F450031
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 235 | 468 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10038141|Ga0105248_100381413 |
| Length | 339 |
| Sequence | VVVLVTGATGFTGGHLARTLAARGHHVRALVRDRRGPDADRSIASSNPELDDVSNSQPIESVTGDLRDAAAVGRALQGVEVVYNIAAVYRQAGLPTETYRAVNALAVGDLVEQAARAGVRRVVHCSTVGVHGDVEHPPADEDAPLRPGDVYQRTKIEGEELARAAAARFGVEVTIARPSGIYGPRDRRLLKLFRNTVRRFPTLGRGDIYYHLTYIDDLVEGFRLCGEHPAAANRTYILAGPQVTRLNDVTAAIADIAGVPPQRWHLPVWPFWLAGAACEAVCAPLGVEPPIFRRRVDFFTKSRAFDITRARTEIGYAPSIGLREGVTRTLHWYREHGWL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 140 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 153 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 154 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 155 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 158 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 159 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 160 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 163 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 164 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 165 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 166 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 228 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 232 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.99 |
| Nodule | 0 |
| Rhizoplane | 2.78 |
| Rhizosphere | 93.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10045958 | 3300005327 | Bacteria | 3533 |
| 2 | Ga0070676_10033959 | 3300005328 | Bacteria | 2927 |
| 3 | Ga0070683_100163156 | 3300005329 | Bacteria | 2114 |
| 4 | Ga0070690_100199281 | 3300005330 | Bacteria | 1392 |
| 5 | Ga0070670_100012446 | 3300005331 | Bacteria | 7281 |
| 6 | Ga0070670_100064103 | 3300005331 | Bacteria | 3153 |
| 7 | Ga0070670_100180755 | 3300005331 | Bacteria | 1831 |
| 8 | Ga0070670_100212058 | 3300005331 | Bacteria | 1684 |
| 9 | Ga0070677_10021044 | 3300005333 | Unclassified | 2387 |
| 10 | Ga0068869_100148837 | 3300005334 | Unclassified | 1814 |
| 11 | Ga0070680_100020787 | 3300005336 | Bacteria | 5208 |
| 12 | Ga0070680_100039705 | 3300005336 | Bacteria | 3807 |
| 13 | Ga0070680_100116958 | 3300005336 | Bacteria | 2223 |
| 14 | Ga0068868_100132169 | 3300005338 | Bacteria | 2043 |
| 15 | Ga0068868_100185058 | 3300005338 | Unclassified | 1730 |
| 16 | Ga0068868_100258141 | 3300005338 | Unclassified | 1469 |
| 17 | Ga0070689_100045359 | 3300005340 | Unclassified | 3385 |
| 18 | Ga0070687_100047427 | 3300005343 | Bacteria | 2204 |
| 19 | Ga0070661_100295247 | 3300005344 | Unclassified | 1260 |
| 20 | Ga0070668_100006466 | 3300005347 | Bacteria | 8688 |
| 21 | Ga0070668_100274683 | 3300005347 | Bacteria | 1406 |
| 22 | Ga0070669_100012602 | 3300005353 | Bacteria | 5999 |
| 23 | Ga0070669_100104682 | 3300005353 | Bacteria | 2139 |
| 24 | Ga0070675_100018823 | 3300005354 | Bacteria | 5498 |
| 25 | Ga0070675_100022500 | 3300005354 | Bacteria | 5037 |
| 26 | Ga0070671_100091001 | 3300005355 | Bacteria | 2554 |
| 27 | Ga0070671_100147941 | 3300005355 | Bacteria | 1983 |
| 28 | Ga0070674_100005716 | 3300005356 | Bacteria | 7212 |
| 29 | Ga0070674_100009206 | 3300005356 | Bacteria | 5908 |
| 30 | Ga0070674_100107178 | 3300005356 | Bacteria | 2046 |
| 31 | Ga0070673_100000364 | 3300005364 | Bacteria | 23738 |
| 32 | Ga0070673_100229164 | 3300005364 | Bacteria | 1611 |
| 33 | Ga0070688_100088325 | 3300005365 | Bacteria | 2021 |
| 34 | Ga0070659_100232062 | 3300005366 | Unclassified | 1525 |
| 35 | Ga0070659_100338725 | 3300005366 | Bacteria | 1260 |
| 36 | Ga0070709_10168600 | 3300005434 | Bacteria | 1528 |
| 37 | Ga0070714_100125955 | 3300005435 | Bacteria | 2284 |
| 38 | Ga0070714_100238744 | 3300005435 | Bacteria | 1677 |
| 39 | Ga0070713_100066442 | 3300005436 | Unclassified | 3033 |
| 40 | Ga0070700_100008186 | 3300005441 | Bacteria | 5692 |
| 41 | Ga0070708_100032869 | 3300005445 | Bacteria | 4503 |
| 42 | Ga0070663_100194972 | 3300005455 | Bacteria | 1578 |
| 43 | Ga0070663_100208041 | 3300005455 | Bacteria | 1531 |
| 44 | Ga0070678_100013004 | 3300005456 | Bacteria | 5198 |
| 45 | Ga0070662_100317675 | 3300005457 | Bacteria | 1269 |
| 46 | Ga0070681_10045461 | 3300005458 | Bacteria | 4392 |
| 47 | Ga0070681_10079771 | 3300005458 | Bacteria | 3229 |
| 48 | Ga0070681_10281795 | 3300005458 | Bacteria | 1572 |
| 49 | Ga0068867_100127989 | 3300005459 | Bacteria | 1970 |
| 50 | Ga0070707_100054869 | 3300005468 | Bacteria | 3821 |
| 51 | Ga0070707_100144685 | 3300005468 | Unclassified | 2314 |
| 52 | Ga0070698_100063281 | 3300005471 | Bacteria | 3731 |
| 53 | Ga0070698_100341759 | 3300005471 | Bacteria | 1428 |
| 54 | Ga0070699_100002365 | 3300005518 | Bacteria | 16923 |
| 55 | Ga0070699_100006877 | 3300005518 | Bacteria | 9894 |
| 56 | Ga0070679_100017472 | 3300005530 | Bacteria | 6943 |
| 57 | Ga0070679_100035234 | 3300005530 | Bacteria | 4965 |
| 58 | Ga0070679_100114398 | 3300005530 | Bacteria | 2683 |
| 59 | Ga0070684_100089041 | 3300005535 | Bacteria | 2743 |
| 60 | Ga0068853_100032033 | 3300005539 | Bacteria | 4451 |
| 61 | Ga0068853_100225188 | 3300005539 | Unclassified | 1714 |
| 62 | Ga0070686_100003397 | 3300005544 | Bacteria | 8730 |
| 63 | Ga0070695_100004825 | 3300005545 | Bacteria | 7935 |
| 64 | Ga0070696_100140962 | 3300005546 | Unclassified | 1762 |
| 65 | Ga0070704_100016780 | 3300005549 | Unclassified | 4637 |
| 66 | Ga0068855_100110549 | 3300005563 | Bacteria | 3155 |
| 67 | Ga0068855_100126106 | 3300005563 | Unclassified | 2927 |
| 68 | Ga0068855_100548972 | 3300005563 | Unclassified | 1251 |
| 69 | Ga0068857_100012955 | 3300005577 | Bacteria | 7268 |
| 70 | Ga0068854_100164955 | 3300005578 | Bacteria | 1719 |
| 71 | Ga0068856_100086677 | 3300005614 | Unclassified | 3112 |
| 72 | Ga0070702_100264217 | 3300005615 | Bacteria | 1173 |
| 73 | Ga0068852_100014753 | 3300005616 | Bacteria | 6031 |
| 74 | Ga0068852_100112946 | 3300005616 | Bacteria | 2473 |
| 75 | Ga0068859_100053090 | 3300005617 | Unclassified | 4075 |
| 76 | Ga0068859_100171905 | 3300005617 | Unclassified | 2248 |
| 77 | Ga0068859_100219271 | 3300005617 | Unclassified | 1990 |
| 78 | Ga0068864_100012773 | 3300005618 | Bacteria | 6942 |
| 79 | Ga0068866_10002163 | 3300005718 | Bacteria | 8179 |
| 80 | Ga0068861_100075513 | 3300005719 | Bacteria | 2624 |
| 81 | Ga0068861_100265471 | 3300005719 | Bacteria | 1471 |
| 82 | Ga0068863_100226041 | 3300005841 | Bacteria | 1804 |
| 83 | Ga0068858_100042970 | 3300005842 | Bacteria | 4191 |
| 84 | Ga0068858_100190946 | 3300005842 | Unclassified | 1936 |
| 85 | Ga0068862_100043541 | 3300005844 | Bacteria | 3828 |
| 86 | Ga0070717_10259327 | 3300006028 | Bacteria | 1538 |
| 87 | Ga0075364_10008709 | 3300006051 | Bacteria | 6069 |
| 88 | Ga0075362_10005347 | 3300006177 | Bacteria | 4692 |
| 89 | Ga0075367_10051224 | 3300006178 | Bacteria | 2440 |
| 90 | Ga0075367_10072703 | 3300006178 | Bacteria | 2071 |
| 91 | Ga0075366_10010882 | 3300006195 | Bacteria | 5118 |
| 92 | Ga0075366_10017584 | 3300006195 | Unclassified | 4117 |
| 93 | Ga0097621_100030731 | 3300006237 | Bacteria | 4255 |
| 94 | Ga0097621_100218189 | 3300006237 | Bacteria | 1661 |
| 95 | Ga0075428_100000010 | 3300006844 | Bacteria | 213631 |
| 96 | Ga0075428_100005848 | 3300006844 | Bacteria | 13665 |
| 97 | Ga0075428_100017492 | 3300006844 | Bacteria | 7920 |
| 98 | Ga0075428_100027805 | 3300006844 | Bacteria | 6257 |
| 99 | Ga0075428_100149848 | 3300006844 | Unclassified | 2534 |
| 100 | Ga0075430_100006615 | 3300006846 | Bacteria | 9768 |
| 101 | Ga0075430_100007270 | 3300006846 | Bacteria | 9350 |
| 102 | Ga0075430_100019004 | 3300006846 | Bacteria | 5846 |
| 103 | Ga0075431_100024135 | 3300006847 | Bacteria | 6226 |
| 104 | Ga0075431_100033593 | 3300006847 | Bacteria | 5286 |
| 105 | Ga0075431_100086176 | 3300006847 | Bacteria | 3241 |
| 106 | Ga0075431_100104108 | 3300006847 | Unclassified | 2929 |
| 107 | Ga0075431_100184829 | 3300006847 | Unclassified | 2138 |
| 108 | Ga0075431_100312565 | 3300006847 | Unclassified | 1586 |
| 109 | Ga0075431_100476101 | 3300006847 | Bacteria | 1242 |
| 110 | Ga0075433_10007642 | 3300006852 | Bacteria | 8585 |
| 111 | Ga0075433_10013631 | 3300006852 | Bacteria | 6617 |
| 112 | Ga0075433_10026199 | 3300006852 | Bacteria | 4934 |
| 113 | Ga0075433_10308285 | 3300006852 | Bacteria | 1401 |
