F450010

General Info

Members Datasets Scaffolds Average Seq Length
468 221 936 382

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100009542|Ga0097621_1000095425
Length 429
Sequence MICGLMVFLNKTLTFTPSPKEIVPLSTQVYLIKTKKSMKKVSIKLSALVLILGCFSNVVNGQSSDNKINVVTTAVPFLRISPDARSGGMGDAGVATAPDANAAFWNLAKYPFNTNQGGLSLTYTPWLKDLGLNDVYLISGAGYYKLSEDEAISSSLRYFSLGNIQFTDNFGNDLSSYRPREFAIDAGYSRKLSEKLSLGIALRYINSNLASGTINNVSYKAGTSVAADLTMFHTNLKADGSGLNYGVALTNLGSKISYTSDATQKDYIPAIDESNKITFALDLHKLLVPTPPVASTNPNDSIADAENTANLTEYRTQSVVSSWFTSLSDAPGGFSEEIKEFQLAVGAEYWYNNQFAFRTGYFYENPTKGNRQYFTMGAGLKYNNFGLNFSYLLPSGNGVSRNPLSNTLRFSLFFDFDGKGQGETATPKE

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
180 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
196 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
197 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
198 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
199 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
221 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 0.43
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100009542 3300006237 Bacteria 7050
2 MRS1b_contig_3312306 2162886011 Bacteria 1902
3 rootL2_10026242 3300003322 Bacteria 3886
4 rootL2_10258815 3300003322 Unclassified 1805
5 rootL2_10288036 3300003322 Bacteria 2778
6 rootH1_10016194 3300003323 Bacteria 5376
7 Ga0055531_10000076 3300003794 Bacteria 106998
8 Ga0065714_10098800 3300005288 Unclassified 1702
9 Ga0065704_10092826 3300005289 Bacteria 2632
10 Ga0065712_10090291 3300005290 Bacteria 2427
11 Ga0065707_10090440 3300005295 Bacteria 4105
12 Ga0070658_10004224 3300005327 Bacteria 11752
13 Ga0070658_10010879 3300005327 Bacteria 7295
14 Ga0070658_10018958 3300005327 Bacteria 5512
15 Ga0070658_10073192 3300005327 Bacteria 2810
16 Ga0070658_10088480 3300005327 Bacteria 2550
17 Ga0070658_10219480 3300005327 Unclassified 1607
18 Ga0070676_10007906 3300005328 Bacteria 5715
19 Ga0070676_10053776 3300005328 Unclassified 2373
20 Ga0070683_100002991 3300005329 Bacteria 13561
21 Ga0070690_100001960 3300005330 Bacteria 10951
22 Ga0070690_100083855 3300005330 Bacteria 2088
23 Ga0070670_100157851 3300005331 Unclassified 1965
24 Ga0068869_100033197 3300005334 Bacteria 3642
25 Ga0068869_100051559 3300005334 Bacteria 2985
26 Ga0068869_100090070 3300005334 Bacteria 2305
27 Ga0070666_10000038 3300005335 Bacteria 115799
28 Ga0070666_10047120 3300005335 Unclassified 2893
29 Ga0070680_100027257 3300005336 Bacteria 4575
30 Ga0070680_100174078 3300005336 Bacteria 1812
31 Ga0070682_100000005 3300005337 Bacteria 386439
32 Ga0070682_100009063 3300005337 Bacteria 5625
33 Ga0070682_100009901 3300005337 Bacteria 5398
34 Ga0068868_100013033 3300005338 Bacteria 6086
35 Ga0068868_100029098 3300005338 Bacteria 4230
36 Ga0068868_100098978 3300005338 Bacteria 2358
37 Ga0068868_100204336 3300005338 Bacteria 1648
38 Ga0070660_100005010 3300005339 Bacteria 9158
39 Ga0070660_100069826 3300005339 Bacteria 2740
40 Ga0070660_100159050 3300005339 Unclassified 1819
41 Ga0070660_100281667 3300005339 Bacteria 1360
42 Ga0070661_100123044 3300005344 Bacteria 1944
43 Ga0070668_100033120 3300005347 Bacteria 3933
44 Ga0070668_100108616 3300005347 Bacteria 2207
45 Ga0070669_100197313 3300005353 Bacteria 1582
46 Ga0070675_100059384 3300005354 Bacteria 3155
47 Ga0070671_100166003 3300005355 Bacteria 1867
48 Ga0070674_100012744 3300005356 Bacteria 5173
49 Ga0070673_100007802 3300005364 Bacteria 7085
50 Ga0070673_100038304 3300005364 Bacteria 3660
51 Ga0070673_100045663 3300005364 Unclassified 3398
52 Ga0070673_100177061 3300005364 Bacteria 1824
53 Ga0070688_100089582 3300005365 Bacteria 2008
54 Ga0070659_100017377 3300005366 Bacteria 5411
55 Ga0070659_100026705 3300005366 Bacteria 4445
56 Ga0070659_100051398 3300005366 Bacteria 3240
57 Ga0070667_100001526 3300005367 Bacteria 20725
58 Ga0070667_100050618 3300005367 Bacteria 3502
59 Ga0070667_100074981 3300005367 Unclassified 2887
60 Ga0070667_100078398 3300005367 Bacteria 2822
61 Ga0070678_100017339 3300005456 Bacteria 4634
62 Ga0070662_100016738 3300005457 Bacteria 4928
63 Ga0070662_100240393 3300005457 Bacteria 1452
64 Ga0070681_10033830 3300005458 Bacteria 5131
65 Ga0070681_10054755 3300005458 Bacteria 3975
66 Ga0070681_10137358 3300005458 Unclassified 2375
67 Ga0070681_10167321 3300005458 Bacteria 2121
68 Ga0068867_100014038 3300005459 Bacteria 5675
69 Ga0068867_100043547 3300005459 Bacteria 3286
70 Ga0068867_100216748 3300005459 Bacteria 1540
71 Ga0070698_100002644 3300005471 Bacteria 19745
