Ga0265334_10007467
646 Ga0307515_10000734
647 Ga0265330_10023925
648 Ga0265340_10006640
649 Ga0265340_10058642
650 Ga0265339_10080465
651 Ga0307508_10259885
652 Ga0307405_10000692
653 Ga0307405_10031248
654 Ga0307405_10242599
655 Ga0307413_10303964
656 Ga0307410_10029869
657 Ga0307407_10054286
658 Ga0307412_10001472
659 Ga0307416_100363509
660 Ga0307411_10061373
661 Ga0307411_10120180
662 Ga0307415_100188605
663 Ga0307510_10056863
664 Ga0373934_0054742
665 Ga0373923_0000665
666 Ga0373936_0008498
667 Ga0373939_0019884
668 Ga0373945_0030583
669 Ga0373953_0155826
670 Ga0373954_0031538
671 Ga0373956_0028794
672 Ga0373943_0110343
673 Ga0373946_0008138
674 Ga0373924_0002958
675 Ga0373931_0029945
676 Ga0373935_0129135
677 Ga0373927_0031293
678 Ga0373927_0425958
679 Ga0373933_0024223
680 Ga0373933_0454037
681 Ga0373947_0082161
682 Ga0373937_0013781
683 Ga0395900_0162024
684 Ga0436364_0189042
685 Ga0436364_0907328
686 Ga0436364_1077066
687 Ga0395901_0000429
688 Ga0436365_0386367
689 Ga0436365_1270831
690 Ga0436365_1361371
691 Ga0436365_1484954
692 Ga0436361_0763867
693 Ga0436363_0053010
694 Ga0436363_0110353
695 Ga0439461_0059598
696 Ga0450909_015400
697 Ga0439435_0068761
698 Ga0466965_0128118
699 Ga0466957_0343863
700 Ga0466960_0119535
701 Ga0466967_0316767
702 Ga0466967_0702978
703 Ga0495627_009766
704 Ga0495592_0065348
705 Ga0495629_0127318
706 Ga0495638_0005667
707 Ga0495638_0076592
708 Ga0495638_0410056
709 Ga0495651_0010673
710 Ga0495662_0119120
711 Ga0495664_0001055
712 Ga0495585_0033136
713 Ga0495594_0158043
714 Ga0495607_0043228
715 Ga0495583_0152994
716 Ga0495606_0000286
717 Ga0495606_0058611
718 Ga0495606_0328306
719 Ga0495608_0104176
720 Ga0495610_0064734
721 Ga0495616_0005580
722 Ga0495616_0171689
723 Ga0495618_0072399
724 Ga0495620_0003772
725 Ga0495628_0034861
726 Ga0495630_0071797
727 Ga0495631_0000135
728 Ga0495637_0006294
729 Ga0495643_0005026
730 Ga0495587_0004246
731 Ga0495621_0023947
732 Ga0495645_0000621
733 Ga0495622_0141077
734 Ga0495667_0037769
735 Ga0495656_0000768
736 Ga0495656_0028109
737 Ga0495668_0032774
738 Ga0495668_0201195
739 Ga0495625_0074868
740 Ga0495625_0207561
741 Ga0495635_0011990
742 Ga0495588_0019333
743 Ga0495588_0267767
744 Ga0495588_0298851
745 Ga0495657_0059497
746 Ga0495599_0024941
747 Ga0495623_0227519
748 Ga0495646_0033870
749 Ga0495613_0190860
750 Ga0495624_0039603
751 Ga0495670_0313817
752 Ga0495671_0069322
753 Ga0495600_0014376
754 Ga0495660_0213769
755 Ga0495581_0160962
756 Ga0495604_0024163
757 Ga0495604_0243500
758 Ga0495674_0177694
759 Ga0495676_0017468
760 Ga0495680_0048773
761 Ga0495675_0005107
762 Ga0495681_0114837
763 Ga0495686_0000301
764 Ga0495686_0008318
765 Ga0495593_0003733
766 Ga0495602_0027115
767 Ga0495602_0046211
768 Ga0495614_0000628
769 Ga0496100_0158536
770 Ga0496101_0002024
771 Ga0496105_0025100
772 Ga0496106_0416968
773 Ga0496113_0100149
774 Ga0496114_0384046
775 Ga0496114_0554710
776 Ga0496116_0003414
777 Ga0496117_0040615
778 Ga0496117_0128993
779 Ga0496117_0273687
780 Ga0496118_0005495
781 Ga0496118_0009108
782 Ga0496118_0046702
783 Ga0496118_0164025
784 Ga0496119_0010494
785 Ga0496119_0016180
786 Ga0496119_0021616
787 Ga0496119_0210264
788 Ga0496121_0005293
789 Ga0496121_0017118
790 Ga0496121_0019634
791 Ga0496121_0063117
792 Ga0496121_0093985
793 Ga0496121_0114352
794 Ga0496121_0151254
795 Ga0496121_0167716
796 Ga0496121_0168353
797 Ga0496122_0017844
798 Ga0496122_0031377
799 Ga0496122_0086217
800 Ga0496122_0197503
801 Ga0496123_0012165
802 Ga0496123_0092108
803 Ga0496123_0108658
804 Ga0496123_0121497
805 Ga0496124_0004534
806 Ga0496124_0015745
807 Ga0496124_0368617