| 114 | Ga0075434_100002153 | 3300006871 | Bacteria | 17151 |
| 115 | Ga0075434_100054041 | 3300006871 | Bacteria | 3990 |
| 116 | Ga0075434_100109666 | 3300006871 | Bacteria | 2770 |
| 117 | Ga0075429_100001697 | 3300006880 | Bacteria | 18198 |
| 118 | Ga0075429_100082922 | 3300006880 | Bacteria | 2795 |
| 119 | Ga0075429_100096000 | 3300006880 | Bacteria | 2586 |
| 120 | Ga0075436_100022198 | 3300006914 | Bacteria | 4359 |
| 121 | Ga0075436_100082361 | 3300006914 | Bacteria | 2232 |
| 122 | Ga0075436_100097479 | 3300006914 | Unclassified | 2045 |
| 123 | Ga0097620_100053088 | 3300006931 | Unclassified | 4075 |
| 124 | Ga0097620_100171914 | 3300006931 | Unclassified | 2248 |
| 125 | Ga0097620_100219267 | 3300006931 | Unclassified | 1990 |
| 126 | Ga0075435_100001847 | 3300007076 | Bacteria | 13744 |
| 127 | Ga0075435_100003420 | 3300007076 | Bacteria | 10764 |
| 128 | Ga0075435_100003471 | 3300007076 | Bacteria | 10690 |
| 129 | Ga0075435_100009122 | 3300007076 | Bacteria | 7161 |
| 130 | Ga0075435_100118979 | 3300007076 | Unclassified | 2203 |
| 131 | Ga0105240_10049469 | 3300009093 | Bacteria | 5305 |
| 132 | Ga0105240_10110142 | 3300009093 | Bacteria | 3333 |
| 133 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 134 | Ga0111539_10000740 | 3300009094 | Bacteria | 42401 |
| 135 | Ga0111539_10016952 | 3300009094 | Bacteria | 9017 |
| 136 | Ga0111539_10018031 | 3300009094 | Bacteria | 8744 |
| 137 | Ga0111539_10133827 | 3300009094 | Bacteria | 2903 |
| 138 | Ga0111539_10347769 | 3300009094 | Bacteria | 1726 |
| 139 | Ga0114129_10000186 | 3300009147 | Bacteria | 69381 |
| 140 | Ga0114129_10001901 | 3300009147 | Bacteria | 28450 |
| 141 | Ga0114129_10002876 | 3300009147 | Bacteria | 24089 |
| 142 | Ga0114129_10005014 | 3300009147 | Bacteria | 18631 |
| 143 | Ga0114129_10011063 | 3300009147 | Bacteria | 12855 |
| 144 | Ga0114129_10015389 | 3300009147 | Bacteria | 10885 |
| 145 | Ga0114129_10016555 | 3300009147 | Bacteria | 10499 |
| 146 | Ga0114129_10041815 | 3300009147 | Bacteria | 6453 |
| 147 | Ga0114129_10045272 | 3300009147 | Bacteria | 6186 |
| 148 | Ga0114129_10061709 | 3300009147 | Bacteria | 5239 |
| 149 | Ga0114129_10077937 | 3300009147 | Bacteria | 4609 |
| 150 | Ga0114129_10081377 | 3300009147 | Bacteria | 4501 |
| 151 | Ga0114129_10166295 | 3300009147 | Bacteria | 3010 |
| 152 | Ga0114129_10246699 | 3300009147 | Bacteria | 2399 |
| 153 | Ga0114129_10285710 | 3300009147 | Bacteria | 2203 |
| 154 | Ga0114129_10393487 | 3300009147 | Unclassified | 1827 |
| 155 | Ga0114129_10507127 | 3300009147 | Bacteria | 1575 |
| 156 | Ga0105242_10026762 | 3300009176 | Bacteria | 4573 |
| 157 | Ga0105242_10070801 | 3300009176 | Unclassified | 2892 |
| 158 | Ga0105242_10357975 | 3300009176 | Bacteria | 1350 |
| 159 | Ga0105248_10012674 | 3300009177 | Bacteria | 9303 |
| 160 | Ga0105248_10037164 | 3300009177 | Bacteria | 5446 |
| 161 | Ga0105248_10038141 | 3300009177 | Bacteria | 5376 |
| 162 | Ga0105248_10039235 | 3300009177 | Bacteria | 5303 |
| 163 | Ga0105248_10097853 | 3300009177 | Bacteria | 3306 |
| 164 | Ga0105248_10119226 | 3300009177 | Bacteria | 2976 |
| 165 | Ga0105248_10197941 | 3300009177 | Bacteria | 2264 |
| 166 | Ga0105248_10240651 | 3300009177 | Bacteria | 2037 |
| 167 | Ga0105248_10793578 | 3300009177 | Bacteria | 1069 |
| 168 | Ga0105238_10152609 | 3300009551 | Bacteria | 2285 |
| 169 | Ga0105249_10000180 | 3300009553 | Bacteria | 74064 |
| 170 | Ga0105249_10213806 | 3300009553 | Unclassified | 1894 |
| 171 | Ga0105239_10407242 | 3300010375 | Bacteria | 1540 |
| 172 | Ga0105239_10519345 | 3300010375 | Unclassified | 1355 |
| 173 | Ga0157370_10016812 | 3300013104 | Bacteria | 7395 |
| 174 | Ga0157369_10050848 | 3300013105 | Bacteria | 4486 |
| 175 | Ga0157374_10050191 | 3300013296 | Bacteria | 3878 |
| 176 | Ga0157372_10039711 | 3300013307 | Bacteria | 5195 |
| 177 | Ga0157372_10163827 | 3300013307 | Bacteria | 2570 |
| 178 | Ga0163163_10122097 | 3300014325 | Bacteria | 2639 |
| 179 | Ga0163163_10134792 | 3300014325 | Bacteria | 2510 |
| 180 | Ga0157380_10020295 | 3300014326 | Bacteria | 4965 |
| 181 | Ga0182008_10007127 | 3300014497 | Bacteria | 6191 |
| 182 | Ga0157379_10133360 | 3300014968 | Bacteria | 2237 |
| 183 | Ga0157376_10097229 | 3300014969 | Bacteria | 2564 |
| 184 | Ga0157376_10108041 | 3300014969 | Bacteria | 2443 |
| 185 | Ga0163161_10104789 | 3300017792 | Bacteria | 2109 |
| 186 | Ga0207697_10004761 | 3300025315 | Bacteria | 6420 |
| 187 | Ga0207682_10066027 | 3300025893 | Bacteria | 1524 |
| 188 | Ga0207688_10106301 | 3300025901 | Unclassified | 1625 |
| 189 | Ga0207699_10256131 | 3300025906 | Bacteria | 1208 |
| 190 | Ga0207645_10018483 | 3300025907 | Bacteria | 4585 |
| 191 | Ga0207707_10001197 | 3300025912 | Bacteria | 24415 |
| 192 | Ga0207707_10025762 | 3300025912 | Bacteria | 5143 |
| 193 | Ga0207707_10026581 | 3300025912 | Bacteria | 5058 |
| 194 | Ga0207707_10067522 | 3300025912 | Unclassified | 3115 |
| 195 | Ga0207707_10110672 | 3300025912 | Bacteria | 2401 |
| 196 | Ga0207660_10134685 | 3300025917 | Unclassified | 1884 |
| 197 | Ga0207662_10005644 | 3300025918 | Bacteria | 6690 |
| 198 | Ga0207662_10059744 | 3300025918 | Bacteria | 2285 |
| 199 | Ga0207657_10008607 | 3300025919 | Bacteria | 10331 |
| 200 | Ga0207657_10139619 | 3300025919 | Bacteria | 1980 |
| 201 | Ga0207649_10216311 | 3300025920 | Unclassified | 1362 |
| 202 | Ga0207652_10005510 | 3300025921 | Bacteria | 10269 |
| 203 | Ga0207652_10047117 | 3300025921 | Bacteria | 3681 |
| 204 | Ga0207646_10058487 | 3300025922 | Bacteria | 3443 |
| 205 | Ga0207681_10020723 | 3300025923 | Bacteria | 4171 |
| 206 | Ga0207681_10020728 | 3300025923 | Bacteria | 4170 |
| 207 | Ga0207681_10147575 | 3300025923 | Unclassified | 1759 |
| 208 | Ga0207694_10015340 | 3300025924 | Bacteria | 5781 |
| 209 | Ga0207650_10006334 | 3300025925 | Bacteria | 8065 |
| 210 | Ga0207650_10034957 | 3300025925 | Bacteria | 3646 |
| 211 | Ga0207650_10077608 | 3300025925 | Bacteria | 2511 |
| 212 | Ga0207659_10113501 | 3300025926 | Bacteria | 2064 |
| 213 | Ga0207659_10179399 | 3300025926 | Unclassified | 1677 |
| 214 | Ga0207687_10069947 | 3300025927 | Bacteria | 2504 |
| 215 | Ga0207664_10118792 | 3300025929 | Bacteria | 2209 |
| 216 | Ga0207664_10161072 | 3300025929 | Bacteria | 1914 |
| 217 | Ga0207664_10254574 | 3300025929 | Bacteria | 1533 |
| 218 | Ga0207644_10062463 | 3300025931 | Bacteria | 2702 |
| 219 | Ga0207706_10024368 | 3300025933 | Bacteria | 5425 |
| 220 | Ga0207706_10147384 | 3300025933 | Bacteria | 2070 |
| 221 | Ga0207686_10102283 | 3300025934 | Bacteria | 1915 |
| 222 | Ga0207669_10003027 | 3300025937 | Bacteria | 7236 |
| 223 | Ga0207669_10132653 | 3300025937 | Bacteria | 1715 |
| 224 | Ga0207691_10011607 | 3300025940 | Bacteria | 8456 |
| 225 | Ga0207691_10157129 | 3300025940 | Bacteria | 1996 |
| 226 | Ga0207711_10010730 | 3300025941 | Bacteria | 7620 |
| 227 | Ga0207711_10035585 | 3300025941 | Bacteria | 4222 |
| 228 | Ga0207711_10350226 | 3300025941 | Bacteria | 1367 |
| 229 | Ga0207711_10358082 | 3300025941 | Bacteria | 1351 |
| 230 | Ga0207661_10176850 | 3300025944 | Bacteria | 1861 |
| 231 | Ga0207661_10319225 | 3300025944 | Unclassified | 1396 |
| 232 | Ga0207667_10266700 | 3300025949 | Bacteria | 1751 |
| 233 | Ga0207667_10325640 | 3300025949 | Bacteria | 1569 |
| 234 | Ga0207667_10524856 | 3300025949 | Unclassified | 1199 |
| 235 | Ga0207651_10016602 | 3300025960 | Bacteria | 4319 |
| 236 | Ga0207712_10000391 | 3300025961 | Bacteria | 38113 |
| 237 | Ga0207668_10026640 | 3300025972 | Bacteria | 3756 |
| 238 | Ga0207668_10058711 | 3300025972 | Bacteria | 2691 |
| 239 | Ga0207668_10080832 | 3300025972 | Bacteria | 2356 |
| 240 | Ga0207677_10080150 | 3300026023 | Bacteria | 2338 |
| 241 | Ga0207677_10203039 | 3300026023 | Unclassified | 1577 |
| 242 | Ga0207703_10158898 | 3300026035 | Unclassified | 1978 |
| 243 | Ga0207639_10033552 | 3300026041 | Bacteria | 3788 |
| 244 | Ga0207639_10095365 | 3300026041 | Bacteria | 2391 |
| 245 | Ga0207678_10073653 | 3300026067 | Bacteria | 2927 |
| 246 | Ga0207708_10008855 | 3300026075 | Bacteria | 7450 |
| 247 | Ga0207708_10143038 | 3300026075 | Bacteria | 1878 |
| 248 | Ga0207702_10133036 | 3300026078 | Unclassified | 2240 |
| 249 | Ga0207648_10113819 | 3300026089 | Bacteria | 2376 |
