F450031

General Info

Members Datasets Scaffolds Average Seq Length
468 235 468 324

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10038141|Ga0105248_100381413
Length 339
Sequence VVVLVTGATGFTGGHLARTLAARGHHVRALVRDRRGPDADRSIASSNPELDDVSNSQPIESVTGDLRDAAAVGRALQGVEVVYNIAAVYRQAGLPTETYRAVNALAVGDLVEQAARAGVRRVVHCSTVGVHGDVEHPPADEDAPLRPGDVYQRTKIEGEELARAAAARFGVEVTIARPSGIYGPRDRRLLKLFRNTVRRFPTLGRGDIYYHLTYIDDLVEGFRLCGEHPAAANRTYILAGPQVTRLNDVTAAIADIAGVPPQRWHLPVWPFWLAGAACEAVCAPLGVEPPIFRRRVDFFTKSRAFDITRARTEIGYAPSIGLREGVTRTLHWYREHGWL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
153 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
154 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
159 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
160 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 2.78
Rhizosphere 93.16
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10045958 3300005327 Bacteria 3533
2 Ga0070676_10033959 3300005328 Bacteria 2927
3 Ga0070683_100163156 3300005329 Bacteria 2114
4 Ga0070690_100199281 3300005330 Bacteria 1392
5 Ga0070670_100012446 3300005331 Bacteria 7281
6 Ga0070670_100064103 3300005331 Bacteria 3153
7 Ga0070670_100180755 3300005331 Bacteria 1831
8 Ga0070670_100212058 3300005331 Bacteria 1684
9 Ga0070677_10021044 3300005333 Unclassified 2387
10 Ga0068869_100148837 3300005334 Unclassified 1814
11 Ga0070680_100020787 3300005336 Bacteria 5208
12 Ga0070680_100039705 3300005336 Bacteria 3807
13 Ga0070680_100116958 3300005336 Bacteria 2223
14 Ga0068868_100132169 3300005338 Bacteria 2043
15 Ga0068868_100185058 3300005338 Unclassified 1730
16 Ga0068868_100258141 3300005338 Unclassified 1469
17 Ga0070689_100045359 3300005340 Unclassified 3385
18 Ga0070687_100047427 3300005343 Bacteria 2204
19 Ga0070661_100295247 3300005344 Unclassified 1260
20 Ga0070668_100006466 3300005347 Bacteria 8688
21 Ga0070668_100274683 3300005347 Bacteria 1406
22 Ga0070669_100012602 3300005353 Bacteria 5999
23 Ga0070669_100104682 3300005353 Bacteria 2139
24 Ga0070675_100018823 3300005354 Bacteria 5498
25 Ga0070675_100022500 3300005354 Bacteria 5037
26 Ga0070671_100091001 3300005355 Bacteria 2554
27 Ga0070671_100147941 3300005355 Bacteria 1983
28 Ga0070674_100005716 3300005356 Bacteria 7212
29 Ga0070674_100009206 3300005356 Bacteria 5908
30 Ga0070674_100107178 3300005356 Bacteria 2046
31 Ga0070673_100000364 3300005364 Bacteria 23738
32 Ga0070673_100229164 3300005364 Bacteria 1611
33 Ga0070688_100088325 3300005365 Bacteria 2021
34 Ga0070659_100232062 3300005366 Unclassified 1525
35 Ga0070659_100338725 3300005366 Bacteria 1260
36 Ga0070709_10168600 3300005434 Bacteria 1528
37 Ga0070714_100125955 3300005435 Bacteria 2284
38 Ga0070714_100238744 3300005435 Bacteria 1677
39 Ga0070713_100066442 3300005436 Unclassified 3033
40 Ga0070700_100008186 3300005441 Bacteria 5692
41 Ga0070708_100032869 3300005445 Bacteria 4503
42 Ga0070663_100194972 3300005455 Bacteria 1578
43 Ga0070663_100208041 3300005455 Bacteria 1531
44 Ga0070678_100013004 3300005456 Bacteria 5198
45 Ga0070662_100317675 3300005457 Bacteria 1269
46 Ga0070681_10045461 3300005458 Bacteria 4392
47 Ga0070681_10079771 3300005458 Bacteria 3229
48 Ga0070681_10281795 3300005458 Bacteria 1572
49 Ga0068867_100127989 3300005459 Bacteria 1970
50 Ga0070707_100054869 3300005468 Bacteria 3821
51 Ga0070707_100144685 3300005468 Unclassified 2314
52 Ga0070698_100063281 3300005471 Bacteria 3731
53 Ga0070698_100341759 3300005471 Bacteria 1428
54 Ga0070699_100002365 3300005518 Bacteria 16923
55 Ga0070699_100006877 3300005518 Bacteria 9894
56 Ga0070679_100017472 3300005530 Bacteria 6943
57 Ga0070679_100035234 3300005530 Bacteria 4965
58 Ga0070679_100114398 3300005530 Bacteria 2683
59 Ga0070684_100089041 3300005535 Bacteria 2743
60 Ga0068853_100032033 3300005539 Bacteria 4451
61 Ga0068853_100225188 3300005539 Unclassified 1714
62 Ga0070686_100003397 3300005544 Bacteria 8730
63 Ga0070695_100004825 3300005545 Bacteria 7935
64 Ga0070696_100140962 3300005546 Unclassified 1762
65 Ga0070704_100016780 3300005549 Unclassified 4637
66 Ga0068855_100110549 3300005563 Bacteria 3155
67 Ga0068855_100126106 3300005563 Unclassified 2927
68 Ga0068855_100548972 3300005563 Unclassified 1251
69 Ga0068857_100012955 3300005577 Bacteria 7268
70 Ga0068854_100164955 3300005578 Bacteria 1719
71 Ga0068856_100086677 3300005614 Unclassified 3112
72 Ga0070702_100264217 3300005615 Bacteria 1173
73 Ga0068852_100014753 3300005616 Bacteria 6031
74 Ga0068852_100112946 3300005616 Bacteria 2473
75 Ga0068859_100053090 3300005617 Unclassified 4075
76 Ga0068859_100171905 3300005617 Unclassified 2248
77 Ga0068859_100219271 3300005617 Unclassified 1990
78 Ga0068864_100012773 3300005618 Bacteria 6942
79 Ga0068866_10002163 3300005718 Bacteria 8179
80 Ga0068861_100075513 3300005719 Bacteria 2624
81 Ga0068861_100265471 3300005719 Bacteria 1471
82 Ga0068863_100226041 3300005841 Bacteria 1804
83 Ga0068858_100042970 3300005842 Bacteria 4191
84 Ga0068858_100190946 3300005842 Unclassified 1936
85 Ga0068862_100043541 3300005844 Bacteria 3828
86 Ga0070717_10259327 3300006028 Bacteria 1538
87 Ga0075364_10008709 3300006051 Bacteria 6069
88 Ga0075362_10005347 3300006177 Bacteria 4692
89 Ga0075367_10051224 3300006178 Bacteria 2440
90 Ga0075367_10072703 3300006178 Bacteria 2071
91 Ga0075366_10010882 3300006195 Bacteria 5118
92 Ga0075366_10017584 3300006195 Unclassified 4117
93 Ga0097621_100030731 3300006237 Bacteria 4255
94 Ga0097621_100218189 3300006237 Bacteria 1661
95 Ga0075428_100000010 3300006844 Bacteria 213631
96 Ga0075428_100005848 3300006844 Bacteria 13665
97 Ga0075428_100017492 3300006844 Bacteria 7920
98 Ga0075428_100027805 3300006844 Bacteria 6257
99 Ga0075428_100149848 3300006844 Unclassified 2534
100 Ga0075430_100006615 3300006846 Bacteria 9768
101 Ga0075430_100007270 3300006846 Bacteria 9350
102 Ga0075430_100019004 3300006846 Bacteria 5846
103 Ga0075431_100024135 3300006847 Bacteria 6226
104 Ga0075431_100033593 3300006847 Bacteria 5286
105 Ga0075431_100086176 3300006847 Bacteria 3241