72 Ga0070698_100003140 3300005471 Bacteria 18206
73 Ga0070698_100025402 3300005471 Bacteria 6174
74 Ga0070679_100001610 3300005530 Bacteria 20288
75 Ga0070679_100005255 3300005530 Bacteria 11986
76 Ga0070679_100046872 3300005530 Bacteria 4309
77 Ga0070684_100000097 3300005535 Bacteria 56477
78 Ga0070684_100145560 3300005535 Bacteria 2144
79 Ga0070684_100310085 3300005535 Bacteria 1449
80 Ga0068853_100017552 3300005539 Bacteria 5906
81 Ga0068853_100083215 3300005539 Bacteria 2804
82 Ga0068853_100100703 3300005539 Unclassified 2554
83 Ga0068853_100132809 3300005539 Bacteria 2229
84 Ga0068853_100167550 3300005539 Unclassified 1986
85 Ga0070672_100047957 3300005543 Bacteria 3317
86 Ga0070665_100091463 3300005548 Bacteria 3048
87 Ga0070665_100104479 3300005548 Bacteria 2835
88 Ga0068855_100062145 3300005563 Bacteria 4361
89 Ga0068855_100216448 3300005563 Bacteria 2150
90 Ga0068855_100237595 3300005563 Bacteria 2037
91 Ga0068855_100240868 3300005563 Bacteria 2021
92 Ga0068855_100304719 3300005563 Bacteria 1764
93 Ga0070664_100001366 3300005564 Bacteria 19444
94 Ga0068857_100003139 3300005577 Bacteria 13677
95 Ga0068857_100004934 3300005577 Bacteria 11326
96 Ga0068857_100175433 3300005577 Unclassified 1950
97 Ga0068854_100013151 3300005578 Bacteria 5425
98 Ga0068854_100116388 3300005578 Bacteria 2023
99 Ga0068854_100161619 3300005578 Bacteria 1735
100 Ga0068856_100021815 3300005614 Bacteria 6223
101 Ga0068856_100149965 3300005614 Bacteria 2340
102 Ga0068856_100258922 3300005614 Bacteria 1755
103 Ga0070702_100078480 3300005615 Unclassified 1971
104 Ga0068852_100009862 3300005616 Bacteria 7106
105 Ga0068852_100014489 3300005616 Bacteria 6072
106 Ga0068852_100056651 3300005616 Unclassified 3388
107 Ga0068852_100059761 3300005616 Bacteria 3307
108 Ga0068859_100000007 3300005617 Bacteria 390070
109 Ga0068859_100003007 3300005617 Bacteria 17097
110 Ga0068859_100056305 3300005617 Bacteria 3956
111 Ga0068859_100085391 3300005617 Bacteria 3202
112 Ga0068859_100352801 3300005617 Unclassified 1566
113 Ga0068859_100353845 3300005617 Bacteria 1563
114 Ga0068864_100008725 3300005618 Bacteria 8360
115 Ga0068864_100015093 3300005618 Bacteria 6422
116 Ga0068864_100024227 3300005618 Bacteria 5104
117 Ga0068861_100017009 3300005719 Bacteria 5157
118 Ga0068863_100011953 3300005841 Bacteria 8389
119 Ga0068863_100125301 3300005841 Bacteria 2450
120 Ga0068863_100176743 3300005841 Bacteria 2049
121 Ga0068860_100004369 3300005843 Bacteria 14436
122 Ga0068860_100006905 3300005843 Bacteria 11383
123 Ga0068860_100019108 3300005843 Bacteria 6654
124 Ga0068860_100151749 3300005843 Bacteria 2231
125 Ga0068862_100012344 3300005844 Bacteria 7062
126 Ga0068862_100341745 3300005844 Bacteria 1386
127 Ga0075366_10006805 3300006195 Bacteria 6285
128 Ga0075366_10026916 3300006195 Unclassified 3371
129 Ga0097621_100000118 3300006237 Bacteria 45384
130 Ga0097621_100002035 3300006237 Bacteria 13843
131 Ga0068871_100008142 3300006358 Bacteria 7529
132 Ga0068871_100112914 3300006358 Bacteria 2287
133 Ga0075428_100015617 3300006844 Bacteria 8415
134 Ga0075428_100158326 3300006844 Bacteria 2459
135 Ga0075430_100122337 3300006846 Bacteria 2169
136 Ga0075431_100013446 3300006847 Bacteria 8267
137 Ga0075431_100027219 3300006847 Bacteria 5865
138 Ga0075434_100141144 3300006871 Bacteria 2429
139 Ga0075429_100070203 3300006880 Bacteria 3050
140 Ga0075429_100236911 3300006880 Bacteria 1598
141 Ga0068865_100073113 3300006881 Unclassified 2437
142 Ga0068865_100083886 3300006881 Bacteria 2295
143 Ga0097620_100000007 3300006931 Bacteria 390070
144 Ga0097620_100003007 3300006931 Bacteria 17097
145 Ga0097620_100056297 3300006931 Bacteria 3956
146 Ga0097620_100085384 3300006931 Bacteria 3202
147 Ga0097620_100352775 3300006931 Unclassified 1566
148 Ga0097620_100353852 3300006931 Bacteria 1563
149 Ga0105240_10009165 3300009093 Bacteria 14040
150 Ga0105240_10017744 3300009093 Bacteria 9580
151 Ga0105240_10037355 3300009093 Bacteria 6243
152 Ga0105240_10051147 3300009093 Bacteria 5203
153 Ga0105240_10138628 3300009093 Bacteria 2911
154 Ga0105240_10266848 3300009093 Unclassified 1973
155 Ga0105240_10516717 3300009093 Unclassified 1326
156 Ga0111539_10029652 3300009094 Bacteria 6660
157 Ga0111539_10204553 3300009094 Bacteria 2301
158 Ga0105247_10000702 3300009101 Bacteria 26164
159 Ga0114129_10005818 3300009147 Bacteria 17462
160 Ga0114129_10018475 3300009147 Bacteria 9930
161 Ga0114129_10199044 3300009147 Bacteria 2714
162 Ga0105241_10000104 3300009174 Bacteria 60482
163 Ga0105241_10007003 3300009174 Bacteria 8295