| 250 | Ga0207648_10177926 | 3300026089 | Bacteria | 1882 |
| 251 | Ga0207676_10109984 | 3300026095 | Bacteria | 2304 |
| 252 | Ga0207676_10282327 | 3300026095 | Unclassified | 1508 |
| 253 | Ga0207674_10019855 | 3300026116 | Bacteria | 7271 |
| 254 | Ga0207675_100071576 | 3300026118 | Bacteria | 3242 |
| 255 | Ga0207675_100086342 | 3300026118 | Bacteria | 2946 |
| 256 | Ga0207675_100155857 | 3300026118 | Bacteria | 2176 |
| 257 | Ga0207683_10193248 | 3300026121 | Unclassified | 1848 |
| 258 | Ga0207683_10425180 | 3300026121 | Unclassified | 1224 |
| 259 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 260 | Ga0268265_10021748 | 3300028380 | Bacteria | 4498 |
| 261 | Ga0268265_10044716 | 3300028380 | Bacteria | 3299 |
| 262 | Ga0268264_10343281 | 3300028381 | Unclassified | 1419 |
| 263 | Ga0307408_100053992 | 3300031548 | Unclassified | 2904 |
| 264 | Ga0307408_100096187 | 3300031548 | Bacteria | 2246 |
| 265 | Ga0307408_100119209 | 3300031548 | Unclassified | 2041 |
| 266 | Ga0316576_10055104 | 3300031727 | Bacteria | 2901 |
| 267 | Ga0307405_10262025 | 3300031731 | Archaea | 1292 |
| 268 | Ga0307407_10071003 | 3300031903 | Bacteria | 2072 |
| 269 | Ga0307416_100102635 | 3300032002 | Unclassified | 2494 |
| 270 | Ga0307416_100132389 | 3300032002 | Bacteria | 2248 |
| 271 | Ga0307416_100151667 | 3300032002 | Bacteria | 2126 |
| 272 | Ga0307416_100268134 | 3300032002 | Bacteria | 1674 |
| 273 | Ga0307416_100309139 | 3300032002 | Unclassified | 1576 |
| 274 | Ga0307414_10315210 | 3300032004 | Bacteria | 1329 |
| 275 | Ga0307411_10033774 | 3300032005 | Bacteria | 3176 |
| 276 | Ga0307411_10063641 | 3300032005 | Bacteria | 2466 |
| 277 | Ga0307411_10246828 | 3300032005 | Archaea | 1401 |
| 278 | Ga0307411_10303673 | 3300032005 | Bacteria | 1281 |
| 279 | Ga0373930_0014627 | 3300034816 | Unclassified | 1464 |
| 280 | Ga0373958_0001973 | 3300034819 | Unclassified | 2824 |
| 281 | Ga0373929_0002955 | 3300035085 | Bacteria | 3095 |
| 282 | Ga0373940_0017366 | 3300035088 | Bacteria | 1793 |
| 283 | Ga0373949_0002450 | 3300035090 | Bacteria | 4762 |
| 284 | Ga0373952_0002536 | 3300035092 | Bacteria | 3288 |
| 285 | Ga0373941_0003558 | 3300035115 | Unclassified | 3541 |
| 286 | Ga0373960_0064791 | 3300035121 | Unclassified | 1116 |
| 287 | Ga0373942_0001577 | 3300035207 | Bacteria | 5851 |
| 288 | Ga0373961_0002480 | 3300035241 | Bacteria | 4772 |
| 289 | Ga0373962_0001413 | 3300035242 | Bacteria | 5669 |
| 290 | Ga0373935_0299968 | 3300035692 | Bacteria | 1135 |
| 291 | Ga0373937_0002111 | 3300036401 | Bacteria | 16623 |
| 292 | Ga0373937_0173019 | 3300036401 | Unclassified | 2026 |
| 293 | Ga0373925_0006423 | 3300037068 | Bacteria | 8650 |
| 294 | Ga0395901_0384500 | 3300038443 | Unclassified | 1444 |
| 295 | Ga0400490_24668 | 3300038726 | Bacteria | 15912 |
| 296 | Ga0400490_33866 | 3300038726 | Bacteria | 4727 |
| 297 | Ga0400488_49291 | 3300038741 | Unclassified | 4078 |
| 298 | Ga0400489_93634 | 3300039093 | Bacteria | 5702 |
| 299 | Ga0451802_1909252 | 3300041460 | Bacteria | 1279 |
| 300 | Ga0451853_2472702 | 3300041512 | Bacteria | 1528 |
| 301 | Ga0439449_0048723 | 3300042007 | Unclassified | 1568 |
| 302 | Ga0450923_006257 | 3300042125 | Bacteria | 1964 |
| 303 | Ga0450894_000870 | 3300042131 | Bacteria | 4824 |
| 304 | Ga0450896_000612 | 3300042133 | Bacteria | 3879 |
| 305 | Ga0439446_0032666 | 3300042156 | Bacteria | 1510 |
| 306 | Ga0450908_017169 | 3300042184 | Bacteria | 1286 |
| 307 | Ga0439464_0008661 | 3300042439 | Unclassified | 2666 |
| 308 | Ga0450918_007760 | 3300042531 | Bacteria | 1892 |
| 309 | Ga0451577_0007418 | 3300042876 | Bacteria | 10772 |
| 310 | Ga0439440_0009888 | 3300042993 | Unclassified | 1983 |
| 311 | Ga0451576_0043352 | 3300045051 | Bacteria | 4748 |
| 312 | Ga0451576_0155586 | 3300045051 | Unclassified | 2385 |
| 313 | Ga0451576_0767568 | 3300045051 | Unclassified | 1013 |
| 314 | Ga0466967_0294065 | 3300045976 | Unclassified | 1561 |
| 315 | Ga0495603_0129308 | 3300046455 | Bacteria | 1471 |
| 316 | Ga0495582_0121619 | 3300046473 | Bacteria | 1471 |
| 317 | Ga0495618_0143215 | 3300046514 | Unclassified | 1529 |
| 318 | Ga0495628_0060447 | 3300046516 | Unclassified | 2973 |
| 319 | Ga0495630_0142479 | 3300046517 | Bacteria | 1823 |
| 320 | Ga0495640_0158572 | 3300046533 | Unclassified | 1451 |
| 321 | Ga0495647_0117793 | 3300046681 | Unclassified | 1114 |
| 322 | Ga0495613_0168429 | 3300046689 | Unclassified | 1556 |
| 323 | Ga0495674_0146146 | 3300047319 | Bacteria | 1985 |
| 324 | Ga0495676_0217108 | 3300047321 | Unclassified | 1320 |
| 325 | Ga0496101_0026680 | 3300048904 | Bacteria | 4018 |
| 326 | Ga0496102_0241308 | 3300048905 | Bacteria | 1704 |
| 327 | Ga0496105_0057397 | 3300048908 | Bacteria | 3215 |
| 328 | Ga0496105_0167883 | 3300048908 | Bacteria | 1800 |
| 329 | Ga0496106_0258485 | 3300048909 | Bacteria | 1393 |
| 330 | Ga0496108_0179888 | 3300048911 | Bacteria | 1831 |
| 331 | Ga0496109_0269829 | 3300048912 | Bacteria | 1603 |
| 332 | Ga0496110_0070899 | 3300048913 | Bacteria | 3089 |
| 333 | Ga0496113_0320698 | 3300048916 | Unclassified | 1242 |
| 334 | Ga0496114_0010933 | 3300048917 | Bacteria | 7235 |
| 335 | Ga0496114_0015050 | 3300048917 | Bacteria | 6219 |
| 336 | Ga0496114_0386704 | 3300048917 | Bacteria | 1239 |
| 337 | Ga0501031_0089169 | 3300049568 | Unclassified | 2011 |
| 338 | Ga0501034_0008525 | 3300049571 | Bacteria | 10818 |
| 339 | Ga0501036_0053098 | 3300049572 | Bacteria | 3433 |
| 340 | Ga0501036_0122610 | 3300049572 | Bacteria | 2195 |
| 341 | Ga0501036_0134431 | 3300049572 | Unclassified | 2087 |
| 342 | Ga0501038_0034649 | 3300049574 | Unclassified | 4438 |
| 343 | Ga0501038_0062277 | 3300049574 | Unclassified | 3188 |
| 344 | Ga0501038_0162805 | 3300049574 | Unclassified | 1812 |
| 345 | Ga0501039_0011216 | 3300049575 | Bacteria | 6830 |
| 346 | Ga0501039_0042555 | 3300049575 | Unclassified | 3509 |
| 347 | Ga0501039_0076629 | 3300049575 | Bacteria | 2600 |
| 348 | Ga0501039_0161778 | 3300049575 | Unclassified | 1760 |
| 349 | Ga0501039_0179743 | 3300049575 | Unclassified | 1664 |
| 350 | Ga0501040_0000054 | 3300049576 | Bacteria | 53380 |
| 351 | Ga0501040_0061779 | 3300049576 | Unclassified | 2577 |
| 352 | Ga0501040_0239606 | 3300049576 | Bacteria | 1293 |
| 353 | Ga0501041_0005544 | 3300049577 | Bacteria | 7382 |
| 354 | Ga0501042_0000588 | 3300049578 | Bacteria | 19290 |
| 355 | Ga0501042_0039120 | 3300049578 | Bacteria | 3369 |
| 356 | Ga0501042_0130623 | 3300049578 | Unclassified | 1810 |
| 357 | Ga0501046_0005971 | 3300049580 | Bacteria | 10839 |
| 358 | Ga0501048_0325571 | 3300049582 | Unclassified | 1095 |
| 359 | Ga0501067_0027574 | 3300049583 | Unclassified | 3148 |
| 360 | Ga0501067_0202227 | 3300049583 | Bacteria | 1106 |
| 361 | Ga0501071_0006452 | 3300049587 | Bacteria | 7614 |
| 362 | Ga0501071_0024982 | 3300049587 | Unclassified | 4183 |
| 363 | Ga0501071_0083402 | 3300049587 | Bacteria | 2341 |
| 364 | Ga0501071_0266883 | 3300049587 | Unclassified | 1293 |
| 365 | Ga0501072_0012117 | 3300049588 | Bacteria | 6587 |
| 366 | Ga0501072_0022970 | 3300049588 | Unclassified | 4842 |
| 367 | Ga0501072_0043246 | 3300049588 | Bacteria | 3540 |
| 368 | Ga0501072_0125430 | 3300049588 | Bacteria | 2045 |
| 369 | Ga0501072_0146094 | 3300049588 | Unclassified | 1885 |
| 370 | Ga0501073_0004475 | 3300049589 | Bacteria | 10498 |
| 371 | Ga0501074_0010625 | 3300049590 | Bacteria | 6684 |
| 372 | Ga0501074_0080423 | 3300049590 | Unclassified | 2338 |
| 373 | Ga0501074_0197247 | 3300049590 | Bacteria | 1435 |
| 374 | Ga0501075_0004583 | 3300049591 | Bacteria | 9369 |
| 375 | Ga0501075_0014855 | 3300049591 | Bacteria | 5584 |
| 376 | Ga0501075_0101511 | 3300049591 | Bacteria | 2185 |
| 377 | Ga0501075_0153965 | 3300049591 | Bacteria | 1753 |
| 378 | Ga0501075_0309537 | 3300049591 | Bacteria | 1204 |
| 379 | Ga0501076_0018865 | 3300049592 | Bacteria | 5264 |
| 380 | Ga0501076_0027790 | 3300049592 | Unclassified | 4387 |
| 381 | Ga0501076_0100469 | 3300049592 | Bacteria | 2331 |
| 382 | Ga0501076_0261942 | 3300049592 | Bacteria | 1416 |
| 383 | Ga0501076_0280631 | 3300049592 | Bacteria | 1365 |
| 384 | Ga0501217_052091 | 3300049661 | Archaea | 1073 |
| 385 | Ga0501079_0022067 | 3300049741 | Unclassified | 4878 |
| 386 | Ga0501079_0046086 | 3300049741 | Bacteria | 3364 |