808 Ga0496125_0026113
809 Ga0496125_0060927
810 Ga0496125_0085397
811 Ga0496125_0141403
812 Ga0496126_0018511
813 Ga0496126_0088408
814 Ga0496126_0490083
815 Ga0501036_0327538
816 Ga0501038_0043906
817 Ga0501039_1254254
818 Ga0501041_0113459
819 Ga0501042_0185391
820 Ga0501043_0190959
821 Ga0501048_0045305
822 Ga0501069_0418781
823 Ga0501072_0063548
824 Ga0501074_0020311
825 Ga0501075_0200680
826 Ga0501077_0203426
827 Ga0501079_0295330
828 Ga0501080_0257175
829 Ga0501081_0290335
830 Ga0501035_0255546
831 Ga0501045_0123650
832 nmdc:mga03683_131136_c1
833 nmdc:mga03n38_105640_c1
834 nmdc:mga00v17_291778_c1
835 nmdc:mga00v17_76569_c1
836 nmdc:mga0k408_8213_c1
837 nmdc:mga07m45_210447_c1
838 nmdc:mga05p37_557652_c1
839 nmdc:mga09592_306408_c1
840 nmdc:mga09592_38415_c1
841 nmdc:mga0qj67_23148_c1
842 nmdc:mga06r32_6170_c1
843 nmdc:mga0sz30_196881_c1
844 Ga0495601_0003004
845 Ga0495612_0000926
846 Ga0500610_0007049
847 Ga0500610_0054019
848 Ga0495595_0075712
849 Ga0495619_0005491
850 Ga0500578_0177543
851 Ga0500651_0000042
852 Ga0500651_0031665
853 Ga0500566_0007251
854 Ga0500566_0221237
855 Ga0500571_000075
856 Ga0500572_006892
857 Ga0500592_013976
858 Ga0500594_0000588
859 Ga0500594_0076782
860 Ga0500595_000443
861 Ga0500595_018050
862 Ga0500607_039572
863 Ga0500608_007382
864 Ga0500618_000405
865 Ga0500626_020349
866 Ga0500628_025356
867 Ga0500655_000155
868 Ga0500658_0000134
869 Ga0500658_0000142
870 Ga0500559_0005546
871 Ga0500564_006845
872 Ga0500568_0000983
873 Ga0500568_0016920
874 Ga0500574_000142
875 Ga0500588_0025830
876 Ga0500604_0019579
877 Ga0500616_0075817
878 Ga0500616_0100128
879 Ga0500624_002913
880 Ga0500638_064602
881 Ga0500638_075940
882 Ga0500636_0069704
883 Ga0500636_0114460
884 Ga0500636_0158740
885 Ga0501084_0306547
886 Ga0530510_0405539
887 2508728761
888 2509078336
889 2511194681
890 2513912064
891 2513927370
892 2585169082
893 2585222119
894 2585334565
895 2585544928
896 2585846062
897 2599415187
898 2599625085
899 2599673098
900 2599682452
901 2599694706
902 2617382134
903 2644168121
904 2644278503
905 2644348817
906 2738717871
907 2738801457
908 2738879525
909 2739248423
910 2739278557
911 2745082253
912 2774868686
913 2776262480
914 2819597022
915 2835316194
916 2838039088
917 2838664320
918 2841913587
919 2841919334
920 2842484345
921 2844536920
922 2894233126
923 2894774011
924 2899930237
925 2904547611
926 2928039350
927 2928045045
928 2928052851
929 2928064478
930 2928075123
931 2928088301
932 2929167148
933 2933019445
934 2936058033
935 2945948139
936 8024490415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8822 38 202
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.848 31 202
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8372 37 202
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8245 39 202
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8154 32 212
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8335 33 203 1.20.1290.10
3beyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8008 30 109 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7954 33 203 1.20.1290.10
3beyD00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7751 29 109 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7747 62 212 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A0D0LQD3-F1-model_v4 Avi_7170 family CMD domain-containing protein 0.9892 14 215
AF-A0A0D0LQD3-F1-model_v4 Avi_7170 family CMD domain-containing protein 0.9796 14 215
AF-A0A6S6NRJ2-F1-model_v4 deleted 0.9774 15 206
AF-A0A7K1R5P3-F1-model_v4 deleted 0.9766 15 206
AF-A0A7M4DIL3-F1-model_v4 CMD domain protein 0.9681 14 211

Map