164 Ga0105241_10060440 3300009174 Unclassified 2915
165 Ga0105241_10090037 3300009174 Bacteria 2419
166 Ga0105248_10013248 3300009177 Bacteria 9079
167 Ga0105237_10002631 3300009545 Bacteria 22095
168 Ga0105237_10014452 3300009545 Bacteria 8254
169 Ga0105237_10032624 3300009545 Bacteria 5273
170 Ga0105237_10237783 3300009545 Bacteria 1823
171 Ga0105238_10018596 3300009551 Bacteria 7075
172 Ga0105238_10021216 3300009551 Bacteria 6620
173 Ga0105238_10090490 3300009551 Bacteria 3047
174 Ga0105249_10001119 3300009553 Bacteria 23864
175 Ga0105249_10003042 3300009553 Bacteria 14469
176 Ga0105249_10012567 3300009553 Bacteria 7463
177 Ga0105249_10190518 3300009553 Unclassified 2001
178 Ga0105249_10258427 3300009553 Unclassified 1729
179 Ga0105239_10006591 3300010375 Bacteria 13447
180 Ga0105239_10023009 3300010375 Bacteria 6870
181 Ga0105239_10202240 3300010375 Unclassified 2225
182 Ga0105239_10246306 3300010375 Bacteria 2007
183 Ga0157373_10006378 3300013100 Bacteria 8812
184 Ga0157373_10011288 3300013100 Bacteria 6569
185 Ga0157373_10042596 3300013100 Bacteria 3244
186 Ga0157371_10000420 3300013102 Bacteria 52349
187 Ga0157371_10006644 3300013102 Bacteria 9476
188 Ga0157371_10058828 3300013102 Unclassified 2726
189 Ga0157371_10123945 3300013102 Bacteria 1838
190 Ga0157370_10004098 3300013104 Bacteria 16897
191 Ga0157370_10028655 3300013104 Bacteria 5475
192 Ga0157370_10032883 3300013104 Bacteria 5061
193 Ga0157369_10014809 3300013105 Bacteria 8800
194 Ga0157369_10192013 3300013105 Bacteria 2145
195 Ga0157374_10000336 3300013296 Bacteria 43367
196 Ga0157374_10004823 3300013296 Bacteria 11320
197 Ga0157374_10042721 3300013296 Bacteria 4183
198 Ga0157374_10129416 3300013296 Bacteria 2442
199 Ga0157378_10003328 3300013297 Bacteria 14295
200 Ga0157378_10031080 3300013297 Bacteria 4716
201 Ga0157378_10049398 3300013297 Bacteria 3742
202 Ga0157378_10079357 3300013297 Bacteria 2963
203 Ga0157378_10084455 3300013297 Bacteria 2875
204 Ga0157378_10145577 3300013297 Bacteria 2203
205 Ga0163162_10000086 3300013306 Bacteria 85949
206 Ga0163162_10000970 3300013306 Bacteria 26653
207 Ga0163162_10025527 3300013306 Bacteria 5839
208 Ga0163162_10027924 3300013306 Bacteria 5582
209 Ga0163162_10113013 3300013306 Bacteria 2814
210 Ga0163162_10141948 3300013306 Bacteria 2515
211 Ga0163162_10156590 3300013306 Unclassified 2398
212 Ga0157372_10017153 3300013307 Bacteria 7773
213 Ga0157372_10052558 3300013307 Unclassified 4537
214 Ga0157372_10090254 3300013307 Unclassified 3483
215 Ga0157372_10107988 3300013307 Unclassified 3185
216 Ga0157372_10162975 3300013307 Bacteria 2577
217 Ga0157372_10332620 3300013307 Bacteria 1769
218 Ga0157375_10000115 3300013308 Bacteria 77964
219 Ga0157375_10071957 3300013308 Bacteria 3472
220 Ga0157375_10165154 3300013308 Bacteria 2358
221 Ga0157375_10329919 3300013308 Bacteria 1691
222 Ga0157380_10123906 3300014326 Bacteria 2193
223 Ga0157380_10186858 3300014326 Bacteria 1826
224 Ga0157377_10002032 3300014745 Bacteria 8867
225 Ga0157377_10030867 3300014745 Bacteria 2907
226 Ga0157377_10044329 3300014745 Unclassified 2480
227 Ga0157379_10036442 3300014968 Bacteria 4386
228 Ga0157376_10000467 3300014969 Bacteria 26068
229 Ga0157376_10032450 3300014969 Bacteria 4193
230 Ga0157376_10144818 3300014969 Bacteria 2136
231 Ga0163161_10018504 3300017792 Bacteria 4881
232 Ga0209257_1000064 3300025304 Bacteria 356803
233 Ga0207682_10023523 3300025893 Bacteria 2434
234 Ga0207710_10091705 3300025900 Bacteria 1422
235 Ga0207680_10000015 3300025903 Bacteria 138253
236 Ga0207647_10007990 3300025904 Bacteria 7606
237 Ga0207647_10042456 3300025904 Bacteria 2853
238 Ga0207645_10012784 3300025907 Bacteria 5687
239 Ga0207705_10011365 3300025909 Bacteria 6447
240 Ga0207705_10017370 3300025909 Bacteria 5153
241 Ga0207705_10174388 3300025909 Bacteria 1620
242 Ga0207654_10019538 3300025911 Bacteria 3577
243 Ga0207654_10034747 3300025911 Unclassified 2803
244 Ga0207654_10131394 3300025911 Bacteria 1585
245 Ga0207707_10055999 3300025912 Bacteria 3429
246 Ga0207707_10079218 3300025912 Bacteria 2869
247 Ga0207707_10170729 3300025912 Unclassified 1900
248 Ga0207695_10004747 3300025913 Bacteria 18391
249 Ga0207695_10005828 3300025913 Bacteria 16206
250 Ga0207695_10013243 3300025913 Bacteria 9841
251 Ga0207695_10041700 3300025913 Bacteria 4911
252 Ga0207695_10125741 3300025913 Bacteria 2526
253 Ga0207671_10007206 3300025914 Bacteria 9688
254 Ga0207671_10018867 3300025914 Bacteria 5286
255 Ga0207671_10029829 3300025914 Unclassified 4072
256 Ga0207671_10038127 3300025914 Bacteria 3562