| 387 | Ga0501079_0046851 | 3300049741 | Unclassified | 3336 |
| 388 | Ga0501079_0113642 | 3300049741 | Bacteria | 2105 |
| 389 | Ga0501080_0038922 | 3300049742 | Unclassified | 4438 |
| 390 | Ga0501080_0097026 | 3300049742 | Bacteria | 2736 |
| 391 | Ga0501081_0000275 | 3300049743 | Bacteria | 27110 |
| 392 | Ga0501081_0012623 | 3300049743 | Bacteria | 5554 |
| 393 | Ga0501081_0051433 | 3300049743 | Bacteria | 2842 |
| 394 | Ga0501081_0185597 | 3300049743 | Unclassified | 1505 |
| 395 | Ga0501083_0079659 | 3300049744 | Bacteria | 2172 |
| 396 | Ga0501035_0249402 | 3300049822 | Unclassified | 1508 |
| 397 | Ga0501045_0009262 | 3300049824 | Bacteria | 6886 |
| 398 | Ga0501045_0012267 | 3300049824 | Bacteria | 6035 |
| 399 | Ga0501045_0025057 | 3300049824 | Bacteria | 4285 |
| 400 | Ga0501045_0044747 | 3300049824 | Unclassified | 3225 |
| 401 | nmdc:mga03683_24526_c1 | 3300050489 | Bacteria | 2361 |
| 402 | nmdc:mga00v17_53440_c1 | 3300050491 | Bacteria | 2462 |
| 403 | nmdc:mga0k408_17092_c1 | 3300050493 | Bacteria | 4035 |
| 404 | nmdc:mga0k408_44368_c1 | 3300050493 | Bacteria | 2564 |
| 405 | nmdc:mga06z11_63003_c1 | 3300050494 | Bacteria | 1939 |
| 406 | nmdc:mga05p37_127484_c1 | 3300050507 | Unclassified | 3124 |
| 407 | nmdc:mga05p37_13758_c1 | 3300050507 | Bacteria | 9694 |
| 408 | nmdc:mga05p37_139909_c1 | 3300050507 | Bacteria | 2966 |
| 409 | nmdc:mga05p37_1524_c1 | 3300050507 | Bacteria | 26970 |
| 410 | nmdc:mga05p37_160430_c1 | 3300050507 | Unclassified | 2747 |
| 411 | nmdc:mga05p37_19222_c1 | 3300050507 | Bacteria | 8264 |
| 412 | nmdc:mga05p37_197657_c1 | 3300050507 | Bacteria | 2438 |
| 413 | nmdc:mga05p37_408531_c1 | 3300050507 | Bacteria | 1583 |
| 414 | nmdc:mga05p37_43881_c1 | 3300050507 | Bacteria | 5501 |
| 415 | nmdc:mga05p37_5890_c1 | 3300050507 | Bacteria | 14416 |
| 416 | nmdc:mga05p37_673675_c1 | 3300050507 | Bacteria | 1154 |
| 417 | nmdc:mga05p37_81565_c1 | 3300050507 | Bacteria | 3984 |
| 418 | nmdc:mga09592_2193_c1 | 3300050508 | Bacteria | 15720 |
| 419 | nmdc:mga09592_225989_c1 | 3300050508 | Bacteria | 1622 |
| 420 | nmdc:mga09592_35715_c1 | 3300050508 | Bacteria | 4161 |
| 421 | nmdc:mga09592_88019_c1 | 3300050508 | Bacteria | 2652 |
| 422 | nmdc:mga0qj67_308909_c1 | 3300050509 | Bacteria | 1281 |
| 423 | nmdc:mga0qj67_5993_c1 | 3300050509 | Bacteria | 8907 |
| 424 | nmdc:mga06r32_106074_c1 | 3300050510 | Unclassified | 2760 |
| 425 | nmdc:mga06r32_147115_c2 | 3300050510 | Unclassified | 1605 |
| 426 | nmdc:mga06r32_251490_c1 | 3300050510 | Unclassified | 1755 |
| 427 | nmdc:mga06r32_258167_c1 | 3300050510 | Bacteria | 1730 |
| 428 | nmdc:mga06r32_615681_c1 | 3300050510 | Archaea | 1056 |
| 429 | nmdc:mga06r32_88458_c1 | 3300050510 | Unclassified | 3023 |
| 430 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 431 | nmdc:mga08y16_4666_c1 | 3300050511 | Bacteria | 14275 |
| 432 | nmdc:mga08y16_7613_c1 | 3300050511 | Bacteria | 11333 |
| 433 | nmdc:mga0n895_215715_c1 | 3300050512 | Bacteria | 1949 |
| 434 | nmdc:mga0n895_65095_c1 | 3300050512 | Bacteria | 3607 |
| 435 | nmdc:mga0n895_9710_c1 | 3300050512 | Bacteria | 8439 |
| 436 | nmdc:mga0rr50_12141_c1 | 3300050513 | Bacteria | 5553 |
| 437 | nmdc:mga0rr50_413357_c1 | 3300050513 | Bacteria | 1141 |
| 438 | nmdc:mga0rr50_8435_c1 | 3300050513 | Bacteria | 6415 |
| 439 | nmdc:mga08x19_124639_c1 | 3300050514 | Bacteria | 1729 |
| 440 | nmdc:mga08x19_20109_c1 | 3300050514 | Unclassified | 4109 |
| 441 | nmdc:mga08x19_34694_c1 | 3300050514 | Unclassified | 3190 |
| 442 | nmdc:mga0a205_115742_c1 | 3300050515 | Unclassified | 1102 |
| 443 | nmdc:mga0a205_206533_c1 | 3300050515 | Bacteria | 1853 |
| 444 | nmdc:mga0a205_41438_c2 | 3300050515 | Bacteria | 3459 |
| 445 | nmdc:mga0a205_436253_c1 | 3300050515 | Unclassified | 1171 |
| 446 | nmdc:mga0a205_50069_c1 | 3300050515 | Unclassified | 4033 |
| 447 | nmdc:mga0a205_75916_c1 | 3300050515 | Bacteria | 3247 |
| 448 | Ga0495612_0069041 | 3300053078 | Bacteria | 1471 |
| 449 | Ga0495619_0006951 | 3300053085 | Bacteria | 7159 |
| 450 | Ga0495619_0121918 | 3300053085 | Bacteria | 1788 |
| 451 | Ga0500641_0001751 | 3300053096 | Bacteria | 7699 |
| 452 | Ga0500555_012739 | 3300053103 | Unclassified | 2421 |
| 453 | Ga0500556_0011191 | 3300053104 | Bacteria | 2652 |
| 454 | Ga0501084_0007489 | 3300054114 | Bacteria | 9001 |
| 455 | Ga0501084_0048856 | 3300054114 | Bacteria | 3542 |
| 456 | Ga0501084_0137355 | 3300054114 | Unclassified | 2058 |
| 457 | Ga0501084_0213445 | 3300054114 | Bacteria | 1628 |
| 458 | Ga0590071_000695 | 3300059421 | Bacteria | 9562 |
| 459 | Ga0590071_029994 | 3300059421 | Unclassified | 1294 |
| 460 | Ga0590075_000238 | 3300059424 | Bacteria | 15479 |
| 461 | Ga0590075_011561 | 3300059424 | Bacteria | 2135 |
| 462 | Ga0590077_000270 | 3300059426 | Bacteria | 14724 |
| 463 | Ga0590077_003069 | 3300059426 | Bacteria | 3497 |
| 464 | Ga0501082_0124721 | 3300060353 | Unclassified | 2233 |
| 465 | Ga0530510_0002943 | 3300061734 | Bacteria | 11678 |
| 466 | Ga0530510_0007888 | 3300061734 | Bacteria | 7426 |
| 467 | Ga0530510_0018969 | 3300061734 | Unclassified | 4878 |
| 468 | Ga0530510_0082488 | 3300061734 | Bacteria | 2341 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053104 | Ga0500556_0011191 | Ga0500556_0011191_1834_2640 | 268 |
| 2 | 3300045051 | Ga0451576_0767568 | Ga0451576_0767568_155_991 | 278 |
| 3 | 3300005356 | Ga0070674_100005716 | Ga0070674_1000057163 | 279 |
| 4 | 3300025937 | Ga0207669_10003027 | Ga0207669_100030277 | 279 |
| 5 | 3300025972 | Ga0207668_10058711 | Ga0207668_100587113 | 279 |
| 6 | 3300035088 | Ga0373940_0017366 | Ga0373940_0017366_880_1728 | 282 |
| 7 | 3300035121 | Ga0373960_0064791 | Ga0373960_0064791_61_909 | 282 |
| 8 | 3300005617 | Ga0068859_100219271 | Ga0068859_1002192712 | 284 |
| 9 | 3300006931 | Ga0097620_100219267 | Ga0097620_1002192672 | 284 |
| 10 | 3300026095 | Ga0207676_10282327 | Ga0207676_102823272 | 284 |
| 11 | 3300009177 | Ga0105248_10197941 | Ga0105248_101979411 | 287 |
| 12 | 3300032002 | Ga0307416_100151667 | Ga0307416_1001516673 | 287 |
| 13 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_49435_50313 | 292 |
| 14 | 3300005331 | Ga0070670_100064103 | Ga0070670_1000641033 | 296 |
| 15 | 3300005618 | Ga0068864_100012773 | Ga0068864_1000127735 | 296 |
| 16 | 3300006195 | Ga0075366_10017584 | Ga0075366_100175842 | 296 |
| 17 | 3300026095 | Ga0207676_10109984 | Ga0207676_101099843 | 296 |
| 18 | 3300005366 | Ga0070659_100338725 | Ga0070659_1003387252 | 297 |
| 19 | 3300026121 | Ga0207683_10425180 | Ga0207683_104251802 | 297 |
| 20 | 3300035692 | Ga0373935_0299968 | Ga0373935_0299968_67_960 | 297 |
| 21 | 3300049583 | Ga0501067_0202227 | Ga0501067_0202227_99_992 | 297 |
| 22 | 3300034816 | Ga0373930_0014627 | Ga0373930_0014627_10_981 | 299 |
| 23 | 3300046517 | Ga0495630_0142479 | Ga0495630_0142479_10_930 | 299 |
| 24 | 3300050510 | nmdc:mga06r32_615681_c1 | nmdc:mga06r32_615681_c1_56_955 | 299 |
| 25 | 3300005331 | Ga0070670_100212058 | Ga0070670_1002120582 | 300 |
| 26 | 3300005353 | Ga0070669_100104682 | Ga0070669_1001046821 | 300 |
| 27 | 3300005364 | Ga0070673_100229164 | Ga0070673_1002291642 | 300 |
| 28 | 3300005455 | Ga0070663_100194972 | Ga0070663_1001949722 | 300 |
| 29 | 3300005455 | Ga0070663_100208041 | Ga0070663_1002080412 | 300 |
| 30 | 3300005718 | Ga0068866_10002163 | Ga0068866_100021633 | 300 |
| 31 | 3300005719 | Ga0068861_100265471 | Ga0068861_1002654711 | 300 |
| 32 | 3300009147 | Ga0114129_10015389 | Ga0114129_100153892 | 300 |
| 33 | 3300009553 | Ga0105249_10213806 | Ga0105249_102138062 | 300 |
| 34 | 3300025925 | Ga0207650_10034957 | Ga0207650_100349574 | 300 |
| 35 | 3300025937 | Ga0207669_10132653 | Ga0207669_101326532 | 300 |
| 36 | 3300025972 | Ga0207668_10080832 | Ga0207668_100808322 | 300 |
| 37 | 3300026118 | Ga0207675_100155857 | Ga0207675_1001558573 | 300 |
| 38 | 3300048908 | Ga0496105_0167883 | Ga0496105_0167883_365_1267 | 300 |
| 39 | 3300049574 | Ga0501038_0034649 | Ga0501038_0034649_3422_4324 | 300 |
| 40 | 3300049575 | Ga0501039_0011216 | Ga0501039_0011216_3053_3955 | 300 |
| 41 | 3300049577 | Ga0501041_0005544 | Ga0501041_0005544_127_1029 | 300 |
| 42 | 3300049578 | Ga0501042_0039120 | Ga0501042_0039120_2309_3211 | 300 |
| 43 | 3300049580 | Ga0501046_0005971 | Ga0501046_0005971_710_1612 | 300 |