106 Ga0075431_100104108 3300006847 Unclassified 2929
107 Ga0075431_100184829 3300006847 Unclassified 2138
108 Ga0075431_100312565 3300006847 Unclassified 1586
109 Ga0075431_100476101 3300006847 Bacteria 1242
110 Ga0075433_10007642 3300006852 Bacteria 8585
111 Ga0075433_10013631 3300006852 Bacteria 6617
112 Ga0075433_10026199 3300006852 Bacteria 4934
113 Ga0075433_10308285 3300006852 Bacteria 1401
114 Ga0075434_100002153 3300006871 Bacteria 17151
115 Ga0075434_100054041 3300006871 Bacteria 3990
116 Ga0075434_100109666 3300006871 Bacteria 2770
117 Ga0075429_100001697 3300006880 Bacteria 18198
118 Ga0075429_100082922 3300006880 Bacteria 2795
119 Ga0075429_100096000 3300006880 Bacteria 2586
120 Ga0075436_100022198 3300006914 Bacteria 4359
121 Ga0075436_100082361 3300006914 Bacteria 2232
122 Ga0075436_100097479 3300006914 Unclassified 2045
123 Ga0097620_100053088 3300006931 Unclassified 4075
124 Ga0097620_100171914 3300006931 Unclassified 2248
125 Ga0097620_100219267 3300006931 Unclassified 1990
126 Ga0075435_100001847 3300007076 Bacteria 13744
127 Ga0075435_100003420 3300007076 Bacteria 10764
128 Ga0075435_100003471 3300007076 Bacteria 10690
129 Ga0075435_100009122 3300007076 Bacteria 7161
130 Ga0075435_100118979 3300007076 Unclassified 2203
131 Ga0105240_10049469 3300009093 Bacteria 5305
132 Ga0105240_10110142 3300009093 Bacteria 3333
133 Ga0111539_10000001 3300009094 Bacteria 1035431
134 Ga0111539_10000740 3300009094 Bacteria 42401
135 Ga0111539_10016952 3300009094 Bacteria 9017
136 Ga0111539_10018031 3300009094 Bacteria 8744
137 Ga0111539_10133827 3300009094 Bacteria 2903
138 Ga0111539_10347769 3300009094 Bacteria 1726
139 Ga0114129_10000186 3300009147 Bacteria 69381
140 Ga0114129_10001901 3300009147 Bacteria 28450
141 Ga0114129_10002876 3300009147 Bacteria 24089
142 Ga0114129_10005014 3300009147 Bacteria 18631
143 Ga0114129_10011063 3300009147 Bacteria 12855
144 Ga0114129_10015389 3300009147 Bacteria 10885
145 Ga0114129_10016555 3300009147 Bacteria 10499
146 Ga0114129_10041815 3300009147 Bacteria 6453
147 Ga0114129_10045272 3300009147 Bacteria 6186
148 Ga0114129_10061709 3300009147 Bacteria 5239
149 Ga0114129_10077937 3300009147 Bacteria 4609
150 Ga0114129_10081377 3300009147 Bacteria 4501
151 Ga0114129_10166295 3300009147 Bacteria 3010
152 Ga0114129_10246699 3300009147 Bacteria 2399
153 Ga0114129_10285710 3300009147 Bacteria 2203
154 Ga0114129_10393487 3300009147 Unclassified 1827
155 Ga0114129_10507127 3300009147 Bacteria 1575
156 Ga0105242_10026762 3300009176 Bacteria 4573
157 Ga0105242_10070801 3300009176 Unclassified 2892
158 Ga0105242_10357975 3300009176 Bacteria 1350
159 Ga0105248_10012674 3300009177 Bacteria 9303
160 Ga0105248_10037164 3300009177 Bacteria 5446
161 Ga0105248_10038141 3300009177 Bacteria 5376
162 Ga0105248_10039235 3300009177 Bacteria 5303
163 Ga0105248_10097853 3300009177 Bacteria 3306
164 Ga0105248_10119226 3300009177 Bacteria 2976
165 Ga0105248_10197941 3300009177 Bacteria 2264
166 Ga0105248_10240651 3300009177 Bacteria 2037
167 Ga0105248_10793578 3300009177 Bacteria 1069
168 Ga0105238_10152609 3300009551 Bacteria 2285
169 Ga0105249_10000180 3300009553 Bacteria 74064
170 Ga0105249_10213806 3300009553 Unclassified 1894
171 Ga0105239_10407242 3300010375 Bacteria 1540
172 Ga0105239_10519345 3300010375 Unclassified 1355
173 Ga0157370_10016812 3300013104 Bacteria 7395
174 Ga0157369_10050848 3300013105 Bacteria 4486
175 Ga0157374_10050191 3300013296 Bacteria 3878
176 Ga0157372_10039711 3300013307 Bacteria 5195
177 Ga0157372_10163827 3300013307 Bacteria 2570
178 Ga0163163_10122097 3300014325 Bacteria 2639
179 Ga0163163_10134792 3300014325 Bacteria 2510
180 Ga0157380_10020295 3300014326 Bacteria 4965
181 Ga0182008_10007127 3300014497 Bacteria 6191
182 Ga0157379_10133360 3300014968 Bacteria 2237
183 Ga0157376_10097229 3300014969 Bacteria 2564
184 Ga0157376_10108041 3300014969 Bacteria 2443
185 Ga0163161_10104789 3300017792 Bacteria 2109
186 Ga0207697_10004761 3300025315 Bacteria 6420
187 Ga0207682_10066027 3300025893 Bacteria 1524
188 Ga0207688_10106301 3300025901 Unclassified 1625
189 Ga0207699_10256131 3300025906 Bacteria 1208
190 Ga0207645_10018483 3300025907 Bacteria 4585
191 Ga0207707_10001197 3300025912 Bacteria 24415
192 Ga0207707_10025762 3300025912 Bacteria 5143
193 Ga0207707_10026581 3300025912 Bacteria 5058
194 Ga0207707_10067522 3300025912 Unclassified 3115
195 Ga0207707_10110672 3300025912 Bacteria 2401
196 Ga0207660_10134685 3300025917 Unclassified 1884
197 Ga0207662_10005644 3300025918 Bacteria 6690
198 Ga0207662_10059744 3300025918 Bacteria 2285
199 Ga0207657_10008607 3300025919 Bacteria 10331
200 Ga0207657_10139619 3300025919 Bacteria 1980
201 Ga0207649_10216311 3300025920 Unclassified 1362
202 Ga0207652_10005510 3300025921 Bacteria 10269
203 Ga0207652_10047117 3300025921 Bacteria 3681
204 Ga0207646_10058487 3300025922 Bacteria 3443
205 Ga0207681_10020723 3300025923 Bacteria 4171
206 Ga0207681_10020728 3300025923 Bacteria 4170
207 Ga0207681_10147575 3300025923 Unclassified 1759
208 Ga0207694_10015340 3300025924 Bacteria 5781
209 Ga0207650_10006334 3300025925 Bacteria 8065
210 Ga0207650_10034957 3300025925 Bacteria 3646
211 Ga0207650_10077608 3300025925 Bacteria 2511
212 Ga0207659_10113501 3300025926 Bacteria 2064
213 Ga0207659_10179399 3300025926 Unclassified 1677
214 Ga0207687_10069947 3300025927 Bacteria 2504
215 Ga0207664_10118792 3300025929 Bacteria 2209
216 Ga0207664_10161072 3300025929 Bacteria 1914
217 Ga0207664_10254574 3300025929 Bacteria 1533
218 Ga0207644_10062463 3300025931 Bacteria 2702
219 Ga0207706_10024368 3300025933 Bacteria 5425
220 Ga0207706_10147384 3300025933 Bacteria 2070
221 Ga0207686_10102283 3300025934 Bacteria 1915
222 Ga0207669_10003027 3300025937 Bacteria 7236
223 Ga0207669_10132653 3300025937 Bacteria 1715
224 Ga0207691_10011607 3300025940 Bacteria 8456
225 Ga0207691_10157129 3300025940 Bacteria 1996
226 Ga0207711_10010730 3300025941 Bacteria 7620
227 Ga0207711_10035585 3300025941 Bacteria 4222