257 Ga0207671_10101354 3300025914 Bacteria 2181
258 Ga0207660_10012120 3300025917 Bacteria 5635
259 Ga0207660_10116051 3300025917 Unclassified 2022
260 Ga0207657_10011382 3300025919 Bacteria 8836
261 Ga0207657_10028007 3300025919 Bacteria 5149
262 Ga0207657_10031731 3300025919 Bacteria 4781
263 Ga0207657_10061831 3300025919 Bacteria 3208
264 Ga0207652_10000057 3300025921 Bacteria 113664
265 Ga0207652_10000210 3300025921 Bacteria 61797
266 Ga0207652_10010171 3300025921 Bacteria 7573
267 Ga0207652_10031285 3300025921 Bacteria 4469
268 Ga0207652_10046207 3300025921 Bacteria 3714
269 Ga0207652_10050394 3300025921 Bacteria 3567
270 Ga0207694_10026813 3300025924 Bacteria 4387
271 Ga0207694_10062336 3300025924 Bacteria 2903
272 Ga0207650_10045458 3300025925 Bacteria 3230
273 Ga0207650_10049439 3300025925 Unclassified 3105
274 Ga0207690_10041535 3300025932 Bacteria 3015
275 Ga0207690_10050551 3300025932 Unclassified 2776
276 Ga0207706_10006567 3300025933 Bacteria 10770
277 Ga0207706_10017530 3300025933 Bacteria 6454
278 Ga0207706_10061738 3300025933 Unclassified 3300
279 Ga0207706_10102604 3300025933 Bacteria 2516
280 Ga0207686_10023549 3300025934 Unclassified 3558
281 Ga0207670_10006475 3300025936 Bacteria 6499
282 Ga0207669_10026363 3300025937 Bacteria 3160
283 Ga0207704_10174887 3300025938 Bacteria 1544
284 Ga0207704_10277737 3300025938 Unclassified 1272
285 Ga0207691_10022993 3300025940 Bacteria 5871
286 Ga0207689_10000795 3300025942 Bacteria 30379
287 Ga0207689_10003497 3300025942 Bacteria 14356
288 Ga0207689_10008027 3300025942 Bacteria 9211
289 Ga0207689_10010642 3300025942 Bacteria 7917
290 Ga0207661_10002533 3300025944 Bacteria 12572
291 Ga0207661_10038715 3300025944 Bacteria 3739
292 Ga0207661_10215591 3300025944 Bacteria 1694
293 Ga0207679_10001397 3300025945 Bacteria 15216
294 Ga0207679_10225161 3300025945 Bacteria 1580
295 Ga0207667_10008192 3300025949 Bacteria 12438
296 Ga0207667_10013853 3300025949 Bacteria 9211
297 Ga0207667_10016284 3300025949 Bacteria 8401
298 Ga0207667_10049050 3300025949 Bacteria 4462
299 Ga0207651_10022179 3300025960 Unclassified 3876
300 Ga0207712_10001318 3300025961 Bacteria 17023
301 Ga0207712_10036120 3300025961 Bacteria 3363
302 Ga0207712_10079088 3300025961 Bacteria 2388
303 Ga0207668_10012948 3300025972 Bacteria 5124
304 Ga0207668_10016625 3300025972 Bacteria 4595
305 Ga0207640_10056251 3300025981 Unclassified 2581
306 Ga0207640_10126222 3300025981 Bacteria 1842
307 Ga0207640_10151006 3300025981 Bacteria 1707
308 Ga0207640_10253802 3300025981 Unclassified 1366
309 Ga0207658_10013954 3300025986 Bacteria 5499
310 Ga0207658_10042725 3300025986 Unclassified 3290
311 Ga0207658_10045543 3300025986 Bacteria 3198
312 Ga0207658_10111409 3300025986 Bacteria 2164
313 Ga0207658_10160640 3300025986 Bacteria 1841
314 Ga0207658_10235270 3300025986 Bacteria 1548
315 Ga0207677_10002608 3300026023 Bacteria 9484
316 Ga0207677_10020606 3300026023 Bacteria 4007
317 Ga0207703_10029833 3300026035 Unclassified 4305
318 Ga0207703_10053688 3300026035 Bacteria 3276
319 Ga0207639_10150883 3300026041 Unclassified 1946
320 Ga0207639_10171698 3300026041 Unclassified 1837
321 Ga0207639_10209485 3300026041 Bacteria 1677
322 Ga0207678_10005531 3300026067 Bacteria 11289
323 Ga0207708_10018473 3300026075 Bacteria 5251
324 Ga0207702_10039973 3300026078 Bacteria 3932
325 Ga0207641_10000056 3300026088 Bacteria 170719
326 Ga0207641_10008719 3300026088 Bacteria 8377
327 Ga0207641_10027919 3300026088 Unclassified 4662
328 Ga0207648_10038000 3300026089 Bacteria 4237
329 Ga0207648_10056517 3300026089 Unclassified 3425
330 Ga0207648_10083248 3300026089 Bacteria 2791
331 Ga0207648_10108202 3300026089 Bacteria 2440
332 Ga0207648_10263528 3300026089 Bacteria 1538
333 Ga0207676_10008945 3300026095 Bacteria 7126
334 Ga0207676_10010372 3300026095 Bacteria 6634
335 Ga0207676_10028232 3300026095 Bacteria 4190
336 Ga0207676_10037692 3300026095 Bacteria 3686
337 Ga0207674_10001712 3300026116 Bacteria 28070
338 Ga0207674_10004448 3300026116 Bacteria 16847
339 Ga0207674_10028342 3300026116 Bacteria 5912
340 Ga0207675_100002556 3300026118 Bacteria 18017
341 Ga0207675_100019273 3300026118 Bacteria 6364
342 Ga0207683_10024788 3300026121 Bacteria 5168
343 Ga0207698_10002668 3300026142 Bacteria 10608
344 Ga0207698_10008454 3300026142 Bacteria 6515
345 Ga0207698_10010894 3300026142 Bacteria 5871
346 Ga0207698_10036730 3300026142 Unclassified 3600
347 Ga0207698_10073709 3300026142 Bacteria 2720
348 Ga0268266_10000022 3300028379 Bacteria 508060