| 44 | 3300049588 | Ga0501072_0125430 | Ga0501072_0125430_364_1266 | 300 |
| 45 | 3300049590 | Ga0501074_0010625 | Ga0501074_0010625_2719_3621 | 300 |
| 46 | 3300049591 | Ga0501075_0004583 | Ga0501075_0004583_5877_6779 | 300 |
| 47 | 3300049741 | Ga0501079_0022067 | Ga0501079_0022067_2591_3493 | 300 |
| 48 | 3300049742 | Ga0501080_0038922 | Ga0501080_0038922_1883_2785 | 300 |
| 49 | 3300049743 | Ga0501081_0000275 | Ga0501081_0000275_22013_22915 | 300 |
| 50 | 3300049743 | Ga0501081_0185597 | Ga0501081_0185597_509_1411 | 300 |
| 51 | 3300049822 | Ga0501035_0249402 | Ga0501035_0249402_542_1444 | 300 |
| 52 | 3300049824 | Ga0501045_0009262 | Ga0501045_0009262_314_1216 | 300 |
| 53 | 3300050507 | nmdc:mga05p37_81565_c1 | nmdc:mga05p37_81565_c1_2644_3546 | 300 |
| 54 | 3300054114 | Ga0501084_0007489 | Ga0501084_0007489_2393_3295 | 300 |
| 55 | 3300061734 | Ga0530510_0002943 | Ga0530510_0002943_7428_8330 | 300 |
| 56 | 3300005468 | Ga0070707_100054869 | Ga0070707_1000548694 | 301 |
| 57 | 3300005545 | Ga0070695_100004825 | Ga0070695_1000048253 | 301 |
| 58 | 3300005546 | Ga0070696_100140962 | Ga0070696_1001409622 | 301 |
| 59 | 3300025922 | Ga0207646_10058487 | Ga0207646_100584872 | 301 |
| 60 | 3300005471 | Ga0070698_100341759 | Ga0070698_1003417592 | 304 |
| 61 | 3300049568 | Ga0501031_0089169 | Ga0501031_0089169_499_1479 | 304 |
| 62 | 3300049572 | Ga0501036_0134431 | Ga0501036_0134431_380_1360 | 304 |
| 63 | 3300049574 | Ga0501038_0062277 | Ga0501038_0062277_964_1944 | 304 |
| 64 | 3300049575 | Ga0501039_0179743 | Ga0501039_0179743_308_1288 | 304 |
| 65 | 3300049576 | Ga0501040_0061779 | Ga0501040_0061779_224_1204 | 304 |
| 66 | 3300049587 | Ga0501071_0006452 | Ga0501071_0006452_3235_4215 | 304 |
| 67 | 3300049588 | Ga0501072_0012117 | Ga0501072_0012117_2131_3111 | 304 |
| 68 | 3300049591 | Ga0501075_0014855 | Ga0501075_0014855_201_1181 | 304 |
| 69 | 3300049592 | Ga0501076_0018865 | Ga0501076_0018865_3383_4363 | 304 |
| 70 | 3300049741 | Ga0501079_0046086 | Ga0501079_0046086_2028_3008 | 304 |
| 71 | 3300049743 | Ga0501081_0012623 | Ga0501081_0012623_2846_3826 | 304 |
| 72 | 3300049824 | Ga0501045_0025057 | Ga0501045_0025057_313_1293 | 304 |
| 73 | 3300054114 | Ga0501084_0137355 | Ga0501084_0137355_452_1432 | 304 |
| 74 | 3300060353 | Ga0501082_0124721 | Ga0501082_0124721_185_1165 | 304 |
| 75 | 3300061734 | Ga0530510_0018969 | Ga0530510_0018969_1688_2668 | 304 |
| 76 | 3300025919 | Ga0207657_10139619 | Ga0207657_101396192 | 305 |
| 77 | 3300050508 | nmdc:mga09592_88019_c1 | nmdc:mga09592_88019_c1_865_1785 | 306 |
| 78 | 3300050509 | nmdc:mga0qj67_5993_c1 | nmdc:mga0qj67_5993_c1_2046_2966 | 306 |
| 79 | 3300005353 | Ga0070669_100012602 | Ga0070669_1000126023 | 308 |
| 80 | 3300053096 | Ga0500641_0001751 | Ga0500641_0001751_23_961 | 308 |
| 81 | 3300005347 | Ga0070668_100274683 | Ga0070668_1002746832 | 309 |
| 82 | 3300005354 | Ga0070675_100022500 | Ga0070675_1000225002 | 309 |
| 83 | 3300005844 | Ga0068862_100043541 | Ga0068862_1000435413 | 309 |
| 84 | 3300025923 | Ga0207681_10020723 | Ga0207681_100207232 | 309 |
| 85 | 3300025933 | Ga0207706_10024368 | Ga0207706_100243684 | 309 |
| 86 | 3300025972 | Ga0207668_10026640 | Ga0207668_100266405 | 309 |
| 87 | 3300028380 | Ga0268265_10044716 | Ga0268265_100447163 | 309 |
| 88 | 3300005435 | Ga0070714_100238744 | Ga0070714_1002387442 | 311 |
| 89 | 3300025906 | Ga0207699_10256131 | Ga0207699_102561312 | 311 |
| 90 | 3300026067 | Ga0207678_10073653 | Ga0207678_100736532 | 311 |
| 91 | 3300035241 | Ga0373961_0002480 | Ga0373961_0002480_3077_4144 | 311 |
| 92 | 3300042007 | Ga0439449_0048723 | Ga0439449_0048723_170_1147 | 311 |
| 93 | 3300059421 | Ga0590071_029994 | Ga0590071_029994_246_1193 | 311 |
| 94 | 3300009147 | Ga0114129_10011063 | Ga0114129_100110636 | 312 |
| 95 | 3300038443 | Ga0395901_0384500 | Ga0395901_0384500_172_1152 | 312 |
| 96 | 3300045051 | Ga0451576_0155586 | Ga0451576_0155586_1129_2106 | 312 |
| 97 | 3300050507 | nmdc:mga05p37_19222_c1 | nmdc:mga05p37_19222_c1_4559_5545 | 312 |
| 98 | 3300006847 | Ga0075431_100104108 | Ga0075431_1001041083 | 314 |
| 99 | 3300036401 | Ga0373937_0173019 | Ga0373937_0173019_60_1061 | 314 |
| 100 | 3300046514 | Ga0495618_0143215 | Ga0495618_0143215_200_1201 | 314 |
| 101 | 3300046516 | Ga0495628_0060447 | Ga0495628_0060447_1115_2116 | 314 |
| 102 | 3300046533 | Ga0495640_0158572 | Ga0495640_0158572_113_1114 | 314 |
| 103 | 3300046681 | Ga0495647_0117793 | Ga0495647_0117793_30_1031 | 314 |
| 104 | 3300047319 | Ga0495674_0146146 | Ga0495674_0146146_740_1741 | 314 |
| 105 | 3300047321 | Ga0495676_0217108 | Ga0495676_0217108_214_1215 | 314 |
| 106 | 3300050510 | nmdc:mga06r32_88458_c1 | nmdc:mga06r32_88458_c1_1920_2900 | 314 |
| 107 | 3300006880 | Ga0075429_100082922 | Ga0075429_1000829222 | 315 |
| 108 | 3300009147 | Ga0114129_10081377 | Ga0114129_100813772 | 315 |
| 109 | 3300050507 | nmdc:mga05p37_43881_c1 | nmdc:mga05p37_43881_c1_1173_2165 | 315 |
| 110 | 3300050508 | nmdc:mga09592_35715_c1 | nmdc:mga09592_35715_c1_391_1383 | 315 |
| 111 | 3300005615 | Ga0070702_100264217 | Ga0070702_1002642171 | 316 |
| 112 | 3300005841 | Ga0068863_100226041 | Ga0068863_1002260412 | 316 |
| 113 | 3300009176 | Ga0105242_10070801 | Ga0105242_100708013 | 316 |
| 114 | 3300009177 | Ga0105248_10039235 | Ga0105248_100392352 | 316 |
| 115 | 3300025923 | Ga0207681_10020728 | Ga0207681_100207285 | 316 |
| 116 | 3300025934 | Ga0207686_10102283 | Ga0207686_101022832 | 316 |
| 117 | 3300006844 | Ga0075428_100000010 | Ga0075428_100000010168 | 317 |
| 118 | 3300006844 | Ga0075428_100149848 | Ga0075428_1001498483 | 317 |
| 119 | 3300009094 | Ga0111539_10000001 | Ga0111539_1000000134 | 317 |
| 120 | 3300009147 | Ga0114129_10000186 | Ga0114129_100001869 | 317 |
| 121 | 3300027907 | Ga0207428_10000002 | Ga0207428_1000000247 | 317 |
| 122 | 3300042125 | Ga0450923_006257 | Ga0450923_006257_869_1849 | 317 |
| 123 | 3300042131 | Ga0450894_000870 | Ga0450894_000870_568_1548 | 317 |
| 124 | 3300042133 | Ga0450896_000612 | Ga0450896_000612_891_1871 | 317 |
| 125 | 3300042184 | Ga0450908_017169 | Ga0450908_017169_208_1188 | 317 |
| 126 | 3300042531 | Ga0450918_007760 | Ga0450918_007760_826_1806 | 317 |
| 127 | 3300045976 | Ga0466967_0294065 | Ga0466967_0294065_506_1459 | 317 |
| 128 | 3300050507 | nmdc:mga05p37_1524_c1 | nmdc:mga05p37_1524_c1_12545_13528 | 317 |
| 129 | 3300009147 | Ga0114129_10005014 | Ga0114129_100050145 | 318 |
| 130 | 3300050507 | nmdc:mga05p37_5890_c1 | nmdc:mga05p37_5890_c1_10419_11426 | 318 |
| 131 | 3300050515 | nmdc:mga0a205_436253_c1 | nmdc:mga0a205_436253_c1_63_1070 | 318 |
| 132 | 3300049592 | Ga0501076_0261942 | Ga0501076_0261942_178_1173 | 319 |
| 133 | 3300050510 | nmdc:mga06r32_106074_c1 | nmdc:mga06r32_106074_c1_736_1695 | 319 |
| 134 | 3300014325 | Ga0163163_10134792 | Ga0163163_101347923 | 320 |
| 135 | 3300050510 | nmdc:mga06r32_147115_c2 | nmdc:mga06r32_147115_c2_482_1465 | 320 |
| 136 | 3300005356 | Ga0070674_100009206 | Ga0070674_1000092062 | 321 |
| 137 | 3300005616 | Ga0068852_100112946 | Ga0068852_1001129462 | 321 |
| 138 | 3300032005 | Ga0307411_10303673 | Ga0307411_103036732 | 321 |
| 139 | 3300006846 | Ga0075430_100019004 | Ga0075430_1000190042 | 322 |
| 140 | 3300006871 | Ga0075434_100054041 | Ga0075434_1000540412 | 322 |
| 141 | 3300009094 | Ga0111539_10000740 | Ga0111539_1000074020 | 322 |
| 142 | 3300009147 | Ga0114129_10001901 | Ga0114129_1000190118 | 322 |
| 143 | 3300025926 | Ga0207659_10179399 | Ga0207659_101793992 | 322 |
| 144 | 3300026075 | Ga0207708_10143038 | Ga0207708_101430382 | 322 |
| 145 | 3300032005 | Ga0307411_10033774 | Ga0307411_100337743 | 322 |
| 146 | 3300042439 | Ga0439464_0008661 | Ga0439464_0008661_1538_2506 | 322 |
| 147 | 3300050508 | nmdc:mga09592_2193_c1 | nmdc:mga09592_2193_c1_14251_15219 | 322 |
| 148 | 3300050509 | nmdc:mga0qj67_308909_c1 | nmdc:mga0qj67_308909_c1_227_1195 | 322 |
| 149 | 3300050511 | nmdc:mga08y16_4666_c1 | nmdc:mga08y16_4666_c1_8269_9237 | 322 |
| 150 | 3300050512 | nmdc:mga0n895_65095_c1 | nmdc:mga0n895_65095_c1_2126_3106 | 322 |
| 151 | 3300005331 | Ga0070670_100012446 | Ga0070670_1000124464 | 323 |
| 152 | 3300005338 | Ga0068868_100185058 | Ga0068868_1001850582 | 323 |
| 153 | 3300005577 | Ga0068857_100012955 | Ga0068857_1000129556 | 323 |