228 Ga0207711_10350226 3300025941 Bacteria 1367
229 Ga0207711_10358082 3300025941 Bacteria 1351
230 Ga0207661_10176850 3300025944 Bacteria 1861
231 Ga0207661_10319225 3300025944 Unclassified 1396
232 Ga0207667_10266700 3300025949 Bacteria 1751
233 Ga0207667_10325640 3300025949 Bacteria 1569
234 Ga0207667_10524856 3300025949 Unclassified 1199
235 Ga0207651_10016602 3300025960 Bacteria 4319
236 Ga0207712_10000391 3300025961 Bacteria 38113
237 Ga0207668_10026640 3300025972 Bacteria 3756
238 Ga0207668_10058711 3300025972 Bacteria 2691
239 Ga0207668_10080832 3300025972 Bacteria 2356
240 Ga0207677_10080150 3300026023 Bacteria 2338
241 Ga0207677_10203039 3300026023 Unclassified 1577
242 Ga0207703_10158898 3300026035 Unclassified 1978
243 Ga0207639_10033552 3300026041 Bacteria 3788
244 Ga0207639_10095365 3300026041 Bacteria 2391
245 Ga0207678_10073653 3300026067 Bacteria 2927
246 Ga0207708_10008855 3300026075 Bacteria 7450
247 Ga0207708_10143038 3300026075 Bacteria 1878
248 Ga0207702_10133036 3300026078 Unclassified 2240
249 Ga0207648_10113819 3300026089 Bacteria 2376
250 Ga0207648_10177926 3300026089 Bacteria 1882
251 Ga0207676_10109984 3300026095 Bacteria 2304
252 Ga0207676_10282327 3300026095 Unclassified 1508
253 Ga0207674_10019855 3300026116 Bacteria 7271
254 Ga0207675_100071576 3300026118 Bacteria 3242
255 Ga0207675_100086342 3300026118 Bacteria 2946
256 Ga0207675_100155857 3300026118 Bacteria 2176
257 Ga0207683_10193248 3300026121 Unclassified 1848
258 Ga0207683_10425180 3300026121 Unclassified 1224
259 Ga0207428_10000002 3300027907 Bacteria 854851
260 Ga0268265_10021748 3300028380 Bacteria 4498
261 Ga0268265_10044716 3300028380 Bacteria 3299
262 Ga0268264_10343281 3300028381 Unclassified 1419
263 Ga0307408_100053992 3300031548 Unclassified 2904
264 Ga0307408_100096187 3300031548 Bacteria 2246
265 Ga0307408_100119209 3300031548 Unclassified 2041
266 Ga0316576_10055104 3300031727 Bacteria 2901
267 Ga0307405_10262025 3300031731 Archaea 1292
268 Ga0307407_10071003 3300031903 Bacteria 2072
269 Ga0307416_100102635 3300032002 Unclassified 2494
270 Ga0307416_100132389 3300032002 Bacteria 2248
271 Ga0307416_100151667 3300032002 Bacteria 2126
272 Ga0307416_100268134 3300032002 Bacteria 1674
273 Ga0307416_100309139 3300032002 Unclassified 1576
274 Ga0307414_10315210 3300032004 Bacteria 1329
275 Ga0307411_10033774 3300032005 Bacteria 3176
276 Ga0307411_10063641 3300032005 Bacteria 2466
277 Ga0307411_10246828 3300032005 Archaea 1401
278 Ga0307411_10303673 3300032005 Bacteria 1281
279 Ga0373930_0014627 3300034816 Unclassified 1464
280 Ga0373958_0001973 3300034819 Unclassified 2824
281 Ga0373929_0002955 3300035085 Bacteria 3095
282 Ga0373940_0017366 3300035088 Bacteria 1793
283 Ga0373949_0002450 3300035090 Bacteria 4762
284 Ga0373952_0002536 3300035092 Bacteria 3288
285 Ga0373941_0003558 3300035115 Unclassified 3541
286 Ga0373960_0064791 3300035121 Unclassified 1116
287 Ga0373942_0001577 3300035207 Bacteria 5851
288 Ga0373961_0002480 3300035241 Bacteria 4772
289 Ga0373962_0001413 3300035242 Bacteria 5669
290 Ga0373935_0299968 3300035692 Bacteria 1135
291 Ga0373937_0002111 3300036401 Bacteria 16623
292 Ga0373937_0173019 3300036401 Unclassified 2026
293 Ga0373925_0006423 3300037068 Bacteria 8650
294 Ga0395901_0384500 3300038443 Unclassified 1444
295 Ga0400490_24668 3300038726 Bacteria 15912
296 Ga0400490_33866 3300038726 Bacteria 4727
297 Ga0400488_49291 3300038741 Unclassified 4078
298 Ga0400489_93634 3300039093 Bacteria 5702
299 Ga0451802_1909252 3300041460 Bacteria 1279
300 Ga0451853_2472702 3300041512 Bacteria 1528
301 Ga0439449_0048723 3300042007 Unclassified 1568
302 Ga0450923_006257 3300042125 Bacteria 1964
303 Ga0450894_000870 3300042131 Bacteria 4824
304 Ga0450896_000612 3300042133 Bacteria 3879
305 Ga0439446_0032666 3300042156 Bacteria 1510
306 Ga0450908_017169 3300042184 Bacteria 1286
307 Ga0439464_0008661 3300042439 Unclassified 2666
308 Ga0450918_007760 3300042531 Bacteria 1892
309 Ga0451577_0007418 3300042876 Bacteria 10772
310 Ga0439440_0009888 3300042993 Unclassified 1983
311 Ga0451576_0043352 3300045051 Bacteria 4748
312 Ga0451576_0155586 3300045051 Unclassified 2385
313 Ga0451576_0767568 3300045051 Unclassified 1013
314 Ga0466967_0294065 3300045976 Unclassified 1561
315 Ga0495603_0129308 3300046455 Bacteria 1471
316 Ga0495582_0121619 3300046473 Bacteria 1471
317 Ga0495618_0143215 3300046514 Unclassified 1529
318 Ga0495628_0060447 3300046516 Unclassified 2973
319 Ga0495630_0142479 3300046517 Bacteria 1823
320 Ga0495640_0158572 3300046533 Unclassified 1451
321 Ga0495647_0117793 3300046681 Unclassified 1114
322 Ga0495613_0168429 3300046689 Unclassified 1556
323 Ga0495674_0146146 3300047319 Bacteria 1985
324 Ga0495676_0217108 3300047321 Unclassified 1320
325 Ga0496101_0026680 3300048904 Bacteria 4018
326 Ga0496102_0241308 3300048905 Bacteria 1704
327 Ga0496105_0057397 3300048908 Bacteria 3215
328 Ga0496105_0167883 3300048908 Bacteria 1800
329 Ga0496106_0258485 3300048909 Bacteria 1393
330 Ga0496108_0179888 3300048911 Bacteria 1831
331 Ga0496109_0269829 3300048912 Bacteria 1603
332 Ga0496110_0070899 3300048913 Bacteria 3089
333 Ga0496113_0320698 3300048916 Unclassified 1242
334 Ga0496114_0010933 3300048917 Bacteria 7235
335 Ga0496114_0015050 3300048917 Bacteria 6219
336 Ga0496114_0386704 3300048917 Bacteria 1239
337 Ga0501031_0089169 3300049568 Unclassified 2011
338 Ga0501034_0008525 3300049571 Bacteria 10818
339 Ga0501036_0053098 3300049572 Bacteria 3433
340 Ga0501036_0122610 3300049572 Bacteria 2195
341 Ga0501036_0134431 3300049572 Unclassified 2087
342 Ga0501038_0034649 3300049574 Unclassified 4438
343 Ga0501038_0062277 3300049574 Unclassified 3188
344 Ga0501038_0162805 3300049574 Unclassified 1812
345 Ga0501039_0011216 3300049575 Bacteria 6830
346 Ga0501039_0042555 3300049575 Unclassified 3509
347 Ga0501039_0076629 3300049575 Bacteria 2600
348 Ga0501039_0161778 3300049575 Unclassified 1760
349 Ga0501039_0179743 3300049575 Unclassified 1664