349 Ga0268266_10318107 3300028379 Bacteria 1456
350 Ga0268265_10150768 3300028380 Bacteria 1961
351 Ga0268264_10001512 3300028381 Bacteria 21658
352 Ga0268264_10003067 3300028381 Bacteria 14469
353 Ga0268264_10032362 3300028381 Bacteria 4290
354 Ga0268264_10047212 3300028381 Unclassified 3580
355 Ga0307517_10069665 3300028786 Bacteria 3182
356 Ga0307515_10000001 3300028794 Bacteria 4259510
357 Ga0307515_10000684 3300028794 Bacteria 78055
358 Ga0307509_10046037 3300031507 Unclassified 4699
359 Ga0307509_10094004 3300031507 Bacteria 3058
360 Ga0307508_10001710 3300031616 Bacteria 24355
361 Ga0307508_10178311 3300031616 Bacteria 1728
362 Ga0316576_10059557 3300031727 Bacteria 2796
363 Ga0307516_10196424 3300031730 Unclassified 1740
364 Ga0307410_10099350 3300031852 Bacteria 2083
365 Ga0373956_0043658 3300035119 Bacteria 1997
366 Ga0373943_0198582 3300035170 Bacteria 1109
367 Ga0373955_0012736 3300035172 Bacteria 4051
368 Ga0316574_0071795 3300035398 Bacteria 2187
369 Ga0373924_0011747 3300035410 Unclassified 3258
370 Ga0373933_0008410 3300035724 Bacteria 5635
371 Ga0373937_0069223 3300036401 Unclassified 3253
372 Ga0395899_0013188 3300037312 Bacteria 6322
373 Ga0395899_0017388 3300037312 Bacteria 5477
374 Ga0395899_0138763 3300037312 Bacteria 1731
375 Ga0395900_0010519 3300037418 Bacteria 9464
376 Ga0395900_0026274 3300037418 Bacteria 5962
377 Ga0395900_0082332 3300037418 Bacteria 3306
378 Ga0395898_0001664 3300037466 Bacteria 29804
379 Ga0395898_0027448 3300037466 Bacteria 5714
380 Ga0395905_0011381 3300037471 Bacteria 8595
381 Ga0395905_0136638 3300037471 Bacteria 2307
382 Ga0395905_0139608 3300037471 Bacteria 2280
383 Ga0395901_0005252 3300038443 Bacteria 13079
384 Ga0439439_0007711 3300041406 Bacteria 2523
385 Ga0439431_0025411 3300041997 Bacteria 1446
386 Ga0439441_002959 3300042001 Bacteria 2449
387 Ga0439449_0017656 3300042007 Bacteria 2679
388 Ga0451577_0002869 3300042876 Bacteria 19808
389 Ga0466972_0020511 3300044658 Bacteria 3302
390 Ga0453684_0029937 3300044712 Bacteria 7709
391 Ga0466960_0044058 3300044901 Bacteria 2126
392 Ga0495638_0116581 3300046460 Bacteria 1582
393 Ga0495653_0102418 3300046463 Bacteria 2072
394 Ga0495618_0034037 3300046514 Unclassified 3194
395 Ga0495630_0072139 3300046517 Bacteria 2599
396 Ga0495648_0005439 3300046524 Bacteria 10573
397 Ga0495587_0032154 3300046536 Unclassified 3174
398 Ga0495622_0068692 3300046557 Bacteria 1637
399 Ga0495668_0000268 3300046616 Bacteria 73486
400 Ga0495634_0227636 3300046642 Bacteria 1148
401 Ga0495625_0026872 3300046660 Bacteria 4341
402 Ga0495613_0239198 3300046689 Bacteria 1270
403 Ga0495672_0048225 3300047320 Bacteria 2527
404 Ga0495687_004292 3300047443 Bacteria 9729
405 Ga0495684_0031357 3300047471 Bacteria 4081
406 Ga0496101_0003876 3300048904 Bacteria 9348
407 Ga0496102_0075872 3300048905 Unclassified 3091
408 Ga0496126_0004187 3300048929 Bacteria 17384
409 Ga0501298_013443 3300049521 Bacteria 1450
410 Ga0501299_006022 3300049522 Bacteria 1889
411 Ga0501032_0025981 3300049569 Bacteria 4033
412 Ga0501033_0045698 3300049570 Bacteria 3258
413 Ga0501033_0047950 3300049570 Bacteria 3175
414 Ga0501033_0107422 3300049570 Unclassified 2033
415 Ga0501034_0000002 3300049571 Bacteria 565510
416 Ga0501034_0006675 3300049571 Bacteria 12375
417 Ga0501034_0013795 3300049571 Bacteria 8315
418 Ga0501036_0002554 3300049572 Bacteria 14316
419 Ga0501036_0223995 3300049572 Bacteria 1579
420 Ga0501037_0024933 3300049573 Bacteria 4420
421 Ga0501038_0025195 3300049574 Bacteria 5303
422 Ga0501039_0042688 3300049575 Unclassified 3503
423 Ga0501043_0010490 3300049579 Bacteria 7255
424 Ga0501043_0013511 3300049579 Bacteria 6389
425 Ga0501047_0007092 3300049581 Bacteria 10523
426 Ga0501047_0033433 3300049581 Bacteria 4964
427 Ga0501047_0343944 3300049581 Unclassified 1329
428 Ga0501070_0007290 3300049586 Bacteria 9390
429 Ga0501070_0190208 3300049586 Unclassified 1687
430 Ga0501206_007663 3300049653 Bacteria 1418
431 Ga0501217_000068 3300049661 Bacteria 12339
432 Ga0501222_011302 3300049662 Bacteria 1178
433 Ga0501223_000404 3300049663 Bacteria 10565
434 Ga0501224_000500 3300049664 Unclassified 4748
435 Ga0501233_002457 3300049668 Bacteria 3270
436 Ga0501235_003100 3300049669 Unclassified 3581
437 Ga0501238_002530 3300049671 Bacteria 2191
438 Ga0501242_000455 3300049674 Unclassified 3568
439 Ga0501225_0001821 3300049705 Bacteria 6680
440 Ga0501245_000166 3300049708 Bacteria 7163
441 Ga0501080_0032729 3300049742 Bacteria 4850
442 Ga0501083_0012545 3300049744 Bacteria 5928
443 Ga0501241_000111 3300049758 Bacteria 17719
444 Ga0501035_0007189 3300049822 Bacteria 10419
445 Ga0501044_0039658 3300049823 Bacteria 4912
446 Ga0501044_0098369 3300049823 Bacteria 2946
447 nmdc:mga0k408_5519_c1 3300050493 Bacteria 6733
448 nmdc:mga05p37_3872_c1 3300050507 Bacteria 17505
449 nmdc:mga05p37_88667_c1 3300050507 Bacteria 3812
450 nmdc:mga09592_10490_c1 3300050508 Bacteria 7540
451 nmdc:mga09592_224264_c1 3300050508 Bacteria 1628
452 nmdc:mga09592_54370_c1 3300050508 Bacteria 3383
453 nmdc:mga0qj67_312251_c1 3300050509 Bacteria 1273
454 nmdc:mga0qj67_5037_c1 3300050509 Bacteria 9603
455 nmdc:mga06r32_121040_c1 3300050510 Bacteria 2582
456 nmdc:mga06r32_528437_c1 3300050510 Bacteria 1155
457 nmdc:mga08y16_21862_c1 3300050511 Bacteria 6750
458 nmdc:mga08y16_289016_c1 3300050511 Bacteria 1690
459 Ga0495619_0159350 3300053085 Bacteria 1558
460 Ga0500646_0026769 3300053090 Bacteria 1565
461 Ga0500562_000025 3300053108 Bacteria 105616
462 Ga0500568_0011758 3300053139 Bacteria 4045
463 Ga0500588_0004478 3300053146 Bacteria 3034
464 Ga0500622_0002705 3300053156 Bacteria 12550
465 Ga0500622_0005868 3300053156 Bacteria 7258
466 Ga0500645_005126 3300053730 Unclassified 4887
467 Ga0500661_003310 3300055283 Bacteria 3030
468 2929243583 2929239360 Bacteria 7745570
469 Ga0097621_100009542
470 MRS1b_contig_3312306
471 rootL2_10026242
472 rootL2_10258815
473 rootL2_10288036
474 rootH1_10016194
475 Ga0055531_10000076
476 Ga0065714_10098800
477 Ga0065704_10092826
478 Ga0065712_10090291
479 Ga0065707_10090440
480 Ga0070658_10004224
481 Ga0070658_10010879
482 Ga0070658_10018958
483 Ga0070658_10073192
484 Ga0070658_10088480
485 Ga0070658_10219480
486 Ga0070676_10007906
487 Ga0070676_10053776
488 Ga0070683_100002991
489 Ga0070690_100001960
490 Ga0070690_100083855
491 Ga0070670_100157851
492 Ga0068869_100033197
493 Ga0068869_100051559
494 Ga0068869_100090070
495 Ga0070666_10000038
496 Ga0070666_10047120
497 Ga0070680_100027257
498 Ga0070680_100174078
499 Ga0070682_100000005
500 Ga0070682_100009063
501 Ga0070682_100009901
502 Ga0068868_100013033
503 Ga0068868_100029098
504 Ga0068868_100098978
505 Ga0068868_100204336
506 Ga0070660_100005010
507 Ga0070660_100069826
508 Ga0070660_100159050
509 Ga0070660_100281667
510 Ga0070661_100123044
511 Ga0070668_100033120
512 Ga0070668_100108616
513 Ga0070669_100197313
514 Ga0070675_100059384
515 Ga0070671_100166003
516 Ga0070674_100012744
517 Ga0070673_100007802
518 Ga0070673_100038304
519 Ga0070673_100045663
520 Ga0070673_100177061
521 Ga0070688_100089582
522 Ga0070659_100017377
523 Ga0070659_100026705
524 Ga0070659_100051398
525 Ga0070667_100001526
526 Ga0070667_100050618
527 Ga0070667_100074981
528 Ga0070667_100078398
529 Ga0070678_100017339
530 Ga0070662_100016738
531 Ga0070662_100240393
532 Ga0070681_10033830
533 Ga0070681_10054755
534 Ga0070681_10137358
535 Ga0070681_10167321
536 Ga0068867_100014038
537 Ga0068867_100043547
538 Ga0068867_100216748
539 Ga0070698_100002644
540 Ga0070698_100003140
541 Ga0070698_100025402
542 Ga0070679_100001610
543 Ga0070679_100005255
544 Ga0070679_100046872
545 Ga0070684_100000097
546 Ga0070684_100145560
547 Ga0070684_100310085
548 Ga0068853_100017552
549 Ga0068853_100083215
550 Ga0068853_100100703
551 Ga0068853_100132809
552 Ga0068853_100167550
553 Ga0070672_100047957
554 Ga0070665_100091463
555 Ga0070665_100104479
556 Ga0068855_100062145
557 Ga0068855_100216448
558 Ga0068855_100237595
559 Ga0068855_100240868
560 Ga0068855_100304719
561 Ga0070664_100001366
562 Ga0068857_100003139
563 Ga0068857_100004934
564 Ga0068857_100175433
565 Ga0068854_100013151
566 Ga0068854_100116388
567 Ga0068854_100161619
568 Ga0068856_100021815
569 Ga0068856_100149965
570 Ga0068856_100258922
571 Ga0070702_100078480
572 Ga0068852_100009862
573 Ga0068852_100014489
574 Ga0068852_100056651
575 Ga0068852_100059761
576 Ga0068859_100000007
577 Ga0068859_100003007
578 Ga0068859_100056305
579 Ga0068859_100085391
580 Ga0068859_100352801
581 Ga0068859_100353845
582 Ga0068864_100008725
583 Ga0068864_100015093
584 Ga0068864_100024227
585 Ga0068861_100017009
586 Ga0068863_100011953
587 Ga0068863_100125301
588 Ga0068863_100176743
589 Ga0068860_100004369
590 Ga0068860_100006905
591 Ga0068860_100019108
592 Ga0068860_100151749
593 Ga0068862_100012344
594 Ga0068862_100341745
595 Ga0075366_10006805
596 Ga0075366_10026916
597 Ga0097621_100000118
598 Ga0097621_100002035
599 Ga0068871_100008142
600 Ga0068871_100112914
601 Ga0075428_100015617
602 Ga0075428_100158326
603 Ga0075430_100122337
604 Ga0075431_100013446
605 Ga0075431_100027219
606 Ga0075434_100141144
607 Ga0075429_100070203
608 Ga0075429_100236911
609 Ga0068865_100073113
610 Ga0068865_100083886
611 Ga0097620_100000007
612 Ga0097620_100003007
613 Ga0097620_100056297
614 Ga0097620_100085384
615 Ga0097620_100352775
616 Ga0097620_100353852
617 Ga0105240_10009165
618 Ga0105240_10017744
619 Ga0105240_10037355
620 Ga0105240_10051147
621 Ga0105240_10138628
622 Ga0105240_10266848
623 Ga0105240_10516717
624 Ga0111539_10029652
625 Ga0111539_10204553
626 Ga0105247_10000702
627 Ga0114129_10005818
628 Ga0114129_10018475
629 Ga0114129_10199044
630 Ga0105241_10000104
631 Ga0105241_10007003
632 Ga0105241_10060440
633 Ga0105241_10090037
634 Ga0105248_10013248
635 Ga0105237_10002631
636 Ga0105237_10014452
637 Ga0105237_10032624
638 Ga0105237_10237783
639 Ga0105238_10018596
640 Ga0105238_10021216
641 Ga0105238_10090490
642 Ga0105249_10001119
643 Ga0105249_10003042
644 Ga0105249_10012567
645 Ga0105249_10190518
646 Ga0105249_10258427
647 Ga0105239_10006591
648 Ga0105239_10023009
649 Ga0105239_10202240
650 Ga0105239_10246306
651 Ga0157373_10006378
652 Ga0157373_10011288
653 Ga0157373_10042596
654 Ga0157371_10000420
655 Ga0157371_10006644
656 Ga0157371_10058828
657 Ga0157371_10123945
658 Ga0157370_10004098
659 Ga0157370_10028655
660 Ga0157370_10032883
661 Ga0157369_10014809
662 Ga0157369_10192013
663 Ga0157374_10000336
664 Ga0157374_10004823
665 Ga0157374_10042721
666 Ga0157374_10129416
667 Ga0157378_10003328
668 Ga0157378_10031080
669 Ga0157378_10049398
670 Ga0157378_10079357
671 Ga0157378_10084455
672 Ga0157378_10145577
673 Ga0163162_10000086
674 Ga0163162_10000970
675 Ga0163162_10025527
676 Ga0163162_10027924
677 Ga0163162_10113013
678 Ga0163162_10141948
679 Ga0163162_10156590
680 Ga0157372_10017153
681 Ga0157372_10052558
682 Ga0157372_10090254
683 Ga0157372_10107988
684 Ga0157372_10162975
685 Ga0157372_10332620
686 Ga0157375_10000115
687 Ga0157375_10071957
688 Ga0157375_10165154
689 Ga0157375_10329919
690 Ga0157380_10123906
691 Ga0157380_10186858
692 Ga0157377_10002032
693 Ga0157377_10030867
694 Ga0157377_10044329
695 Ga0157379_10036442
696 Ga0157376_10000467
697 Ga0157376_10032450
698 Ga0157376_10144818
699 Ga0163161_10018504
700 Ga0209257_1000064
701 Ga0207682_10023523
702 Ga0207710_10091705
703 Ga0207680_10000015
704 Ga0207647_10007990
705 Ga0207647_10042456
706 Ga0207645_10012784
707 Ga0207705_10011365
708 Ga0207705_10017370
709 Ga0207705_10174388
710 Ga0207654_10019538
711 Ga0207654_10034747
712 Ga0207654_10131394
713 Ga0207707_10055999
714 Ga0207707_10079218
715 Ga0207707_10170729
716 Ga0207695_10004747
717 Ga0207695_10005828
718 Ga0207695_10013243
719 Ga0207695_10041700
720 Ga0207695_10125741
721 Ga0207671_10007206
722 Ga0207671_10018867
723 Ga0207671_10029829
724 Ga0207671_10038127
725 Ga0207671_10101354
726 Ga0207660_10012120
727 Ga0207660_10116051
728 Ga0207657_10011382
729 Ga0207657_10028007
730 Ga0207657_10031731
731 Ga0207657_10061831
732 Ga0207652_10000057
733 Ga0207652_10000210
734 Ga0207652_10010171
735 Ga0207652_10031285
736 Ga0207652_10046207
737 Ga0207652_10050394
738 Ga0207694_10026813
739 Ga0207694_10062336
740 Ga0207650_10045458
741 Ga0207650_10049439
742 Ga0207690_10041535
743 Ga0207690_10050551
744 Ga0207706_10006567
745 Ga0207706_10017530
746 Ga0207706_10061738
747 Ga0207706_10102604
748 Ga0207686_10023549
749 Ga0207670_10006475
750 Ga0207669_10026363
751 Ga0207704_10174887
752 Ga0207704_10277737
753 Ga0207691_10022993
754 Ga0207689_10000795
755 Ga0207689_10003497
756 Ga0207689_10008027
757 Ga0207689_10010642
758 Ga0207661_10002533
759 Ga0207661_10038715
760 Ga0207661_10215591
761 Ga0207679_10001397
762 Ga0207679_10225161
763 Ga0207667_10008192
764 Ga0207667_10013853
765 Ga0207667_10016284
766 Ga0207667_10049050
767 Ga0207651_10022179
768 Ga0207712_10001318
769 Ga0207712_10036120
770 Ga0207712_10079088
771 Ga0207668_10012948
772 Ga0207668_10016625
773 Ga0207640_10056251
774 Ga0207640_10126222
775 Ga0207640_10151006
776 Ga0207640_10253802
777 Ga0207658_10013954
778 Ga0207658_10042725
779 Ga0207658_10045543
780 Ga0207658_10111409
781 Ga0207658_10160640
782 Ga0207658_10235270
783 Ga0207677_10002608
784 Ga0207677_10020606
785 Ga0207703_10029833
786 Ga0207703_10053688
787 Ga0207639_10150883
788 Ga0207639_10171698
789 Ga0207639_10209485
790 Ga0207678_10005531
791 Ga0207708_10018473
792 Ga0207702_10039973
793 Ga0207641_10000056
794 Ga0207641_10008719
795 Ga0207641_10027919
796 Ga0207648_10038000
797 Ga0207648_10056517
798 Ga0207648_10083248
799 Ga0207648_10108202
800 Ga0207648_10263528
801 Ga0207676_10008945
802 Ga0207676_10010372
803 Ga0207676_10028232
804 Ga0207676_10037692
805 Ga0207674_10001712
806 Ga0207674_10004448
807 Ga0207674_10028342
808 Ga0207675_100002556
809 Ga0207675_100019273
810 Ga0207683_10024788
811 Ga0207698_10002668
812 Ga0207698_10008454
813 Ga0207698_10010894
814 Ga0207698_10036730
815 Ga0207698_10073709
816 Ga0268266_10000022
817 Ga0268266_10318107
818 Ga0268265_10150768
819 Ga0268264_10001512
820 Ga0268264_10003067
821 Ga0268264_10032362
822 Ga0268264_10047212
823 Ga0307517_10069665
824 Ga0307515_10000001
825 Ga0307515_10000684
826 Ga0307509_10046037
827 Ga0307509_10094004
828 Ga0307508_10001710
829 Ga0307508_10178311
830 Ga0316576_10059557
831 Ga0307516_10196424
832 Ga0307410_10099350
833 Ga0373956_0043658
834 Ga0373943_0198582
835 Ga0373955_0012736
836 Ga0316574_0071795
837 Ga0373924_0011747
838 Ga0373933_0008410
839 Ga0373937_0069223
840 Ga0395899_0013188
841 Ga0395899_0017388
842 Ga0395899_0138763
843 Ga0395900_0010519
844 Ga0395900_0026274
845 Ga0395900_0082332
846 Ga0395898_0001664
847 Ga0395898_0027448
848 Ga0395905_0011381
849 Ga0395905_0136638
850 Ga0395905_0139608
851 Ga0395901_0005252
852 Ga0439439_0007711
853 Ga0439431_0025411
854 Ga0439441_002959
855 Ga0439449_0017656
856 Ga0451577_0002869
857 Ga0466972_0020511
858 Ga0453684_0029937
859 Ga0466960_0044058
860 Ga0495638_0116581
861 Ga0495653_0102418
862 Ga0495618_0034037
863 Ga0495630_0072139
864 Ga0495648_0005439
865 Ga0495587_0032154
866 Ga0495622_0068692
867 Ga0495668_0000268
868 Ga0495634_0227636
869 Ga0495625_0026872
870 Ga0495613_0239198
871 Ga0495672_0048225
872 Ga0495687_004292
873 Ga0495684_0031357
874 Ga0496101_0003876
875 Ga0496102_0075872
876 Ga0496126_0004187
877 Ga0501298_013443
878 Ga0501299_006022
879 Ga0501032_0025981
880 Ga0501033_0045698
881 Ga0501033_0047950
882 Ga0501033_0107422
883 Ga0501034_0000002
884 Ga0501034_0006675
885 Ga0501034_0013795
886 Ga0501036_0002554
887 Ga0501036_0223995
888 Ga0501037_0024933
889 Ga0501038_0025195
890 Ga0501039_0042688
891 Ga0501043_0010490
892 Ga0501043_0013511
893 Ga0501047_0007092
894 Ga0501047_0033433
895 Ga0501047_0343944
896 Ga0501070_0007290
897 Ga0501070_0190208
898 Ga0501206_007663
899 Ga0501217_000068
900 Ga0501222_011302
901 Ga0501223_000404
902 Ga0501224_000500
903 Ga0501233_002457
904 Ga0501235_003100
905 Ga0501238_002530
906 Ga0501242_000455
907 Ga0501225_0001821
908 Ga0501245_000166
909 Ga0501080_0032729
910 Ga0501083_0012545
911 Ga0501241_000111
912 Ga0501035_0007189
913 Ga0501044_0039658
914 Ga0501044_0098369
915 nmdc:mga0k408_5519_c1
916 nmdc:mga05p37_3872_c1
917 nmdc:mga05p37_88667_c1
918 nmdc:mga09592_10490_c1
919 nmdc:mga09592_224264_c1
920 nmdc:mga09592_54370_c1
921 nmdc:mga0qj67_312251_c1
922 nmdc:mga0qj67_5037_c1
923 nmdc:mga06r32_121040_c1
924 nmdc:mga06r32_528437_c1
925 nmdc:mga08y16_21862_c1
926 nmdc:mga08y16_289016_c1
927 Ga0495619_0159350
928 Ga0500646_0026769
929 Ga0500562_000025
930 Ga0500568_0011758
931 Ga0500588_0004478
932 Ga0500622_0002705
933 Ga0500622_0005868
934 Ga0500645_005126
935 Ga0500661_003310
936 2929243583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19572

PorV

Type IX secretion system protein PorV

62

293

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h3i-assembly1.cif.gz_F structural snapshots of the type 9 protein translocon 0.8909 31 391
6h3i-assembly1.cif.gz_F structural snapshots of the type 9 protein translocon 0.8809 31 391
2wvp-assembly1.cif.gz_A synthetically modified ompg 0.6898 79 382
2wvp-assembly1.cif.gz_A synthetically modified ompg 0.6623 79 382
4fqe-assembly1.cif.gz_A kdgm porin 0.6473 80 384
ID Description Score Start End Superfamily
2wvpA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6898 79 382 2.40.160.40
2wvpA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6623 79 382 2.40.160.40
af_Q5AMP9_96_290_3.90.1150.210 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.6595 114 202 3.90.1150.210
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6473 80 384 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6375 80 384 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A2M7NZR3-F1-model_v4 Type IX secretion system protein PorV domain-containing protein 0.9181 31 384 GO:0016020
AF-A0A3D2P5M1-F1-model_v4 PorV/PorQ family protein 0.9104 61 384
AF-A0A1Q6FZ02-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9085 55 384
AF-A0A2G6BUP0-F1-model_v4 PorV/PorQ family protein 0.901 40 384
AF-A0A3D5H915-F1-model_v4 PorV/PorQ family protein 0.898 39 217

Map