| 154 | 3300009147 | Ga0114129_10166295 | Ga0114129_101662953 | 323 |
| 155 | 3300009177 | Ga0105248_10097853 | Ga0105248_100978532 | 323 |
| 156 | 3300025925 | Ga0207650_10077608 | Ga0207650_100776083 | 323 |
| 157 | 3300026116 | Ga0207674_10019855 | Ga0207674_100198556 | 323 |
| 158 | 3300050507 | nmdc:mga05p37_139909_c1 | nmdc:mga05p37_139909_c1_1664_2695 | 323 |
| 159 | 3300005366 | Ga0070659_100232062 | Ga0070659_1002320621 | 324 |
| 160 | 3300006852 | Ga0075433_10007642 | Ga0075433_100076423 | 324 |
| 161 | 3300006871 | Ga0075434_100002153 | Ga0075434_1000021535 | 324 |
| 162 | 3300009553 | Ga0105249_10000180 | Ga0105249_1000018068 | 324 |
| 163 | 3300013105 | Ga0157369_10050848 | Ga0157369_100508482 | 324 |
| 164 | 3300014969 | Ga0157376_10108041 | Ga0157376_101080413 | 324 |
| 165 | 3300042156 | Ga0439446_0032666 | Ga0439446_0032666_29_1015 | 324 |
| 166 | 3300042876 | Ga0451577_0007418 | Ga0451577_0007418_4614_5591 | 324 |
| 167 | 3300053103 | Ga0500555_012739 | Ga0500555_012739_580_1566 | 324 |
| 168 | 3300005842 | Ga0068858_100042970 | Ga0068858_1000429703 | 325 |
| 169 | 3300005842 | Ga0068858_100190946 | Ga0068858_1001909462 | 325 |
| 170 | 3300006844 | Ga0075428_100017492 | Ga0075428_1000174923 | 325 |
| 171 | 3300009147 | Ga0114129_10041815 | Ga0114129_100418155 | 325 |
| 172 | 3300009147 | Ga0114129_10393487 | Ga0114129_103934872 | 325 |
| 173 | 3300009147 | Ga0114129_10507127 | Ga0114129_105071272 | 325 |
| 174 | 3300009177 | Ga0105248_10038141 | Ga0105248_100381413 | 325 |
| 175 | 3300014325 | Ga0163163_10122097 | Ga0163163_101220972 | 325 |
| 176 | 3300014968 | Ga0157379_10133360 | Ga0157379_101333602 | 325 |
| 177 | 3300025912 | Ga0207707_10110672 | Ga0207707_101106723 | 325 |
| 178 | 3300026035 | Ga0207703_10158898 | Ga0207703_101588982 | 325 |
| 179 | 3300028381 | Ga0268264_10343281 | Ga0268264_103432812 | 325 |
| 180 | 3300031727 | Ga0316576_10055104 | Ga0316576_100551042 | 325 |
| 181 | 3300032002 | Ga0307416_100132389 | Ga0307416_1001323893 | 325 |
| 182 | 3300038726 | Ga0400490_24668 | Ga0400490_24668_8134_9132 | 325 |
| 183 | 3300038726 | Ga0400490_33866 | Ga0400490_33866_1753_2751 | 325 |
| 184 | 3300038741 | Ga0400488_49291 | Ga0400488_49291_1428_2426 | 325 |
| 185 | 3300039093 | Ga0400489_93634 | Ga0400489_93634_3932_4912 | 325 |
| 186 | 3300049576 | Ga0501040_0000054 | Ga0501040_0000054_23144_24127 | 325 |
| 187 | 3300049578 | Ga0501042_0000588 | Ga0501042_0000588_15175_16158 | 325 |
| 188 | 3300049583 | Ga0501067_0027574 | Ga0501067_0027574_2037_3020 | 325 |
| 189 | 3300049589 | Ga0501073_0004475 | Ga0501073_0004475_5260_6249 | 325 |
| 190 | 3300050507 | nmdc:mga05p37_127484_c1 | nmdc:mga05p37_127484_c1_364_1353 | 325 |
| 191 | 3300050507 | nmdc:mga05p37_197657_c1 | nmdc:mga05p37_197657_c1_967_1974 | 325 |
| 192 | 3300005327 | Ga0070658_10045958 | Ga0070658_100459583 | 326 |
| 193 | 3300005328 | Ga0070676_10033959 | Ga0070676_100339592 | 326 |
| 194 | 3300005329 | Ga0070683_100163156 | Ga0070683_1001631563 | 326 |
| 195 | 3300005330 | Ga0070690_100199281 | Ga0070690_1001992812 | 326 |
| 196 | 3300005331 | Ga0070670_100180755 | Ga0070670_1001807552 | 326 |
| 197 | 3300005333 | Ga0070677_10021044 | Ga0070677_100210443 | 326 |
| 198 | 3300005334 | Ga0068869_100148837 | Ga0068869_1001488372 | 326 |
| 199 | 3300005336 | Ga0070680_100020787 | Ga0070680_1000207875 | 326 |
| 200 | 3300005336 | Ga0070680_100039705 | Ga0070680_1000397053 | 326 |
| 201 | 3300005336 | Ga0070680_100116958 | Ga0070680_1001169582 | 326 |
| 202 | 3300005338 | Ga0068868_100132169 | Ga0068868_1001321692 | 326 |
| 203 | 3300005338 | Ga0068868_100258141 | Ga0068868_1002581411 | 326 |
| 204 | 3300005340 | Ga0070689_100045359 | Ga0070689_1000453593 | 326 |
| 205 | 3300005343 | Ga0070687_100047427 | Ga0070687_1000474272 | 326 |
| 206 | 3300005344 | Ga0070661_100295247 | Ga0070661_1002952471 | 326 |
| 207 | 3300005347 | Ga0070668_100006466 | Ga0070668_1000064665 | 326 |
| 208 | 3300005354 | Ga0070675_100018823 | Ga0070675_1000188233 | 326 |
| 209 | 3300005355 | Ga0070671_100091001 | Ga0070671_1000910012 | 326 |
| 210 | 3300005355 | Ga0070671_100147941 | Ga0070671_1001479412 | 326 |
| 211 | 3300005356 | Ga0070674_100107178 | Ga0070674_1001071782 | 326 |
| 212 | 3300005364 | Ga0070673_100000364 | Ga0070673_1000003641 | 326 |
| 213 | 3300005365 | Ga0070688_100088325 | Ga0070688_1000883252 | 326 |
| 214 | 3300005434 | Ga0070709_10168600 | Ga0070709_101686001 | 326 |
| 215 | 3300005435 | Ga0070714_100125955 | Ga0070714_1001259551 | 326 |
| 216 | 3300005436 | Ga0070713_100066442 | Ga0070713_1000664422 | 326 |
| 217 | 3300005441 | Ga0070700_100008186 | Ga0070700_1000081865 | 326 |
| 218 | 3300005445 | Ga0070708_100032869 | Ga0070708_1000328693 | 326 |
| 219 | 3300005456 | Ga0070678_100013004 | Ga0070678_1000130043 | 326 |
| 220 | 3300005457 | Ga0070662_100317675 | Ga0070662_1003176751 | 326 |
| 221 | 3300005458 | Ga0070681_10045461 | Ga0070681_100454613 | 326 |
| 222 | 3300005458 | Ga0070681_10079771 | Ga0070681_100797712 | 326 |
| 223 | 3300005458 | Ga0070681_10281795 | Ga0070681_102817952 | 326 |
| 224 | 3300005459 | Ga0068867_100127989 | Ga0068867_1001279892 | 326 |
| 225 | 3300005468 | Ga0070707_100144685 | Ga0070707_1001446852 | 326 |
| 226 | 3300005471 | Ga0070698_100063281 | Ga0070698_1000632813 | 326 |
| 227 | 3300005518 | Ga0070699_100002365 | Ga0070699_10000236517 | 326 |
| 228 | 3300005518 | Ga0070699_100006877 | Ga0070699_1000068777 | 326 |
| 229 | 3300005530 | Ga0070679_100017472 | Ga0070679_1000174724 | 326 |
| 230 | 3300005530 | Ga0070679_100035234 | Ga0070679_1000352343 | 326 |
| 231 | 3300005530 | Ga0070679_100114398 | Ga0070679_1001143982 | 326 |
| 232 | 3300005535 | Ga0070684_100089041 | Ga0070684_1000890412 | 326 |
| 233 | 3300005539 | Ga0068853_100032033 | Ga0068853_1000320333 | 326 |
| 234 | 3300005539 | Ga0068853_100225188 | Ga0068853_1002251882 | 326 |
| 235 | 3300005544 | Ga0070686_100003397 | Ga0070686_1000033974 | 326 |
| 236 | 3300005549 | Ga0070704_100016780 | Ga0070704_1000167804 | 326 |
| 237 | 3300005563 | Ga0068855_100110549 | Ga0068855_1001105492 | 326 |
| 238 | 3300005563 | Ga0068855_100126106 | Ga0068855_1001261063 | 326 |
| 239 | 3300005563 | Ga0068855_100548972 | Ga0068855_1005489722 | 326 |
| 240 | 3300005578 | Ga0068854_100164955 | Ga0068854_1001649552 | 326 |
| 241 | 3300005614 | Ga0068856_100086677 | Ga0068856_1000866773 | 326 |
| 242 | 3300005616 | Ga0068852_100014753 | Ga0068852_1000147533 | 326 |
| 243 | 3300005617 | Ga0068859_100053090 | Ga0068859_1000530901 | 326 |
| 244 | 3300005617 | Ga0068859_100171905 | Ga0068859_1001719052 | 326 |
| 245 | 3300005719 | Ga0068861_100075513 | Ga0068861_1000755133 | 326 |
| 246 | 3300006028 | Ga0070717_10259327 | Ga0070717_102593272 | 326 |
| 247 | 3300006051 | Ga0075364_10008709 | Ga0075364_100087095 | 326 |
| 248 | 3300006177 | Ga0075362_10005347 | Ga0075362_100053474 | 326 |
| 249 | 3300006178 | Ga0075367_10051224 | Ga0075367_100512242 | 326 |
| 250 | 3300006178 | Ga0075367_10072703 | Ga0075367_100727032 | 326 |
| 251 | 3300006195 | Ga0075366_10010882 | Ga0075366_100108825 | 326 |
| 252 | 3300006237 | Ga0097621_100030731 | Ga0097621_1000307314 | 326 |
| 253 | 3300006237 | Ga0097621_100218189 | Ga0097621_1002181892 | 326 |
| 254 | 3300006844 | Ga0075428_100005848 | Ga0075428_1000058482 | 326 |
| 255 | 3300006844 | Ga0075428_100027805 | Ga0075428_1000278053 | 326 |
| 256 | 3300006846 | Ga0075430_100006615 | Ga0075430_1000066152 | 326 |
| 257 | 3300006846 | Ga0075430_100007270 | Ga0075430_1000072706 | 326 |
| 258 | 3300006847 | Ga0075431_100024135 | Ga0075431_1000241353 | 326 |
| 259 | 3300006847 | Ga0075431_100033593 | Ga0075431_1000335933 | 326 |
| 260 | 3300006847 | Ga0075431_100086176 | Ga0075431_1000861762 | 326 |
| 261 | 3300006847 | Ga0075431_100184829 | Ga0075431_1001848292 | 326 |
| 262 | 3300006847 | Ga0075431_100312565 | Ga0075431_1003125651 | 326 |
| 263 | 3300006847 | Ga0075431_100476101 | Ga0075431_1004761012 | 326 |
| 264 | 3300006852 | Ga0075433_10013631 | Ga0075433_100136314 | 326 |
| 265 | 3300006852 | Ga0075433_10026199 | Ga0075433_100261993 | 326 |
| 266 | 3300006852 | Ga0075433_10308285 | Ga0075433_103082851 | 326 |
| 267 | 3300006871 | Ga0075434_100109666 | Ga0075434_1001096663 | 326 |
| 268 | 3300006880 | Ga0075429_100001697 | Ga0075429_10000169714 | 326 |