350 Ga0501040_0000054 3300049576 Bacteria 53380
351 Ga0501040_0061779 3300049576 Unclassified 2577
352 Ga0501040_0239606 3300049576 Bacteria 1293
353 Ga0501041_0005544 3300049577 Bacteria 7382
354 Ga0501042_0000588 3300049578 Bacteria 19290
355 Ga0501042_0039120 3300049578 Bacteria 3369
356 Ga0501042_0130623 3300049578 Unclassified 1810
357 Ga0501046_0005971 3300049580 Bacteria 10839
358 Ga0501048_0325571 3300049582 Unclassified 1095
359 Ga0501067_0027574 3300049583 Unclassified 3148
360 Ga0501067_0202227 3300049583 Bacteria 1106
361 Ga0501071_0006452 3300049587 Bacteria 7614
362 Ga0501071_0024982 3300049587 Unclassified 4183
363 Ga0501071_0083402 3300049587 Bacteria 2341
364 Ga0501071_0266883 3300049587 Unclassified 1293
365 Ga0501072_0012117 3300049588 Bacteria 6587
366 Ga0501072_0022970 3300049588 Unclassified 4842
367 Ga0501072_0043246 3300049588 Bacteria 3540
368 Ga0501072_0125430 3300049588 Bacteria 2045
369 Ga0501072_0146094 3300049588 Unclassified 1885
370 Ga0501073_0004475 3300049589 Bacteria 10498
371 Ga0501074_0010625 3300049590 Bacteria 6684
372 Ga0501074_0080423 3300049590 Unclassified 2338
373 Ga0501074_0197247 3300049590 Bacteria 1435
374 Ga0501075_0004583 3300049591 Bacteria 9369
375 Ga0501075_0014855 3300049591 Bacteria 5584
376 Ga0501075_0101511 3300049591 Bacteria 2185
377 Ga0501075_0153965 3300049591 Bacteria 1753
378 Ga0501075_0309537 3300049591 Bacteria 1204
379 Ga0501076_0018865 3300049592 Bacteria 5264
380 Ga0501076_0027790 3300049592 Unclassified 4387
381 Ga0501076_0100469 3300049592 Bacteria 2331
382 Ga0501076_0261942 3300049592 Bacteria 1416
383 Ga0501076_0280631 3300049592 Bacteria 1365
384 Ga0501217_052091 3300049661 Archaea 1073
385 Ga0501079_0022067 3300049741 Unclassified 4878
386 Ga0501079_0046086 3300049741 Bacteria 3364
387 Ga0501079_0046851 3300049741 Unclassified 3336
388 Ga0501079_0113642 3300049741 Bacteria 2105
389 Ga0501080_0038922 3300049742 Unclassified 4438
390 Ga0501080_0097026 3300049742 Bacteria 2736
391 Ga0501081_0000275 3300049743 Bacteria 27110
392 Ga0501081_0012623 3300049743 Bacteria 5554
393 Ga0501081_0051433 3300049743 Bacteria 2842
394 Ga0501081_0185597 3300049743 Unclassified 1505
395 Ga0501083_0079659 3300049744 Bacteria 2172
396 Ga0501035_0249402 3300049822 Unclassified 1508
397 Ga0501045_0009262 3300049824 Bacteria 6886
398 Ga0501045_0012267 3300049824 Bacteria 6035
399 Ga0501045_0025057 3300049824 Bacteria 4285
400 Ga0501045_0044747 3300049824 Unclassified 3225
401 nmdc:mga03683_24526_c1 3300050489 Bacteria 2361
402 nmdc:mga00v17_53440_c1 3300050491 Bacteria 2462
403 nmdc:mga0k408_17092_c1 3300050493 Bacteria 4035
404 nmdc:mga0k408_44368_c1 3300050493 Bacteria 2564
405 nmdc:mga06z11_63003_c1 3300050494 Bacteria 1939
406 nmdc:mga05p37_127484_c1 3300050507 Unclassified 3124
407 nmdc:mga05p37_13758_c1 3300050507 Bacteria 9694
408 nmdc:mga05p37_139909_c1 3300050507 Bacteria 2966
409 nmdc:mga05p37_1524_c1 3300050507 Bacteria 26970
410 nmdc:mga05p37_160430_c1 3300050507 Unclassified 2747
411 nmdc:mga05p37_19222_c1 3300050507 Bacteria 8264
412 nmdc:mga05p37_197657_c1 3300050507 Bacteria 2438
413 nmdc:mga05p37_408531_c1 3300050507 Bacteria 1583
414 nmdc:mga05p37_43881_c1 3300050507 Bacteria 5501
415 nmdc:mga05p37_5890_c1 3300050507 Bacteria 14416
416 nmdc:mga05p37_673675_c1 3300050507 Bacteria 1154
417 nmdc:mga05p37_81565_c1 3300050507 Bacteria 3984
418 nmdc:mga09592_2193_c1 3300050508 Bacteria 15720
419 nmdc:mga09592_225989_c1 3300050508 Bacteria 1622
420 nmdc:mga09592_35715_c1 3300050508 Bacteria 4161
421 nmdc:mga09592_88019_c1 3300050508 Bacteria 2652
422 nmdc:mga0qj67_308909_c1 3300050509 Bacteria 1281
423 nmdc:mga0qj67_5993_c1 3300050509 Bacteria 8907
424 nmdc:mga06r32_106074_c1 3300050510 Unclassified 2760
425 nmdc:mga06r32_147115_c2 3300050510 Unclassified 1605
426 nmdc:mga06r32_251490_c1 3300050510 Unclassified 1755
427 nmdc:mga06r32_258167_c1 3300050510 Bacteria 1730
428 nmdc:mga06r32_615681_c1 3300050510 Archaea 1056
429 nmdc:mga06r32_88458_c1 3300050510 Unclassified 3023
430 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
431 nmdc:mga08y16_4666_c1 3300050511 Bacteria 14275
432 nmdc:mga08y16_7613_c1 3300050511 Bacteria 11333
433 nmdc:mga0n895_215715_c1 3300050512 Bacteria 1949
434 nmdc:mga0n895_65095_c1 3300050512 Bacteria 3607
435 nmdc:mga0n895_9710_c1 3300050512 Bacteria 8439
436 nmdc:mga0rr50_12141_c1 3300050513 Bacteria 5553
437 nmdc:mga0rr50_413357_c1 3300050513 Bacteria 1141
438 nmdc:mga0rr50_8435_c1 3300050513 Bacteria 6415
439 nmdc:mga08x19_124639_c1 3300050514 Bacteria 1729
440 nmdc:mga08x19_20109_c1 3300050514 Unclassified 4109
441 nmdc:mga08x19_34694_c1 3300050514 Unclassified 3190
442 nmdc:mga0a205_115742_c1 3300050515 Unclassified 1102
443 nmdc:mga0a205_206533_c1 3300050515 Bacteria 1853
444 nmdc:mga0a205_41438_c2 3300050515 Bacteria 3459
445 nmdc:mga0a205_436253_c1 3300050515 Unclassified 1171
446 nmdc:mga0a205_50069_c1 3300050515 Unclassified 4033
447 nmdc:mga0a205_75916_c1 3300050515 Bacteria 3247
448 Ga0495612_0069041 3300053078 Bacteria 1471
449 Ga0495619_0006951 3300053085 Bacteria 7159
450 Ga0495619_0121918 3300053085 Bacteria 1788
451 Ga0500641_0001751 3300053096 Bacteria 7699
452 Ga0500555_012739 3300053103 Unclassified 2421
453 Ga0500556_0011191 3300053104 Bacteria 2652
454 Ga0501084_0007489 3300054114 Bacteria 9001
455 Ga0501084_0048856 3300054114 Bacteria 3542
456 Ga0501084_0137355 3300054114 Unclassified 2058
457 Ga0501084_0213445 3300054114 Bacteria 1628
458 Ga0590071_000695 3300059421 Bacteria 9562
459 Ga0590071_029994 3300059421 Unclassified 1294
460 Ga0590075_000238 3300059424 Bacteria 15479
461 Ga0590075_011561 3300059424 Bacteria 2135
462 Ga0590077_000270 3300059426 Bacteria 14724
463 Ga0590077_003069 3300059426 Bacteria 3497
464 Ga0501082_0124721 3300060353 Unclassified 2233
465 Ga0530510_0002943 3300061734 Bacteria 11678
466 Ga0530510_0007888 3300061734 Bacteria 7426
467 Ga0530510_0018969 3300061734 Unclassified 4878
468 Ga0530510_0082488 3300061734 Bacteria 2341

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053104 Ga0500556_0011191 Ga0500556_0011191_1834_2640 268
2 3300045051 Ga0451576_0767568 Ga0451576_0767568_155_991 278
3 3300005356 Ga0070674_100005716 Ga0070674_1000057163 279
4 3300025937 Ga0207669_10003027 Ga0207669_100030277 279
5 3300025972 Ga0207668_10058711 Ga0207668_100587113 279
6 3300035088 Ga0373940_0017366 Ga0373940_0017366_880_1728 282
7 3300035121 Ga0373960_0064791 Ga0373960_0064791_61_909 282
8 3300005617 Ga0068859_100219271 Ga0068859_1002192712 284
9 3300006931 Ga0097620_100219267 Ga0097620_1002192672 284
10 3300026095 Ga0207676_10282327 Ga0207676_102823272 284
11 3300009177 Ga0105248_10197941 Ga0105248_101979411 287
12 3300032002 Ga0307416_100151667 Ga0307416_1001516673 287
13 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_49435_50313 292
14 3300005331 Ga0070670_100064103 Ga0070670_1000641033 296
15 3300005618 Ga0068864_100012773 Ga0068864_1000127735 296
16 3300006195 Ga0075366_10017584 Ga0075366_100175842 296
17 3300026095 Ga0207676_10109984 Ga0207676_101099843 296
18 3300005366 Ga0070659_100338725 Ga0070659_1003387252 297
19 3300026121 Ga0207683_10425180 Ga0207683_104251802 297
20 3300035692 Ga0373935_0299968 Ga0373935_0299968_67_960 297
21 3300049583 Ga0501067_0202227 Ga0501067_0202227_99_992 297
22 3300034816 Ga0373930_0014627 Ga0373930_0014627_10_981 299
23 3300046517 Ga0495630_0142479 Ga0495630_0142479_10_930 299
24 3300050510 nmdc:mga06r32_615681_c1 nmdc:mga06r32_615681_c1_56_955 299
25 3300005331 Ga0070670_100212058 Ga0070670_1002120582 300
26 3300005353 Ga0070669_100104682 Ga0070669_1001046821 300
27 3300005364 Ga0070673_100229164 Ga0070673_1002291642 300
28 3300005455 Ga0070663_100194972 Ga0070663_1001949722 300
29 3300005455 Ga0070663_100208041 Ga0070663_1002080412 300
30 3300005718 Ga0068866_10002163 Ga0068866_100021633 300
31 3300005719 Ga0068861_100265471 Ga0068861_1002654711 300
32 3300009147 Ga0114129_10015389 Ga0114129_100153892 300
33 3300009553 Ga0105249_10213806 Ga0105249_102138062 300
34 3300025925 Ga0207650_10034957 Ga0207650_100349574 300
35 3300025937 Ga0207669_10132653 Ga0207669_101326532 300
36 3300025972 Ga0207668_10080832 Ga0207668_100808322 300
37 3300026118 Ga0207675_100155857 Ga0207675_1001558573 300
38 3300048908 Ga0496105_0167883 Ga0496105_0167883_365_1267 300
39 3300049574 Ga0501038_0034649 Ga0501038_0034649_3422_4324 300
40 3300049575 Ga0501039_0011216 Ga0501039_0011216_3053_3955 300
41 3300049577 Ga0501041_0005544 Ga0501041_0005544_127_1029 300
42 3300049578 Ga0501042_0039120 Ga0501042_0039120_2309_3211 300
43 3300049580 Ga0501046_0005971 Ga0501046_0005971_710_1612 300
44 3300049588 Ga0501072_0125430 Ga0501072_0125430_364_1266 300
45 3300049590 Ga0501074_0010625 Ga0501074_0010625_2719_3621 300
46 3300049591 Ga0501075_0004583 Ga0501075_0004583_5877_6779 300
47 3300049741 Ga0501079_0022067 Ga0501079_0022067_2591_3493 300
48 3300049742 Ga0501080_0038922 Ga0501080_0038922_1883_2785 300
49 3300049743 Ga0501081_0000275 Ga0501081_0000275_22013_22915 300
50 3300049743 Ga0501081_0185597 Ga0501081_0185597_509_1411 300
51 3300049822 Ga0501035_0249402 Ga0501035_0249402_542_1444 300
52 3300049824 Ga0501045_0009262 Ga0501045_0009262_314_1216 300
53 3300050507 nmdc:mga05p37_81565_c1 nmdc:mga05p37_81565_c1_2644_3546 300
54 3300054114 Ga0501084_0007489 Ga0501084_0007489_2393_3295 300
55 3300061734 Ga0530510_0002943 Ga0530510_0002943_7428_8330 300
56 3300005468 Ga0070707_100054869 Ga0070707_1000548694 301
57 3300005545 Ga0070695_100004825 Ga0070695_1000048253 301
58 3300005546 Ga0070696_100140962 Ga0070696_1001409622 301
59 3300025922 Ga0207646_10058487 Ga0207646_100584872 301
60 3300005471 Ga0070698_100341759 Ga0070698_1003417592 304
61 3300049568 Ga0501031_0089169 Ga0501031_0089169_499_1479 304
62 3300049572 Ga0501036_0134431 Ga0501036_0134431_380_1360 304
63 3300049574 Ga0501038_0062277 Ga0501038_0062277_964_1944 304
64 3300049575 Ga0501039_0179743 Ga0501039_0179743_308_1288 304
65 3300049576 Ga0501040_0061779 Ga0501040_0061779_224_1204 304
66 3300049587 Ga0501071_0006452 Ga0501071_0006452_3235_4215 304
67 3300049588 Ga0501072_0012117 Ga0501072_0012117_2131_3111 304
68 3300049591 Ga0501075_0014855 Ga0501075_0014855_201_1181 304
69 3300049592 Ga0501076_0018865 Ga0501076_0018865_3383_4363 304
70 3300049741 Ga0501079_0046086 Ga0501079_0046086_2028_3008 304
71 3300049743 Ga0501081_0012623 Ga0501081_0012623_2846_3826 304
72 3300049824 Ga0501045_0025057 Ga0501045_0025057_313_1293 304
73 3300054114 Ga0501084_0137355 Ga0501084_0137355_452_1432 304
74 3300060353 Ga0501082_0124721 Ga0501082_0124721_185_1165 304
75 3300061734 Ga0530510_0018969 Ga0530510_0018969_1688_2668 304
76 3300025919 Ga0207657_10139619 Ga0207657_101396192 305
77 3300050508 nmdc:mga09592_88019_c1 nmdc:mga09592_88019_c1_865_1785 306
78 3300050509 nmdc:mga0qj67_5993_c1 nmdc:mga0qj67_5993_c1_2046_2966 306
79 3300005353 Ga0070669_100012602 Ga0070669_1000126023 308
80 3300053096 Ga0500641_0001751 Ga0500641_0001751_23_961 308
81 3300005347 Ga0070668_100274683 Ga0070668_1002746832 309
82 3300005354 Ga0070675_100022500 Ga0070675_1000225002 309
83 3300005844 Ga0068862_100043541 Ga0068862_1000435413 309
84 3300025923 Ga0207681_10020723 Ga0207681_100207232 309
85 3300025933 Ga0207706_10024368 Ga0207706_100243684 309
86 3300025972 Ga0207668_10026640 Ga0207668_100266405 309
87 3300028380 Ga0268265_10044716 Ga0268265_100447163 309
88 3300005435 Ga0070714_100238744 Ga0070714_1002387442 311
89 3300025906 Ga0207699_10256131 Ga0207699_102561312 311
90 3300026067 Ga0207678_10073653 Ga0207678_100736532 311
91 3300035241 Ga0373961_0002480 Ga0373961_0002480_3077_4144 311
92 3300042007 Ga0439449_0048723 Ga0439449_0048723_170_1147 311
93 3300059421 Ga0590071_029994 Ga0590071_029994_246_1193 311
94 3300009147 Ga0114129_10011063 Ga0114129_100110636 312
95 3300038443 Ga0395901_0384500 Ga0395901_0384500_172_1152 312
96 3300045051 Ga0451576_0155586 Ga0451576_0155586_1129_2106 312
97 3300050507 nmdc:mga05p37_19222_c1 nmdc:mga05p37_19222_c1_4559_5545 312
98 3300006847 Ga0075431_100104108 Ga0075431_1001041083 314
99 3300036401 Ga0373937_0173019 Ga0373937_0173019_60_1061 314
100 3300046514 Ga0495618_0143215 Ga0495618_0143215_200_1201 314
101 3300046516 Ga0495628_0060447 Ga0495628_0060447_1115_2116 314
102 3300046533 Ga0495640_0158572 Ga0495640_0158572_113_1114 314
103 3300046681 Ga0495647_0117793 Ga0495647_0117793_30_1031 314
104 3300047319 Ga0495674_0146146 Ga0495674_0146146_740_1741 314
105 3300047321 Ga0495676_0217108 Ga0495676_0217108_214_1215 314
106 3300050510 nmdc:mga06r32_88458_c1 nmdc:mga06r32_88458_c1_1920_2900 314
107 3300006880 Ga0075429_100082922 Ga0075429_1000829222 315
108 3300009147 Ga0114129_10081377 Ga0114129_100813772 315
109 3300050507 nmdc:mga05p37_43881_c1 nmdc:mga05p37_43881_c1_1173_2165 315
110 3300050508 nmdc:mga09592_35715_c1 nmdc:mga09592_35715_c1_391_1383 315
111 3300005615 Ga0070702_100264217 Ga0070702_1002642171 316
112 3300005841 Ga0068863_100226041 Ga0068863_1002260412 316
113 3300009176 Ga0105242_10070801 Ga0105242_100708013 316
114 3300009177 Ga0105248_10039235 Ga0105248_100392352 316
115 3300025923 Ga0207681_10020728 Ga0207681_100207285 316
116 3300025934 Ga0207686_10102283 Ga0207686_101022832 316
117 3300006844 Ga0075428_100000010 Ga0075428_100000010168 317
118 3300006844 Ga0075428_100149848 Ga0075428_1001498483 317
119 3300009094 Ga0111539_10000001 Ga0111539_1000000134 317
120 3300009147 Ga0114129_10000186 Ga0114129_100001869 317
121 3300027907 Ga0207428_10000002 Ga0207428_1000000247 317
122 3300042125 Ga0450923_006257 Ga0450923_006257_869_1849 317
123 3300042131 Ga0450894_000870 Ga0450894_000870_568_1548 317
124 3300042133 Ga0450896_000612 Ga0450896_000612_891_1871 317
125 3300042184 Ga0450908_017169 Ga0450908_017169_208_1188 317
126 3300042531 Ga0450918_007760 Ga0450918_007760_826_1806 317
127 3300045976 Ga0466967_0294065 Ga0466967_0294065_506_1459 317
128 3300050507 nmdc:mga05p37_1524_c1 nmdc:mga05p37_1524_c1_12545_13528 317
129 3300009147 Ga0114129_10005014 Ga0114129_100050145 318
130 3300050507 nmdc:mga05p37_5890_c1 nmdc:mga05p37_5890_c1_10419_11426 318
131 3300050515 nmdc:mga0a205_436253_c1 nmdc:mga0a205_436253_c1_63_1070 318
132 3300049592 Ga0501076_0261942 Ga0501076_0261942_178_1173 319
133 3300050510 nmdc:mga06r32_106074_c1 nmdc:mga06r32_106074_c1_736_1695 319
134 3300014325 Ga0163163_10134792 Ga0163163_101347923 320
135 3300050510 nmdc:mga06r32_147115_c2 nmdc:mga06r32_147115_c2_482_1465 320
136 3300005356 Ga0070674_100009206 Ga0070674_1000092062 321
137 3300005616 Ga0068852_100112946 Ga0068852_1001129462 321
138 3300032005 Ga0307411_10303673 Ga0307411_103036732 321
139 3300006846 Ga0075430_100019004 Ga0075430_1000190042 322
140 3300006871 Ga0075434_100054041 Ga0075434_1000540412 322
141 3300009094 Ga0111539_10000740 Ga0111539_1000074020 322
142 3300009147 Ga0114129_10001901 Ga0114129_1000190118 322
143 3300025926 Ga0207659_10179399 Ga0207659_101793992 322
144 3300026075 Ga0207708_10143038 Ga0207708_101430382 322
145 3300032005 Ga0307411_10033774 Ga0307411_100337743 322
146 3300042439 Ga0439464_0008661 Ga0439464_0008661_1538_2506 322
147 3300050508 nmdc:mga09592_2193_c1 nmdc:mga09592_2193_c1_14251_15219 322
148 3300050509 nmdc:mga0qj67_308909_c1 nmdc:mga0qj67_308909_c1_227_1195 322
149 3300050511 nmdc:mga08y16_4666_c1 nmdc:mga08y16_4666_c1_8269_9237 322
150 3300050512 nmdc:mga0n895_65095_c1 nmdc:mga0n895_65095_c1_2126_3106 322
151 3300005331 Ga0070670_100012446 Ga0070670_1000124464 323
152 3300005338 Ga0068868_100185058 Ga0068868_1001850582 323
153 3300005577 Ga0068857_100012955 Ga0068857_1000129556 323
154 3300009147 Ga0114129_10166295 Ga0114129_101662953 323
155 3300009177 Ga0105248_10097853 Ga0105248_100978532 323
156 3300025925 Ga0207650_10077608 Ga0207650_100776083 323
157 3300026116 Ga0207674_10019855 Ga0207674_100198556 323
158 3300050507 nmdc:mga05p37_139909_c1 nmdc:mga05p37_139909_c1_1664_2695 323
159 3300005366 Ga0070659_100232062 Ga0070659_1002320621 324
160 3300006852 Ga0075433_10007642 Ga0075433_100076423 324
161 3300006871 Ga0075434_100002153 Ga0075434_1000021535 324
162 3300009553 Ga0105249_10000180 Ga0105249_1000018068 324
163 3300013105 Ga0157369_10050848 Ga0157369_100508482 324
164 3300014969 Ga0157376_10108041 Ga0157376_101080413 324
165 3300042156 Ga0439446_0032666 Ga0439446_0032666_29_1015 324
166 3300042876 Ga0451577_0007418 Ga0451577_0007418_4614_5591 324
167 3300053103 Ga0500555_012739 Ga0500555_012739_580_1566 324
168 3300005842 Ga0068858_100042970 Ga0068858_1000429703 325
169 3300005842 Ga0068858_100190946 Ga0068858_1001909462 325
170 3300006844 Ga0075428_100017492 Ga0075428_1000174923 325
171 3300009147 Ga0114129_10041815 Ga0114129_100418155 325
172 3300009147 Ga0114129_10393487 Ga0114129_103934872 325
173 3300009147 Ga0114129_10507127 Ga0114129_105071272 325
174 3300009177 Ga0105248_10038141 Ga0105248_100381413 325
175 3300014325 Ga0163163_10122097 Ga0163163_101220972 325
176 3300014968 Ga0157379_10133360 Ga0157379_101333602 325
177 3300025912 Ga0207707_10110672 Ga0207707_101106723 325
178 3300026035 Ga0207703_10158898 Ga0207703_101588982 325
179 3300028381 Ga0268264_10343281 Ga0268264_103432812 325
180 3300031727 Ga0316576_10055104 Ga0316576_100551042 325
181 3300032002 Ga0307416_100132389 Ga0307416_1001323893 325
182 3300038726 Ga0400490_24668 Ga0400490_24668_8134_9132 325
183 3300038726 Ga0400490_33866 Ga0400490_33866_1753_2751 325
184 3300038741 Ga0400488_49291 Ga0400488_49291_1428_2426 325
185 3300039093 Ga0400489_93634 Ga0400489_93634_3932_4912 325
186 3300049576 Ga0501040_0000054 Ga0501040_0000054_23144_24127 325
187 3300049578 Ga0501042_0000588 Ga0501042_0000588_15175_16158 325
188 3300049583 Ga0501067_0027574 Ga0501067_0027574_2037_3020 325
189 3300049589 Ga0501073_0004475 Ga0501073_0004475_5260_6249 325
190 3300050507 nmdc:mga05p37_127484_c1 nmdc:mga05p37_127484_c1_364_1353 325
191 3300050507 nmdc:mga05p37_197657_c1 nmdc:mga05p37_197657_c1_967_1974 325
192 3300005327 Ga0070658_10045958 Ga0070658_100459583 326
193 3300005328 Ga0070676_10033959 Ga0070676_100339592 326
194 3300005329 Ga0070683_100163156 Ga0070683_1001631563 326
195 3300005330 Ga0070690_100199281 Ga0070690_1001992812 326
196 3300005331 Ga0070670_100180755 Ga0070670_1001807552 326
197 3300005333 Ga0070677_10021044 Ga0070677_100210443 326
198 3300005334 Ga0068869_100148837 Ga0068869_1001488372 326
199 3300005336 Ga0070680_100020787 Ga0070680_1000207875 326
200 3300005336 Ga0070680_100039705 Ga0070680_1000397053 326
201 3300005336 Ga0070680_100116958 Ga0070680_1001169582 326
202 3300005338 Ga0068868_100132169 Ga0068868_1001321692 326
203 3300005338 Ga0068868_100258141 Ga0068868_1002581411 326
204 3300005340 Ga0070689_100045359 Ga0070689_1000453593 326
205 3300005343 Ga0070687_100047427 Ga0070687_1000474272 326
206 3300005344 Ga0070661_100295247 Ga0070661_1002952471 326
207 3300005347 Ga0070668_100006466 Ga0070668_1000064665 326
208 3300005354 Ga0070675_100018823 Ga0070675_1000188233 326
209 3300005355 Ga0070671_100091001 Ga0070671_1000910012 326
210 3300005355 Ga0070671_100147941 Ga0070671_1001479412 326
211 3300005356 Ga0070674_100107178 Ga0070674_1001071782 326
212 3300005364 Ga0070673_100000364 Ga0070673_1000003641 326
213 3300005365 Ga0070688_100088325 Ga0070688_1000883252 326
214 3300005434 Ga0070709_10168600 Ga0070709_101686001 326
215 3300005435 Ga0070714_100125955 Ga0070714_1001259551 326
216 3300005436 Ga0070713_100066442 Ga0070713_1000664422 326
217 3300005441 Ga0070700_100008186 Ga0070700_1000081865 326
218 3300005445 Ga0070708_100032869 Ga0070708_1000328693 326
219 3300005456 Ga0070678_100013004 Ga0070678_1000130043 326
220 3300005457 Ga0070662_100317675 Ga0070662_1003176751 326
221 3300005458 Ga0070681_10045461 Ga0070681_100454613 326
222 3300005458 Ga0070681_10079771 Ga0070681_100797712 326
223 3300005458 Ga0070681_10281795 Ga0070681_102817952 326
224 3300005459 Ga0068867_100127989 Ga0068867_1001279892 326
225 3300005468 Ga0070707_100144685 Ga0070707_1001446852 326
226 3300005471 Ga0070698_100063281 Ga0070698_1000632813 326
227 3300005518 Ga0070699_100002365 Ga0070699_10000236517 326
228 3300005518 Ga0070699_100006877 Ga0070699_1000068777 326
229 3300005530 Ga0070679_100017472 Ga0070679_1000174724 326
230 3300005530 Ga0070679_100035234 Ga0070679_1000352343 326
231 3300005530 Ga0070679_100114398 Ga0070679_1001143982 326
232 3300005535 Ga0070684_100089041 Ga0070684_1000890412 326
233 3300005539 Ga0068853_100032033 Ga0068853_1000320333 326
234 3300005539 Ga0068853_100225188 Ga0068853_1002251882 326
235 3300005544 Ga0070686_100003397 Ga0070686_1000033974 326
236 3300005549 Ga0070704_100016780 Ga0070704_1000167804 326
237 3300005563 Ga0068855_100110549 Ga0068855_1001105492 326
238 3300005563 Ga0068855_100126106 Ga0068855_1001261063 326
239 3300005563 Ga0068855_100548972 Ga0068855_1005489722 326
240 3300005578 Ga0068854_100164955 Ga0068854_1001649552 326
241 3300005614 Ga0068856_100086677 Ga0068856_1000866773 326
242 3300005616 Ga0068852_100014753 Ga0068852_1000147533 326
243 3300005617 Ga0068859_100053090 Ga0068859_1000530901 326
244 3300005617 Ga0068859_100171905 Ga0068859_1001719052 326
245 3300005719 Ga0068861_100075513 Ga0068861_1000755133 326
246 3300006028 Ga0070717_10259327 Ga0070717_102593272 326
247 3300006051 Ga0075364_10008709 Ga0075364_100087095 326
248 3300006177 Ga0075362_10005347 Ga0075362_100053474 326
249 3300006178 Ga0075367_10051224 Ga0075367_100512242 326
250 3300006178 Ga0075367_10072703 Ga0075367_100727032 326
251 3300006195 Ga0075366_10010882 Ga0075366_100108825 326
252 3300006237 Ga0097621_100030731 Ga0097621_1000307314 326
253 3300006237 Ga0097621_100218189 Ga0097621_1002181892 326
254 3300006844 Ga0075428_100005848 Ga0075428_1000058482 326
255 3300006844 Ga0075428_100027805 Ga0075428_1000278053 326
256 3300006846 Ga0075430_100006615 Ga0075430_1000066152 326
257 3300006846 Ga0075430_100007270 Ga0075430_1000072706 326
258 3300006847 Ga0075431_100024135 Ga0075431_1000241353 326
259 3300006847 Ga0075431_100033593 Ga0075431_1000335933 326
260 3300006847 Ga0075431_100086176 Ga0075431_1000861762 326
261 3300006847 Ga0075431_100184829 Ga0075431_1001848292 326
262 3300006847 Ga0075431_100312565 Ga0075431_1003125651 326
263 3300006847 Ga0075431_100476101 Ga0075431_1004761012 326
264 3300006852 Ga0075433_10013631 Ga0075433_100136314 326
265 3300006852 Ga0075433_10026199 Ga0075433_100261993 326
266 3300006852 Ga0075433_10308285 Ga0075433_103082851 326
267 3300006871 Ga0075434_100109666 Ga0075434_1001096663 326
268 3300006880 Ga0075429_100001697 Ga0075429_10000169714 326
269 3300006880 Ga0075429_100096000 Ga0075429_1000960003 326
270 3300006914 Ga0075436_100022198 Ga0075436_1000221984 326
271 3300006914 Ga0075436_100082361 Ga0075436_1000823612 326
272 3300006914 Ga0075436_100097479 Ga0075436_1000974792 326
273 3300006931 Ga0097620_100053088 Ga0097620_1000530881 326
274 3300006931 Ga0097620_100171914 Ga0097620_1001719142 326
275 3300007076 Ga0075435_100001847 Ga0075435_1000018476 326
276 3300007076 Ga0075435_100003420 Ga0075435_1000034204 326
277 3300007076 Ga0075435_100003471 Ga0075435_10000347110 326
278 3300007076 Ga0075435_100009122 Ga0075435_1000091225 326
279 3300007076 Ga0075435_100118979 Ga0075435_1001189792 326
280 3300009093 Ga0105240_10049469 Ga0105240_100494693 326
281 3300009093 Ga0105240_10110142 Ga0105240_101101423 326
282 3300009094 Ga0111539_10016952 Ga0111539_100169523 326
283 3300009094 Ga0111539_10018031 Ga0111539_100180316 326
284 3300009094 Ga0111539_10133827 Ga0111539_101338271 326
285 3300009094 Ga0111539_10347769 Ga0111539_103477692 326
286 3300009147 Ga0114129_10002876 Ga0114129_1000287618 326
287 3300009147 Ga0114129_10016555 Ga0114129_100165553 326
288 3300009147 Ga0114129_10045272 Ga0114129_100452723 326
289 3300009147 Ga0114129_10061709 Ga0114129_100617095 326
290 3300009147 Ga0114129_10077937 Ga0114129_100779374 326
291 3300009147 Ga0114129_10246699 Ga0114129_102466992 326
292 3300009147 Ga0114129_10285710 Ga0114129_102857102 326
293 3300009176 Ga0105242_10026762 Ga0105242_100267624 326
294 3300009176 Ga0105242_10357975 Ga0105242_103579752 326
295 3300009177 Ga0105248_10012674 Ga0105248_100126747 326
296 3300009177 Ga0105248_10037164 Ga0105248_100371642 326
297 3300009177 Ga0105248_10119226 Ga0105248_101192262 326
298 3300009177 Ga0105248_10240651 Ga0105248_102406512 326
299 3300009177 Ga0105248_10793578 Ga0105248_107935781 326
300 3300009551 Ga0105238_10152609 Ga0105238_101526092 326
301 3300010375 Ga0105239_10407242 Ga0105239_104072422 326
302 3300010375 Ga0105239_10519345 Ga0105239_105193452 326
303 3300013104 Ga0157370_10016812 Ga0157370_100168127 326
304 3300013296 Ga0157374_10050191 Ga0157374_100501913 326
305 3300013307 Ga0157372_10039711 Ga0157372_100397113 326
306 3300013307 Ga0157372_10163827 Ga0157372_101638272 326
307 3300014326 Ga0157380_10020295 Ga0157380_100202953 326
308 3300014497 Ga0182008_10007127 Ga0182008_100071274 326
309 3300014969 Ga0157376_10097229 Ga0157376_100972292 326
310 3300017792 Ga0163161_10104789 Ga0163161_101047892 326
311 3300025315 Ga0207697_10004761 Ga0207697_100047615 326
312 3300025893 Ga0207682_10066027 Ga0207682_100660272 326
313 3300025901 Ga0207688_10106301 Ga0207688_101063011 326
314 3300025907 Ga0207645_10018483 Ga0207645_100184833 326
315 3300025912 Ga0207707_10001197 Ga0207707_1000119718 326
316 3300025912 Ga0207707_10025762 Ga0207707_100257622 326
317 3300025912 Ga0207707_10026581 Ga0207707_100265813 326
318 3300025912 Ga0207707_10067522 Ga0207707_100675222 326
319 3300025917 Ga0207660_10134685 Ga0207660_101346852 326
320 3300025918 Ga0207662_10005644 Ga0207662_100056446 326
321 3300025918 Ga0207662_10059744 Ga0207662_100597442 326
322 3300025919 Ga0207657_10008607 Ga0207657_100086079 326
323 3300025920 Ga0207649_10216311 Ga0207649_102163112 326
324 3300025921 Ga0207652_10005510 Ga0207652_100055109 326
325 3300025921 Ga0207652_10047117 Ga0207652_100471172 326
326 3300025923 Ga0207681_10147575 Ga0207681_101475752 326
327 3300025924 Ga0207694_10015340 Ga0207694_100153406 326
328 3300025925 Ga0207650_10006334 Ga0207650_100063345 326
329 3300025926 Ga0207659_10113501 Ga0207659_101135013 326
330 3300025927 Ga0207687_10069947 Ga0207687_100699473 326
331 3300025929 Ga0207664_10118792 Ga0207664_101187922 326
332 3300025929 Ga0207664_10161072 Ga0207664_101610721 326
333 3300025929 Ga0207664_10254574 Ga0207664_102545742 326
334 3300025931 Ga0207644_10062463 Ga0207644_100624633 326
335 3300025933 Ga0207706_10147384 Ga0207706_101473842 326
336 3300025940 Ga0207691_10011607 Ga0207691_100116075 326
337 3300025940 Ga0207691_10157129 Ga0207691_101571292 326
338 3300025941 Ga0207711_10010730 Ga0207711_100107304 326
339 3300025941 Ga0207711_10035585 Ga0207711_100355854 326
340 3300025941 Ga0207711_10350226 Ga0207711_103502261 326
341 3300025941 Ga0207711_10358082 Ga0207711_103580822 326
342 3300025944 Ga0207661_10176850 Ga0207661_101768501 326
343 3300025944 Ga0207661_10319225 Ga0207661_103192252 326
344 3300025949 Ga0207667_10266700 Ga0207667_102667002 326
345 3300025949 Ga0207667_10325640 Ga0207667_103256402 326
346 3300025949 Ga0207667_10524856 Ga0207667_105248562 326
347 3300025960 Ga0207651_10016602 Ga0207651_100166021 326
348 3300025961 Ga0207712_10000391 Ga0207712_1000039136 326
349 3300026023 Ga0207677_10080150 Ga0207677_100801502 326
350 3300026023 Ga0207677_10203039 Ga0207677_102030392 326
351 3300026041 Ga0207639_10033552 Ga0207639_100335524 326
352 3300026041 Ga0207639_10095365 Ga0207639_100953652 326
353 3300026075 Ga0207708_10008855 Ga0207708_100088556 326
354 3300026078 Ga0207702_10133036 Ga0207702_101330362 326
355 3300026089 Ga0207648_10113819 Ga0207648_101138192 326
356 3300026089 Ga0207648_10177926 Ga0207648_101779262 326
357 3300026118 Ga0207675_100071576 Ga0207675_1000715763 326
358 3300026118 Ga0207675_100086342 Ga0207675_1000863423 326
359 3300026121 Ga0207683_10193248 Ga0207683_101932482 326
360 3300028380 Ga0268265_10021748 Ga0268265_100217482 326
361 3300031548 Ga0307408_100053992 Ga0307408_1000539921 326
362 3300031548 Ga0307408_100096187 Ga0307408_1000961872 326
363 3300031548 Ga0307408_100119209 Ga0307408_1001192091 326
364 3300031731 Ga0307405_10262025 Ga0307405_102620251 326
365 3300031903 Ga0307407_10071003 Ga0307407_100710032 326
366 3300032002 Ga0307416_100102635 Ga0307416_1001026353 326
367 3300032002 Ga0307416_100268134 Ga0307416_1002681342 326
368 3300032002 Ga0307416_100309139 Ga0307416_1003091392 326
369 3300032004 Ga0307414_10315210 Ga0307414_103152102 326
370 3300032005 Ga0307411_10063641 Ga0307411_100636412 326
371 3300032005 Ga0307411_10246828 Ga0307411_102468281 326
372 3300034819 Ga0373958_0001973 Ga0373958_0001973_337_1356 326
373 3300035085 Ga0373929_0002955 Ga0373929_0002955_537_1652 326
374 3300035090 Ga0373949_0002450 Ga0373949_0002450_536_1627 326
375 3300035092 Ga0373952_0002536 Ga0373952_0002536_580_1695 326
376 3300035115 Ga0373941_0003558 Ga0373941_0003558_2116_3183 326
377 3300035207 Ga0373942_0001577 Ga0373942_0001577_3157_4176 326
378 3300035242 Ga0373962_0001413 Ga0373962_0001413_1510_2553 326
379 3300036401 Ga0373937_0002111 Ga0373937_0002111_3216_4196 326
380 3300037068 Ga0373925_0006423 Ga0373925_0006423_79_1059 326
381 3300041460 Ga0451802_1909252 Ga0451802_1909252_242_1234 326
382 3300041512 Ga0451853_2472702 Ga0451853_2472702_51_1043 326
383 3300042993 Ga0439440_0009888 Ga0439440_0009888_525_1511 326
384 3300045051 Ga0451576_0043352 Ga0451576_0043352_2034_3086 326
385 3300046455 Ga0495603_0129308 Ga0495603_0129308_312_1295 326
386 3300046473 Ga0495582_0121619 Ga0495582_0121619_85_1065 326
387 3300046689 Ga0495613_0168429 Ga0495613_0168429_78_1061 326
388 3300048904 Ga0496101_0026680 Ga0496101_0026680_197_1177 326
389 3300048905 Ga0496102_0241308 Ga0496102_0241308_220_1224 326
390 3300048908 Ga0496105_0057397 Ga0496105_0057397_1099_2079 326
391 3300048909 Ga0496106_0258485 Ga0496106_0258485_313_1296 326
392 3300048911 Ga0496108_0179888 Ga0496108_0179888_503_1483 326
393 3300048912 Ga0496109_0269829 Ga0496109_0269829_489_1472 326
394 3300048913 Ga0496110_0070899 Ga0496110_0070899_1888_2868 326
395 3300048916 Ga0496113_0320698 Ga0496113_0320698_186_1166 326
396 3300048917 Ga0496114_0010933 Ga0496114_0010933_22_1002 326
397 3300048917 Ga0496114_0015050 Ga0496114_0015050_4580_5560 326
398 3300048917 Ga0496114_0386704 Ga0496114_0386704_139_1122 326
399 3300049571 Ga0501034_0008525 Ga0501034_0008525_325_1308 326
400 3300049572 Ga0501036_0053098 Ga0501036_0053098_216_1202 326
401 3300049572 Ga0501036_0122610 Ga0501036_0122610_235_1227 326
402 3300049574 Ga0501038_0162805 Ga0501038_0162805_647_1633 326
403 3300049575 Ga0501039_0042555 Ga0501039_0042555_2103_3089 326
404 3300049575 Ga0501039_0076629 Ga0501039_0076629_1489_2481 326
405 3300049575 Ga0501039_0161778 Ga0501039_0161778_712_1692 326
406 3300049576 Ga0501040_0239606 Ga0501040_0239606_15_1001 326
407 3300049578 Ga0501042_0130623 Ga0501042_0130623_787_1773 326
408 3300049582 Ga0501048_0325571 Ga0501048_0325571_42_1022 326
409 3300049587 Ga0501071_0024982 Ga0501071_0024982_989_1969 326
410 3300049587 Ga0501071_0083402 Ga0501071_0083402_258_1238 326
411 3300049587 Ga0501071_0266883 Ga0501071_0266883_247_1239 326
412 3300049588 Ga0501072_0022970 Ga0501072_0022970_3740_4720 326
413 3300049588 Ga0501072_0043246 Ga0501072_0043246_1389_2381 326
414 3300049588 Ga0501072_0146094 Ga0501072_0146094_149_1135 326
415 3300049590 Ga0501074_0080423 Ga0501074_0080423_287_1267 326
416 3300049590 Ga0501074_0197247 Ga0501074_0197247_14_994 326
417 3300049591 Ga0501075_0101511 Ga0501075_0101511_38_1018 326
418 3300049591 Ga0501075_0153965 Ga0501075_0153965_401_1381 326
419 3300049591 Ga0501075_0309537 Ga0501075_0309537_11_991 326
420 3300049592 Ga0501076_0027790 Ga0501076_0027790_580_1560 326
421 3300049592 Ga0501076_0100469 Ga0501076_0100469_283_1263 326
422 3300049592 Ga0501076_0280631 Ga0501076_0280631_130_1110 326
423 3300049661 Ga0501217_052091 Ga0501217_052091_62_1051 326
424 3300049741 Ga0501079_0046851 Ga0501079_0046851_1259_2245 326
425 3300049741 Ga0501079_0113642 Ga0501079_0113642_128_1129 326
426 3300049742 Ga0501080_0097026 Ga0501080_0097026_77_1057 326
427 3300049743 Ga0501081_0051433 Ga0501081_0051433_1122_2114 326
428 3300049744 Ga0501083_0079659 Ga0501083_0079659_80_1060 326
429 3300049824 Ga0501045_0012267 Ga0501045_0012267_428_1414 326
430 3300049824 Ga0501045_0044747 Ga0501045_0044747_1615_2595 326
431 3300050489 nmdc:mga03683_24526_c1 nmdc:mga03683_24526_c1_451_1437 326
432 3300050491 nmdc:mga00v17_53440_c1 nmdc:mga00v17_53440_c1_556_1542 326
433 3300050493 nmdc:mga0k408_17092_c1 nmdc:mga0k408_17092_c1_897_1883 326
434 3300050493 nmdc:mga0k408_44368_c1 nmdc:mga0k408_44368_c1_848_1834 326
435 3300050494 nmdc:mga06z11_63003_c1 nmdc:mga06z11_63003_c1_536_1522 326
436 3300050507 nmdc:mga05p37_13758_c1 nmdc:mga05p37_13758_c1_160_1140 326
437 3300050507 nmdc:mga05p37_160430_c1 nmdc:mga05p37_160430_c1_1077_2057 326
438 3300050507 nmdc:mga05p37_408531_c1 nmdc:mga05p37_408531_c1_229_1215 326
439 3300050507 nmdc:mga05p37_673675_c1 nmdc:mga05p37_673675_c1_30_1016 326
440 3300050508 nmdc:mga09592_225989_c1 nmdc:mga09592_225989_c1_570_1550 326
441 3300050510 nmdc:mga06r32_251490_c1 nmdc:mga06r32_251490_c1_614_1594 326
442 3300050510 nmdc:mga06r32_258167_c1 nmdc:mga06r32_258167_c1_155_1153 326
443 3300050511 nmdc:mga08y16_7613_c1 nmdc:mga08y16_7613_c1_3241_4233 326
444 3300050512 nmdc:mga0n895_215715_c1 nmdc:mga0n895_215715_c1_929_1918 326
445 3300050512 nmdc:mga0n895_9710_c1 nmdc:mga0n895_9710_c1_6492_7472 326
446 3300050513 nmdc:mga0rr50_12141_c1 nmdc:mga0rr50_12141_c1_898_1878 326
447 3300050513 nmdc:mga0rr50_413357_c1 nmdc:mga0rr50_413357_c1_34_1038 326
448 3300050513 nmdc:mga0rr50_8435_c1 nmdc:mga0rr50_8435_c1_2163_3191 326
449 3300050514 nmdc:mga08x19_124639_c1 nmdc:mga08x19_124639_c1_500_1480 326
450 3300050514 nmdc:mga08x19_20109_c1 nmdc:mga08x19_20109_c1_1336_2316 326
451 3300050514 nmdc:mga08x19_34694_c1 nmdc:mga08x19_34694_c1_1907_2887 326
452 3300050515 nmdc:mga0a205_115742_c1 nmdc:mga0a205_115742_c1_106_1086 326
453 3300050515 nmdc:mga0a205_206533_c1 nmdc:mga0a205_206533_c1_747_1733 326
454 3300050515 nmdc:mga0a205_41438_c2 nmdc:mga0a205_41438_c2_1952_2932 326
455 3300050515 nmdc:mga0a205_50069_c1 nmdc:mga0a205_50069_c1_747_1727 326
456 3300050515 nmdc:mga0a205_75916_c1 nmdc:mga0a205_75916_c1_1647_2627 326
457 3300053078 Ga0495612_0069041 Ga0495612_0069041_442_1422 326
458 3300053085 Ga0495619_0006951 Ga0495619_0006951_4931_5911 326
459 3300053085 Ga0495619_0121918 Ga0495619_0121918_230_1213 326
460 3300054114 Ga0501084_0048856 Ga0501084_0048856_2467_3447 326
461 3300054114 Ga0501084_0213445 Ga0501084_0213445_200_1186 326
462 3300059421 Ga0590071_000695 Ga0590071_000695_6686_7672 326
463 3300059424 Ga0590075_000238 Ga0590075_000238_13303_14289 326
464 3300059424 Ga0590075_011561 Ga0590075_011561_385_1368 326
465 3300059426 Ga0590077_000270 Ga0590077_000270_9246_10232 326
466 3300059426 Ga0590077_003069 Ga0590077_003069_1369_2361 326
467 3300061734 Ga0530510_0007888 Ga0530510_0007888_2628_3629 326
468 3300061734 Ga0530510_0082488 Ga0530510_0082488_761_1753 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

239

0.92

PF07993

NAD_binding_4

Male sterility protein

5

201

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

224

0.86

PF05368

NmrA

NmrA-like family

3

141

0.86

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

268

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

130

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

329

0.77

PF13460

NAD_binding_10

NAD(P)H-binding

7

194

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.9106 1 323
3m2p-assembly3.cif.gz_D the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.9077 1 321
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.9033 1 324
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.9024 1 319
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8974 1 323
ID Description Score Start End Superfamily
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9201 2 77 3.40.50.720
af_P75821_1_335_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9109 1 326 3.40.50.720
af_P75821_1_335_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9083 1 326 3.40.50.720
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9018 1 103 3.40.50.20
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9004 1 73 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A2V8CDQ0-F1-model_v4 Oxidoreductase 0.9876 1 175 GO:0004029
GO:0005737
AF-A0A7W1I475-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9864 1 238 GO:0004029
GO:0005737
AF-A0A2V8CDQ0-F1-model_v4 Oxidoreductase 0.9765 1 175 GO:0004029
GO:0005737
AF-A0A7W1I475-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9663 1 238 GO:0004029
GO:0005737
AF-A0A850H689-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9621 2 326

Feature Viewer

pLDDT pTM Quality
92.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map