| 269 | 3300006880 | Ga0075429_100096000 | Ga0075429_1000960003 | 326 |
| 270 | 3300006914 | Ga0075436_100022198 | Ga0075436_1000221984 | 326 |
| 271 | 3300006914 | Ga0075436_100082361 | Ga0075436_1000823612 | 326 |
| 272 | 3300006914 | Ga0075436_100097479 | Ga0075436_1000974792 | 326 |
| 273 | 3300006931 | Ga0097620_100053088 | Ga0097620_1000530881 | 326 |
| 274 | 3300006931 | Ga0097620_100171914 | Ga0097620_1001719142 | 326 |
| 275 | 3300007076 | Ga0075435_100001847 | Ga0075435_1000018476 | 326 |
| 276 | 3300007076 | Ga0075435_100003420 | Ga0075435_1000034204 | 326 |
| 277 | 3300007076 | Ga0075435_100003471 | Ga0075435_10000347110 | 326 |
| 278 | 3300007076 | Ga0075435_100009122 | Ga0075435_1000091225 | 326 |
| 279 | 3300007076 | Ga0075435_100118979 | Ga0075435_1001189792 | 326 |
| 280 | 3300009093 | Ga0105240_10049469 | Ga0105240_100494693 | 326 |
| 281 | 3300009093 | Ga0105240_10110142 | Ga0105240_101101423 | 326 |
| 282 | 3300009094 | Ga0111539_10016952 | Ga0111539_100169523 | 326 |
| 283 | 3300009094 | Ga0111539_10018031 | Ga0111539_100180316 | 326 |
| 284 | 3300009094 | Ga0111539_10133827 | Ga0111539_101338271 | 326 |
| 285 | 3300009094 | Ga0111539_10347769 | Ga0111539_103477692 | 326 |
| 286 | 3300009147 | Ga0114129_10002876 | Ga0114129_1000287618 | 326 |
| 287 | 3300009147 | Ga0114129_10016555 | Ga0114129_100165553 | 326 |
| 288 | 3300009147 | Ga0114129_10045272 | Ga0114129_100452723 | 326 |
| 289 | 3300009147 | Ga0114129_10061709 | Ga0114129_100617095 | 326 |
| 290 | 3300009147 | Ga0114129_10077937 | Ga0114129_100779374 | 326 |
| 291 | 3300009147 | Ga0114129_10246699 | Ga0114129_102466992 | 326 |
| 292 | 3300009147 | Ga0114129_10285710 | Ga0114129_102857102 | 326 |
| 293 | 3300009176 | Ga0105242_10026762 | Ga0105242_100267624 | 326 |
| 294 | 3300009176 | Ga0105242_10357975 | Ga0105242_103579752 | 326 |
| 295 | 3300009177 | Ga0105248_10012674 | Ga0105248_100126747 | 326 |
| 296 | 3300009177 | Ga0105248_10037164 | Ga0105248_100371642 | 326 |
| 297 | 3300009177 | Ga0105248_10119226 | Ga0105248_101192262 | 326 |
| 298 | 3300009177 | Ga0105248_10240651 | Ga0105248_102406512 | 326 |
| 299 | 3300009177 | Ga0105248_10793578 | Ga0105248_107935781 | 326 |
| 300 | 3300009551 | Ga0105238_10152609 | Ga0105238_101526092 | 326 |
| 301 | 3300010375 | Ga0105239_10407242 | Ga0105239_104072422 | 326 |
| 302 | 3300010375 | Ga0105239_10519345 | Ga0105239_105193452 | 326 |
| 303 | 3300013104 | Ga0157370_10016812 | Ga0157370_100168127 | 326 |
| 304 | 3300013296 | Ga0157374_10050191 | Ga0157374_100501913 | 326 |
| 305 | 3300013307 | Ga0157372_10039711 | Ga0157372_100397113 | 326 |
| 306 | 3300013307 | Ga0157372_10163827 | Ga0157372_101638272 | 326 |
| 307 | 3300014326 | Ga0157380_10020295 | Ga0157380_100202953 | 326 |
| 308 | 3300014497 | Ga0182008_10007127 | Ga0182008_100071274 | 326 |
| 309 | 3300014969 | Ga0157376_10097229 | Ga0157376_100972292 | 326 |
| 310 | 3300017792 | Ga0163161_10104789 | Ga0163161_101047892 | 326 |
| 311 | 3300025315 | Ga0207697_10004761 | Ga0207697_100047615 | 326 |
| 312 | 3300025893 | Ga0207682_10066027 | Ga0207682_100660272 | 326 |
| 313 | 3300025901 | Ga0207688_10106301 | Ga0207688_101063011 | 326 |
| 314 | 3300025907 | Ga0207645_10018483 | Ga0207645_100184833 | 326 |
| 315 | 3300025912 | Ga0207707_10001197 | Ga0207707_1000119718 | 326 |
| 316 | 3300025912 | Ga0207707_10025762 | Ga0207707_100257622 | 326 |
| 317 | 3300025912 | Ga0207707_10026581 | Ga0207707_100265813 | 326 |
| 318 | 3300025912 | Ga0207707_10067522 | Ga0207707_100675222 | 326 |
| 319 | 3300025917 | Ga0207660_10134685 | Ga0207660_101346852 | 326 |
| 320 | 3300025918 | Ga0207662_10005644 | Ga0207662_100056446 | 326 |
| 321 | 3300025918 | Ga0207662_10059744 | Ga0207662_100597442 | 326 |
| 322 | 3300025919 | Ga0207657_10008607 | Ga0207657_100086079 | 326 |
| 323 | 3300025920 | Ga0207649_10216311 | Ga0207649_102163112 | 326 |
| 324 | 3300025921 | Ga0207652_10005510 | Ga0207652_100055109 | 326 |
| 325 | 3300025921 | Ga0207652_10047117 | Ga0207652_100471172 | 326 |
| 326 | 3300025923 | Ga0207681_10147575 | Ga0207681_101475752 | 326 |
| 327 | 3300025924 | Ga0207694_10015340 | Ga0207694_100153406 | 326 |
| 328 | 3300025925 | Ga0207650_10006334 | Ga0207650_100063345 | 326 |
| 329 | 3300025926 | Ga0207659_10113501 | Ga0207659_101135013 | 326 |
| 330 | 3300025927 | Ga0207687_10069947 | Ga0207687_100699473 | 326 |
| 331 | 3300025929 | Ga0207664_10118792 | Ga0207664_101187922 | 326 |
| 332 | 3300025929 | Ga0207664_10161072 | Ga0207664_101610721 | 326 |
| 333 | 3300025929 | Ga0207664_10254574 | Ga0207664_102545742 | 326 |
| 334 | 3300025931 | Ga0207644_10062463 | Ga0207644_100624633 | 326 |
| 335 | 3300025933 | Ga0207706_10147384 | Ga0207706_101473842 | 326 |
| 336 | 3300025940 | Ga0207691_10011607 | Ga0207691_100116075 | 326 |
| 337 | 3300025940 | Ga0207691_10157129 | Ga0207691_101571292 | 326 |
| 338 | 3300025941 | Ga0207711_10010730 | Ga0207711_100107304 | 326 |
| 339 | 3300025941 | Ga0207711_10035585 | Ga0207711_100355854 | 326 |
| 340 | 3300025941 | Ga0207711_10350226 | Ga0207711_103502261 | 326 |
| 341 | 3300025941 | Ga0207711_10358082 | Ga0207711_103580822 | 326 |
| 342 | 3300025944 | Ga0207661_10176850 | Ga0207661_101768501 | 326 |
| 343 | 3300025944 | Ga0207661_10319225 | Ga0207661_103192252 | 326 |
| 344 | 3300025949 | Ga0207667_10266700 | Ga0207667_102667002 | 326 |
| 345 | 3300025949 | Ga0207667_10325640 | Ga0207667_103256402 | 326 |
| 346 | 3300025949 | Ga0207667_10524856 | Ga0207667_105248562 | 326 |
| 347 | 3300025960 | Ga0207651_10016602 | Ga0207651_100166021 | 326 |
| 348 | 3300025961 | Ga0207712_10000391 | Ga0207712_1000039136 | 326 |
| 349 | 3300026023 | Ga0207677_10080150 | Ga0207677_100801502 | 326 |
| 350 | 3300026023 | Ga0207677_10203039 | Ga0207677_102030392 | 326 |
| 351 | 3300026041 | Ga0207639_10033552 | Ga0207639_100335524 | 326 |
| 352 | 3300026041 | Ga0207639_10095365 | Ga0207639_100953652 | 326 |
| 353 | 3300026075 | Ga0207708_10008855 | Ga0207708_100088556 | 326 |
| 354 | 3300026078 | Ga0207702_10133036 | Ga0207702_101330362 | 326 |
| 355 | 3300026089 | Ga0207648_10113819 | Ga0207648_101138192 | 326 |
| 356 | 3300026089 | Ga0207648_10177926 | Ga0207648_101779262 | 326 |
| 357 | 3300026118 | Ga0207675_100071576 | Ga0207675_1000715763 | 326 |
| 358 | 3300026118 | Ga0207675_100086342 | Ga0207675_1000863423 | 326 |
| 359 | 3300026121 | Ga0207683_10193248 | Ga0207683_101932482 | 326 |
| 360 | 3300028380 | Ga0268265_10021748 | Ga0268265_100217482 | 326 |
| 361 | 3300031548 | Ga0307408_100053992 | Ga0307408_1000539921 | 326 |
| 362 | 3300031548 | Ga0307408_100096187 | Ga0307408_1000961872 | 326 |
| 363 | 3300031548 | Ga0307408_100119209 | Ga0307408_1001192091 | 326 |
| 364 | 3300031731 | Ga0307405_10262025 | Ga0307405_102620251 | 326 |
| 365 | 3300031903 | Ga0307407_10071003 | Ga0307407_100710032 | 326 |
| 366 | 3300032002 | Ga0307416_100102635 | Ga0307416_1001026353 | 326 |
| 367 | 3300032002 | Ga0307416_100268134 | Ga0307416_1002681342 | 326 |
| 368 | 3300032002 | Ga0307416_100309139 | Ga0307416_1003091392 | 326 |
| 369 | 3300032004 | Ga0307414_10315210 | Ga0307414_103152102 | 326 |
| 370 | 3300032005 | Ga0307411_10063641 | Ga0307411_100636412 | 326 |
| 371 | 3300032005 | Ga0307411_10246828 | Ga0307411_102468281 | 326 |
| 372 | 3300034819 | Ga0373958_0001973 | Ga0373958_0001973_337_1356 | 326 |
| 373 | 3300035085 | Ga0373929_0002955 | Ga0373929_0002955_537_1652 | 326 |
| 374 | 3300035090 | Ga0373949_0002450 | Ga0373949_0002450_536_1627 | 326 |
| 375 | 3300035092 | Ga0373952_0002536 | Ga0373952_0002536_580_1695 | 326 |
| 376 | 3300035115 | Ga0373941_0003558 | Ga0373941_0003558_2116_3183 | 326 |
| 377 | 3300035207 | Ga0373942_0001577 | Ga0373942_0001577_3157_4176 | 326 |
| 378 | 3300035242 | Ga0373962_0001413 | Ga0373962_0001413_1510_2553 | 326 |
| 379 | 3300036401 | Ga0373937_0002111 | Ga0373937_0002111_3216_4196 | 326 |
| 380 | 3300037068 | Ga0373925_0006423 | Ga0373925_0006423_79_1059 | 326 |
| 381 | 3300041460 | Ga0451802_1909252 | Ga0451802_1909252_242_1234 | 326 |
| 382 | 3300041512 | Ga0451853_2472702 | Ga0451853_2472702_51_1043 | 326 |
| 383 | 3300042993 | Ga0439440_0009888 | Ga0439440_0009888_525_1511 | 326 |
| 384 | 3300045051 | Ga0451576_0043352 | Ga0451576_0043352_2034_3086 | 326 |
| 385 | 3300046455 | Ga0495603_0129308 | Ga0495603_0129308_312_1295 | 326 |
| 386 | 3300046473 | Ga0495582_0121619 | Ga0495582_0121619_85_1065 | 326 |
| 387 | 3300046689 | Ga0495613_0168429 | Ga0495613_0168429_78_1061 | 326 |
| 388 | 3300048904 | Ga0496101_0026680 | Ga0496101_0026680_197_1177 | 326 |
| 389 | 3300048905 | Ga0496102_0241308 | Ga0496102_0241308_220_1224 | 326 |
| 390 | 3300048908 | Ga0496105_0057397 | Ga0496105_0057397_1099_2079 | 326 |
| 391 | 3300048909 | Ga0496106_0258485 | Ga0496106_0258485_313_1296 | 326 |
| 392 | 3300048911 | Ga0496108_0179888 | Ga0496108_0179888_503_1483 | 326 |
| 393 | 3300048912 | Ga0496109_0269829 | Ga0496109_0269829_489_1472 | 326 |
| 394 | 3300048913 | Ga0496110_0070899 | Ga0496110_0070899_1888_2868 | 326 |
| 395 | 3300048916 | Ga0496113_0320698 | Ga0496113_0320698_186_1166 | 326 |
| 396 | 3300048917 | Ga0496114_0010933 | Ga0496114_0010933_22_1002 | 326 |
| 397 | 3300048917 | Ga0496114_0015050 | Ga0496114_0015050_4580_5560 | 326 |
| 398 | 3300048917 | Ga0496114_0386704 | Ga0496114_0386704_139_1122 | 326 |
| 399 | 3300049571 | Ga0501034_0008525 | Ga0501034_0008525_325_1308 | 326 |
| 400 | 3300049572 | Ga0501036_0053098 | Ga0501036_0053098_216_1202 | 326 |
| 401 | 3300049572 | Ga0501036_0122610 | Ga0501036_0122610_235_1227 | 326 |
| 402 | 3300049574 | Ga0501038_0162805 | Ga0501038_0162805_647_1633 | 326 |
| 403 | 3300049575 | Ga0501039_0042555 | Ga0501039_0042555_2103_3089 | 326 |
| 404 | 3300049575 | Ga0501039_0076629 | Ga0501039_0076629_1489_2481 | 326 |
| 405 | 3300049575 | Ga0501039_0161778 | Ga0501039_0161778_712_1692 | 326 |
| 406 | 3300049576 | Ga0501040_0239606 | Ga0501040_0239606_15_1001 | 326 |
| 407 | 3300049578 | Ga0501042_0130623 | Ga0501042_0130623_787_1773 | 326 |
| 408 | 3300049582 | Ga0501048_0325571 | Ga0501048_0325571_42_1022 | 326 |
| 409 | 3300049587 | Ga0501071_0024982 | Ga0501071_0024982_989_1969 | 326 |
| 410 | 3300049587 | Ga0501071_0083402 | Ga0501071_0083402_258_1238 | 326 |
| 411 | 3300049587 | Ga0501071_0266883 | Ga0501071_0266883_247_1239 | 326 |
| 412 | 3300049588 | Ga0501072_0022970 | Ga0501072_0022970_3740_4720 | 326 |
| 413 | 3300049588 | Ga0501072_0043246 | Ga0501072_0043246_1389_2381 | 326 |
| 414 | 3300049588 | Ga0501072_0146094 | Ga0501072_0146094_149_1135 | 326 |
| 415 | 3300049590 | Ga0501074_0080423 | Ga0501074_0080423_287_1267 | 326 |
| 416 | 3300049590 | Ga0501074_0197247 | Ga0501074_0197247_14_994 | 326 |
| 417 | 3300049591 | Ga0501075_0101511 | Ga0501075_0101511_38_1018 | 326 |
| 418 | 3300049591 | Ga0501075_0153965 | Ga0501075_0153965_401_1381 | 326 |
| 419 | 3300049591 | Ga0501075_0309537 | Ga0501075_0309537_11_991 | 326 |
| 420 | 3300049592 | Ga0501076_0027790 | Ga0501076_0027790_580_1560 | 326 |
| 421 | 3300049592 | Ga0501076_0100469 | Ga0501076_0100469_283_1263 | 326 |
| 422 | 3300049592 | Ga0501076_0280631 | Ga0501076_0280631_130_1110 | 326 |
| 423 | 3300049661 | Ga0501217_052091 | Ga0501217_052091_62_1051 | 326 |
| 424 | 3300049741 | Ga0501079_0046851 | Ga0501079_0046851_1259_2245 | 326 |
| 425 | 3300049741 | Ga0501079_0113642 | Ga0501079_0113642_128_1129 | 326 |
| 426 | 3300049742 | Ga0501080_0097026 | Ga0501080_0097026_77_1057 | 326 |
| 427 | 3300049743 | Ga0501081_0051433 | Ga0501081_0051433_1122_2114 | 326 |
| 428 | 3300049744 | Ga0501083_0079659 | Ga0501083_0079659_80_1060 | 326 |
| 429 | 3300049824 | Ga0501045_0012267 | Ga0501045_0012267_428_1414 | 326 |
| 430 | 3300049824 | Ga0501045_0044747 | Ga0501045_0044747_1615_2595 | 326 |
| 431 | 3300050489 | nmdc:mga03683_24526_c1 | nmdc:mga03683_24526_c1_451_1437 | 326 |
| 432 | 3300050491 | nmdc:mga00v17_53440_c1 | nmdc:mga00v17_53440_c1_556_1542 | 326 |
| 433 | 3300050493 | nmdc:mga0k408_17092_c1 | nmdc:mga0k408_17092_c1_897_1883 | 326 |
| 434 | 3300050493 | nmdc:mga0k408_44368_c1 | nmdc:mga0k408_44368_c1_848_1834 | 326 |
| 435 | 3300050494 | nmdc:mga06z11_63003_c1 | nmdc:mga06z11_63003_c1_536_1522 | 326 |
| 436 | 3300050507 | nmdc:mga05p37_13758_c1 | nmdc:mga05p37_13758_c1_160_1140 | 326 |
| 437 | 3300050507 | nmdc:mga05p37_160430_c1 | nmdc:mga05p37_160430_c1_1077_2057 | 326 |
| 438 | 3300050507 | nmdc:mga05p37_408531_c1 | nmdc:mga05p37_408531_c1_229_1215 | 326 |
| 439 | 3300050507 | nmdc:mga05p37_673675_c1 | nmdc:mga05p37_673675_c1_30_1016 | 326 |
| 440 | 3300050508 | nmdc:mga09592_225989_c1 | nmdc:mga09592_225989_c1_570_1550 | 326 |
| 441 | 3300050510 | nmdc:mga06r32_251490_c1 | nmdc:mga06r32_251490_c1_614_1594 | 326 |
| 442 | 3300050510 | nmdc:mga06r32_258167_c1 | nmdc:mga06r32_258167_c1_155_1153 | 326 |
| 443 | 3300050511 | nmdc:mga08y16_7613_c1 | nmdc:mga08y16_7613_c1_3241_4233 | 326 |
| 444 | 3300050512 | nmdc:mga0n895_215715_c1 | nmdc:mga0n895_215715_c1_929_1918 | 326 |
| 445 | 3300050512 | nmdc:mga0n895_9710_c1 | nmdc:mga0n895_9710_c1_6492_7472 | 326 |
| 446 | 3300050513 | nmdc:mga0rr50_12141_c1 | nmdc:mga0rr50_12141_c1_898_1878 | 326 |
| 447 | 3300050513 | nmdc:mga0rr50_413357_c1 | nmdc:mga0rr50_413357_c1_34_1038 | 326 |
| 448 | 3300050513 | nmdc:mga0rr50_8435_c1 | nmdc:mga0rr50_8435_c1_2163_3191 | 326 |
| 449 | 3300050514 | nmdc:mga08x19_124639_c1 | nmdc:mga08x19_124639_c1_500_1480 | 326 |
| 450 | 3300050514 | nmdc:mga08x19_20109_c1 | nmdc:mga08x19_20109_c1_1336_2316 | 326 |
| 451 | 3300050514 | nmdc:mga08x19_34694_c1 | nmdc:mga08x19_34694_c1_1907_2887 | 326 |
| 452 | 3300050515 | nmdc:mga0a205_115742_c1 | nmdc:mga0a205_115742_c1_106_1086 | 326 |
| 453 | 3300050515 | nmdc:mga0a205_206533_c1 | nmdc:mga0a205_206533_c1_747_1733 | 326 |
| 454 | 3300050515 | nmdc:mga0a205_41438_c2 | nmdc:mga0a205_41438_c2_1952_2932 | 326 |
| 455 | 3300050515 | nmdc:mga0a205_50069_c1 | nmdc:mga0a205_50069_c1_747_1727 | 326 |
| 456 | 3300050515 | nmdc:mga0a205_75916_c1 | nmdc:mga0a205_75916_c1_1647_2627 | 326 |
| 457 | 3300053078 | Ga0495612_0069041 | Ga0495612_0069041_442_1422 | 326 |
| 458 | 3300053085 | Ga0495619_0006951 | Ga0495619_0006951_4931_5911 | 326 |
| 459 | 3300053085 | Ga0495619_0121918 | Ga0495619_0121918_230_1213 | 326 |
| 460 | 3300054114 | Ga0501084_0048856 | Ga0501084_0048856_2467_3447 | 326 |
| 461 | 3300054114 | Ga0501084_0213445 | Ga0501084_0213445_200_1186 | 326 |
| 462 | 3300059421 | Ga0590071_000695 | Ga0590071_000695_6686_7672 | 326 |
| 463 | 3300059424 | Ga0590075_000238 | Ga0590075_000238_13303_14289 | 326 |
| 464 | 3300059424 | Ga0590075_011561 | Ga0590075_011561_385_1368 | 326 |
| 465 | 3300059426 | Ga0590077_000270 | Ga0590077_000270_9246_10232 | 326 |
| 466 | 3300059426 | Ga0590077_003069 | Ga0590077_003069_1369_2361 | 326 |
| 467 | 3300061734 | Ga0530510_0007888 | Ga0530510_0007888_2628_3629 | 326 |
| 468 | 3300061734 | Ga0530510_0082488 | Ga0530510_0082488_761_1753 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m2p-assembly3.cif.gz_E | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.9106 | 1 | 323 |
| 3m2p-assembly3.cif.gz_D | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.9077 | 1 | 321 |
| 3m2p-assembly2.cif.gz_F | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.9033 | 1 | 324 |
| 3m2p-assembly2.cif.gz_C | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.9024 | 1 | 319 |
| 3m2p-assembly3.cif.gz_E | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.8974 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0VRA9_18_110_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9201 | 2 | 77 | 3.40.50.720 |
| af_P75821_1_335_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9109 | 1 | 326 | 3.40.50.720 |
| af_P75821_1_335_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9083 | 1 | 326 | 3.40.50.720 |
| af_A0A1D6GVM8_196_300_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9018 | 1 | 103 | 3.40.50.20 |
| af_A0A1D6IP12_4_87_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9004 | 1 | 73 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8CDQ0-F1-model_v4 | Oxidoreductase | 0.9876 | 1 | 175 |
GO:0004029
GO:0005737 |
| AF-A0A7W1I475-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9864 | 1 | 238 |
GO:0004029
GO:0005737 |
| AF-A0A2V8CDQ0-F1-model_v4 | Oxidoreductase | 0.9765 | 1 | 175 |
GO:0004029
GO:0005737 |
| AF-A0A7W1I475-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9663 | 1 | 238 |
GO:0004029
GO:0005737 |
| AF-A0A850H689-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9621 | 2 | 326 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar