F450032

General Info

Members Datasets Scaffolds Average Seq Length
468 210 468 338

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000101|Ga0105237_1000010132
Length 375
Sequence MVRGRGDVDRTGWADVHSFNELWFRAKAAELAGPLMKKARVVVLFDTDDAPPANQDFTKHIESVDEAEFDVARALIARGHEVRCLGFRDDLNQLVAGLKAAPCDMVFNLSERFRGKSALDYTVVAILEMLGIPFTGATTEGLILARDKALTKKVLAYHGILIPHFMVCPIGQPIQRPSDLRFPLIVKPQDEDASVGIAQSSVVLDDDALNSRIQFIHDKIGTDAIVEEFIEGRELYVGVIGNERPKALPPIEMVFKNEPNVEGRIATFKAKWSVKYRESRGIENMVAQDLSKSLIQRLSDVAVRTYRAAGLRDYGRIDVRLAHDEAIYVVEANPNPYLADGEDLAWAAEVAGYPYQDLIEKLAEMTLGRARKNGG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.5
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10006051 3300003320 Bacteria 2499
2 rootH1_10012253 3300003323 Bacteria 10367
3 rootH1_10041377 3300003323 Unclassified 4606
4 Ga0065707_10090896 3300005295 Bacteria 4031
5 Ga0070658_10000646 3300005327 Bacteria 30121
6 Ga0070658_10077632 3300005327 Unclassified 2725
7 Ga0070676_10172446 3300005328 Bacteria 1400
8 Ga0070690_100049217 3300005330 Bacteria 2686
9 Ga0070690_100097494 3300005330 Bacteria 1944
10 Ga0070670_100214509 3300005331 Bacteria 1674
11 Ga0070680_100008659 3300005336 Bacteria 7799
12 Ga0070682_100036994 3300005337 Bacteria 2986
13 Ga0070682_100095892 3300005337 Unclassified 1949
14 Ga0070682_100241160 3300005337 Bacteria 1298
15 Ga0068868_100078929 3300005338 Bacteria 2636
16 Ga0070689_100000002 3300005340 Bacteria 695141
17 Ga0070689_100205524 3300005340 Bacteria 1610
18 Ga0070687_100032932 3300005343 Bacteria 2554
19 Ga0070692_10006487 3300005345 Bacteria 5085
20 Ga0070692_10064312 3300005345 Bacteria 1940
21 Ga0070668_100008122 3300005347 Bacteria 7795
22 Ga0070668_100126352 3300005347 Bacteria 2048
23 Ga0070669_100003851 3300005353 Bacteria 10841
24 Ga0070669_100007077 3300005353 Bacteria 8058
25 Ga0070675_100119492 3300005354 Unclassified 2238
26 Ga0070674_100012392 3300005356 Bacteria 5237
27 Ga0070674_100056440 3300005356 Unclassified 2723
28 Ga0070673_100043383 3300005364 Bacteria 3475
29 Ga0070673_100057519 3300005364 Bacteria 3072
30 Ga0070673_100106979 3300005364 Unclassified 2313
31 Ga0070673_100113747 3300005364 Bacteria 2248
32 Ga0070673_100185598 3300005364 Bacteria 1783
33 Ga0070688_100011707 3300005365 Bacteria 4887
34 Ga0070688_100190270 3300005365 Bacteria 1429
35 Ga0070688_100207206 3300005365 Bacteria 1375
36 Ga0070667_100188019 3300005367 Bacteria 1828
37 Ga0070703_10000328 3300005406 Bacteria 21477
38 Ga0070703_10003059 3300005406 Bacteria 4786
39 Ga0070703_10016763 3300005406 Bacteria 2106
40 Ga0070709_10013892 3300005434 Bacteria 4539
41 Ga0070713_100140328 3300005436 Bacteria 2140
42 Ga0070713_100204944 3300005436 Bacteria 1783
43 Ga0070701_10009262 3300005438 Bacteria 4306
44 Ga0070701_10108673 3300005438 Bacteria 1546
45 Ga0070711_100000009 3300005439 Bacteria 172420
46 Ga0070705_100014849 3300005440 Unclassified 4016
47 Ga0070705_100026976 3300005440 Bacteria 3131
48 Ga0070705_100076354 3300005440 Bacteria 2043
49 Ga0070705_100108540 3300005440 Bacteria 1768
50 Ga0070705_100213522 3300005440 Bacteria 1332
51 Ga0070694_100001548 3300005444 Bacteria 13526
52 Ga0070694_100004848 3300005444 Bacteria 8103
53 Ga0070694_100006901 3300005444 Bacteria 6899
54 Ga0070694_100009463 3300005444 Bacteria 5977
55 Ga0070694_100011424 3300005444 Bacteria 5500
56 Ga0070694_100025211 3300005444 Bacteria 3846
57 Ga0070694_100045322 3300005444 Bacteria 2947
58 Ga0070694_100250493 3300005444 Unclassified 1339
59 Ga0070708_100002678 3300005445 Bacteria 13812
60 Ga0070708_100008243 3300005445 Bacteria 8366
61 Ga0070708_100008398 3300005445 Bacteria 8289
62 Ga0070708_100043046 3300005445 Bacteria 3967
63 Ga0070708_100086904 3300005445 Bacteria 2841
64 Ga0070708_100118018 3300005445 Bacteria 2444
65 Ga0070708_100144711 3300005445 Unclassified 2207
66 Ga0070706_100017797 3300005467 Bacteria 6556
67 Ga0070706_100120916 3300005467 Bacteria 2441
68 Ga0070706_100146244 3300005467 Bacteria 2207
69 Ga0070706_100180840 3300005467 Unclassified 1969
70 Ga0070706_100290017 3300005467 Bacteria 1527
71 Ga0070707_100060516 3300005468 Unclassified 3631
72 Ga0070707_100077918 3300005468 Bacteria 3198
73 Ga0070707_100240904 3300005468 Unclassified 1760
74 Ga0070707_100324873 3300005468 Unclassified 1495
75 Ga0070698_100000315 3300005471 Bacteria 49156
76 Ga0070698_100021817 3300005471 Bacteria 6706
77 Ga0070698_100044395 3300005471 Bacteria 4552
78 Ga0070698_100072135 3300005471 Bacteria 3462
79 Ga0070698_100085277 3300005471 Bacteria 3146
80 Ga0070699_100022023 3300005518 Bacteria 5489
81 Ga0070699_100035603 3300005518 Unclassified 4303
82 Ga0070699_100036890 3300005518 Bacteria 4229
83 Ga0070699_100039408 3300005518 Bacteria 4091
84 Ga0070699_100045500 3300005518 Bacteria 3798
85 Ga0070699_100089769 3300005518 Bacteria 2685
86 Ga0070699_100160209 3300005518 Bacteria 1991
87 Ga0070699_100256754 3300005518 Bacteria 1562
88 Ga0070679_100008763 3300005530 Bacteria 9543
89 Ga0070679_100159032 3300005530 Bacteria 2234
90 Ga0070684_100001186 3300005535 Bacteria 18731
91 Ga0070697_100001232 3300005536 Bacteria 19340
92 Ga0070697_100001636 3300005536 Bacteria 17082
93 Ga0070697_100129098 3300005536 Bacteria 2119
94 Ga0070672_100015096 3300005543 Bacteria 5490
95 Ga0070672_100067316 3300005543 Bacteria 2838
96 Ga0070686_100067456 3300005544 Bacteria 2331
97 Ga0070695_100000459 3300005545 Bacteria 21195
98 Ga0070695_100007915 3300005545 Bacteria 6292
99 Ga0070695_100024261 3300005545 Bacteria 3734
100 Ga0070695_100025512 3300005545 Bacteria 3650
101 Ga0070695_100040510 3300005545 Unclassified 2949
102 Ga0070695_100077316 3300005545 Bacteria 2193
103 Ga0070696_100000903 3300005546 Bacteria 19281
104 Ga0070696_100001232 3300005546 Bacteria 16614
105 Ga0070696_100007692 3300005546 Bacteria 7198
106 Ga0070696_100048833 3300005546 Bacteria 2938
107 Ga0070696_100082320 3300005546 Bacteria 2282
108 Ga0070665_100400624 3300005548 Bacteria 1380
109 Ga0070704_100004763 3300005549 Bacteria 7852
110 Ga0070704_100011683 3300005549 Bacteria 5393
111 Ga0070704_100040992 3300005549 Unclassified 3192
112 Ga0070704_100074490 3300005549 Bacteria 2476
113 Ga0068855_100018066 3300005563 Bacteria 8475
114 Ga0068855_100147288 3300005563 Bacteria 2679
115 Ga0070702_100015063 3300005615 Bacteria 3938
116 Ga0068859_100225556 3300005617 Unclassified 1962
117 Ga0068859_100354406 3300005617 Bacteria 1562
118 Ga0068866_10113353 3300005718 Bacteria 1516
119 Ga0068861_100287800 3300005719 Bacteria 1418
120 Ga0068858_100117085 3300005842 Bacteria 2490
121 Ga0068862_100013463 3300005844 Bacteria 6771
122 Ga0081538_10046562 3300005981 Bacteria 2673
123 Ga0075363_100038170 3300006048 Bacteria 2525
124 Ga0070715_10061887 3300006163 Bacteria 1645
125 Ga0070716_100002873 3300006173 Bacteria 8022
126 Ga0075428_100004416 3300006844 Bacteria 15528
127 Ga0075428_100027406 3300006844 Bacteria 6305
128 Ga0075428_100178132 3300006844 Unclassified 2302
129 Ga0075428_100375469 3300006844 Unclassified 1524
130 Ga0075430_100016372 3300006846 Bacteria 6313
131 Ga0075430_100023460 3300006846 Bacteria 5252
132 Ga0075430_100175538 3300006846 Bacteria 1783
133 Ga0075431_100037515 3300006847 Bacteria 4992
134 Ga0075431_100043634 3300006847 Unclassified 4624
135 Ga0075431_100099381 3300006847 Bacteria 3003
136 Ga0075431_100119392 3300006847 Bacteria 2720
137 Ga0075433_10003208 3300006852 Bacteria 12612
138 Ga0075433_10026257 3300006852 Bacteria 4929
139 Ga0075433_10070312 3300006852 Bacteria 3076
140 Ga0075433_10093889 3300006852 Unclassified 2655
141 Ga0075434_100000674 3300006871 Bacteria 26554
142 Ga0075434_100002155 3300006871 Bacteria 17149
143 Ga0075434_100004841 3300006871 Bacteria 12202
144 Ga0075434_100045708 3300006871 Unclassified 4344
145 Ga0075434_100061891 3300006871 Bacteria 3725
146 Ga0075434_100525014 3300006871 Bacteria 1204
147 Ga0075429_100019831 3300006880 Bacteria 5830
148 Ga0075429_100242960 3300006880 Bacteria 1577
149 Ga0068865_100046051 3300006881 Bacteria 2992
150 Ga0075436_100010206 3300006914 Bacteria 6431
151 Ga0075436_100014493 3300006914 Bacteria 5402
152 Ga0075436_100017824 3300006914 Unclassified 4862
153 Ga0075436_100086666 3300006914 Bacteria 2175
154 Ga0075436_100301004 3300006914 Unclassified 1149
155 Ga0097620_100225556 3300006931 Unclassified 1962
156 Ga0097620_100354414 3300006931 Bacteria 1562
157 Ga0075435_100002309 3300007076 Bacteria 12611
158 Ga0075435_100076818 3300007076 Bacteria 2737
159 Ga0075435_100380572 3300007076 Bacteria 1212
160 Ga0099794_10000007 3300007265 Bacteria 128667
161 Ga0099794_10028552 3300007265 Bacteria 2596
162 Ga0105240_10000990 3300009093 Bacteria 50703
163 Ga0105240_10011991 3300009093 Bacteria 12014
164 Ga0105240_10122812 3300009093 Bacteria 3125
165 Ga0111539_10001533 3300009094 Bacteria 30755
166 Ga0111539_10003100 3300009094 Bacteria 22025
167 Ga0111539_10005665 3300009094 Bacteria 16158
168 Ga0111539_10010733 3300009094 Bacteria 11529
169 Ga0111539_10012093 3300009094 Bacteria 10826
170 Ga0111539_10066425 3300009094 Bacteria 4260
171 Ga0111539_10131479 3300009094 Bacteria 2931
172 Ga0111539_10353428 3300009094 Bacteria 1710
173 Ga0105247_10101390 3300009101 Bacteria 1841
174 Ga0114129_10019488 3300009147 Bacteria 9661
175 Ga0114129_10030778 3300009147 Bacteria 7590
176 Ga0114129_10065094 3300009147 Bacteria 5088
177 Ga0114129_10105257 3300009147 Bacteria 3899
178 Ga0114129_10185290 3300009147 Bacteria 2829
179 Ga0114129_10252522 3300009147 Bacteria 2367
180 Ga0114129_10429534 3300009147 Bacteria 1736
181 Ga0114129_11038654 3300009147 Bacteria 1030
182 Ga0105243_10217360 3300009148 Bacteria 1687
183 Ga0105248_10032031 3300009177 Bacteria 5874
184 Ga0105237_10000101 3300009545 Bacteria 119322
185 Ga0105238_10025179 3300009551 Bacteria 6064
186 Ga0105238_10047866 3300009551 Bacteria 4310
187 Ga0105249_10151217 3300009553 Bacteria 2235
188 Ga0105249_10176603 3300009553 Bacteria 2075
189 Ga0157378_10169810 3300013297 Bacteria 2045
190 Ga0163162_10254970 3300013306 Bacteria 1886
191 Ga0163163_10000030 3300014325 Bacteria 171203
192 Ga0157380_10004651 3300014326 Bacteria 9548
193 Ga0157380_10005824 3300014326 Bacteria 8629
194 Ga0157380_10012096 3300014326 Bacteria 6246
195 Ga0157380_10205425 3300014326 Bacteria 1751
196 Ga0213876_10015397 3300021384 Bacteria 4048
197 Ga0213876_10049943 3300021384 Bacteria 2210
198 Ga0213876_10110358 3300021384 Unclassified 1460
199 Ga0207697_10048431 3300025315 Unclassified 1753
200 Ga0207653_10000005 3300025885 Bacteria 257928
201 Ga0207653_10001365 3300025885 Bacteria 7954
202 Ga0207653_10013361 3300025885 Bacteria 2571
203 Ga0207680_10027049 3300025903 Bacteria 3188
204 Ga0207645_10002793 3300025907 Bacteria 13589
205 Ga0207705_10001863 3300025909 Bacteria 16556
206 Ga0207684_10002682 3300025910 Bacteria 17782
207 Ga0207684_10012529 3300025910 Bacteria 7371
208 Ga0207684_10023971 3300025910 Bacteria 5207
209 Ga0207684_10029792 3300025910 Bacteria 4646
210 Ga0207684_10212474 3300025910 Bacteria 1669
211 Ga0207707_10459183 3300025912 Unclassified 1089
212 Ga0207695_10000991 3300025913 Bacteria 50282
213 Ga0207695_10081719 3300025913 Bacteria 3269
214 Ga0207671_10000194 3300025914 Bacteria 94161
215 Ga0207663_10000013 3300025916 Bacteria 167304
216 Ga0207660_10021148 3300025917 Bacteria 4373
217 Ga0207660_10030468 3300025917 Unclassified 3709
218 Ga0207662_10046692 3300025918 Bacteria 2563
219 Ga0207662_10076288 3300025918 Unclassified 2037
220 Ga0207652_10001123 3300025921 Bacteria 24094
221 Ga0207652_10008246 3300025921 Bacteria 8370
222 Ga0207652_10058113 3300025921 Bacteria 3332
223 Ga0207652_10072697 3300025921 Bacteria 2991
224 Ga0207646_10003090 3300025922 Bacteria 19145
225 Ga0207646_10007634 3300025922 Bacteria 10948
226 Ga0207646_10021562 3300025922 Bacteria 5952
227 Ga0207646_10037760 3300025922 Bacteria 4353
228 Ga0207646_10062668 3300025922 Unclassified 3320
229 Ga0207646_10089079 3300025922 Bacteria 2762
230 Ga0207646_10241034 3300025922 Bacteria 1633
231 Ga0207681_10001213 3300025923 Bacteria 16584
232 Ga0207694_10030256 3300025924 Bacteria 4135
233 Ga0207659_10134047 3300025926 Unclassified 1916
234 Ga0207700_10093960 3300025928 Bacteria 2375
235 Ga0207706_10050423 3300025933 Bacteria 3678
236 Ga0207670_10000001 3300025936 Bacteria 949312
237 Ga0207670_10169348 3300025936 Bacteria 1636
238 Ga0207669_10001360 3300025937 Bacteria 10413
239 Ga0207669_10009826 3300025937 Bacteria 4576
240 Ga0207665_10011119 3300025939 Bacteria 5905
241 Ga0207691_10090954 3300025940 Bacteria 2735
242 Ga0207691_10452402 3300025940 Bacteria 1093
243 Ga0207711_10055233 3300025941 Bacteria 3410
244 Ga0207689_10061537 3300025942 Unclassified 3087
245 Ga0207667_10039169 3300025949 Bacteria 5053
246 Ga0207651_10002995 3300025960 Bacteria 8181
247 Ga0207651_10027065 3300025960 Bacteria 3596
248 Ga0207651_10151342 3300025960 Bacteria 1806
249 Ga0207712_10119095 3300025961 Bacteria 1994
250 Ga0207668_10025773 3300025972 Bacteria 3809
251 Ga0207640_10074614 3300025981 Bacteria 2296
252 Ga0207677_10047779 3300026023 Bacteria 2876
253 Ga0207677_10242034 3300026023 Bacteria 1460
254 Ga0207677_10435428 3300026023 Unclassified 1120
255 Ga0207703_10093663 3300026035 Bacteria 2530
256 Ga0207708_10018978 3300026075 Bacteria 5178
257 Ga0207648_10048114 3300026089 Bacteria 3735
258 Ga0207674_10127321 3300026116 Bacteria 2512
259 Ga0207675_100021823 3300026118 Bacteria 5961
260 Ga0207675_100207811 3300026118 Bacteria 1882
261 Ga0207698_10220831 3300026142 Unclassified 1712
262 Ga0209588_1007365 3300027671 Unclassified 3232
263 Ga0207428_10000071 3300027907 Bacteria 144369
264 Ga0207428_10004486 3300027907 Bacteria 13241
265 Ga0207428_10025999 3300027907 Bacteria 4891
266 Ga0207428_10035612 3300027907 Bacteria 4067
267 Ga0268266_10343622 3300028379 Bacteria 1401
268 Ga0268265_10071579 3300028380 Bacteria 2701
269 Ga0268265_10191838 3300028380 Bacteria 1765
270 Ga0265334_10003874 3300028573 Bacteria 6747
271 Ga0265318_10000064 3300028577 Bacteria 103060
272 Ga0265318_10000183 3300028577 Bacteria 55325
273 Ga0265338_10100586 3300028800 Bacteria 2357
274 Ga0265330_10000074 3300031235 Bacteria 85757
275 Ga0265330_10000609 3300031235 Bacteria 23189
276 Ga0265332_10000086 3300031238 Bacteria 81718
277 Ga0265332_10000347 3300031238 Bacteria 34727
278 Ga0265328_10001529 3300031239 Bacteria 10684
279 Ga0265320_10000063 3300031240 Bacteria 99134
280 Ga0265320_10001287 3300031240 Bacteria 18297
281 Ga0265325_10034322 3300031241 Bacteria 2700
282 Ga0265329_10000152 3300031242 Bacteria 34026
283 Ga0265329_10003841 3300031242 Bacteria 6444
284 Ga0265339_10001674 3300031249 Bacteria 16381
285 Ga0265331_10000127 3300031250 Bacteria 99280
286 Ga0265331_10002550 3300031250 Bacteria 12247
287 Ga0265316_10001237 3300031344 Bacteria 27468
288 Ga0265316_10011881 3300031344 Bacteria 7829
289 Ga0265313_10000036 3300031595 Bacteria 124141
290 Ga0265314_10000167 3300031711 Bacteria 99227
291 Ga0265314_10006749 3300031711 Bacteria 10076
292 Ga0265314_10062159 3300031711 Bacteria 2539
293 Ga0265342_10001059 3300031712 Bacteria 26880
294 Ga0265342_10003461 3300031712 Bacteria 12935
295 Ga0316576_10042212 3300031727 Bacteria 3287
296 Ga0307410_10076890 3300031852 Bacteria 2331
297 Ga0307406_10014944 3300031901 Bacteria 4480
298 Ga0307409_100165646 3300031995 Bacteria 1939
299 Ga0307411_10046280 3300032005 Bacteria 2803
300 Ga0373950_0000002 3300034818 Bacteria 933559
301 Ga0373950_0000055 3300034818 Bacteria 80935
302 Ga0373953_0090457 3300035117 Bacteria 1280
303 Ga0373962_0047196 3300035242 Unclassified 1231
304 Ga0373935_0044947 3300035692 Bacteria 2785
305 Ga0373935_0090047 3300035692 Unclassified 2007
306 Ga0373933_0000142 3300035724 Bacteria 46265
307 Ga0373937_0314782 3300036401 Bacteria 1481
308 Ga0316582_0285599 3300036647 Bacteria 1133
309 Ga0373925_0049992 3300037068 Bacteria 3118
310 Ga0436364_0843729 3300037853 Bacteria 2206
311 Ga0436365_0045906 3300039437 Bacteria 10690
312 Ga0436365_0908986 3300039437 Bacteria 2500
313 Ga0451577_0015418 3300042876 Bacteria 7112
314 Ga0453683_0096964 3300044673 Unclassified 1850
315 Ga0451576_0002086 3300045051 Bacteria 31200
316 Ga0451576_0004588 3300045051 Bacteria 17829
317 Ga0451576_0092220 3300045051 Bacteria 3150
318 Ga0451576_0241619 3300045051 Unclassified 1886
319 Ga0451576_0385503 3300045051 Unclassified 1469
320 Ga0495638_0006031 3300046460 Bacteria 8871
321 Ga0495628_0001758 3300046516 Bacteria 19697
322 Ga0495630_0061291 3300046517 Bacteria 2825
323 Ga0495630_0077333 3300046517 Bacteria 2509
324 Ga0495642_0059549 3300046528 Unclassified 1583
325 Ga0495621_0037818 3300046539 Bacteria 1680
326 Ga0495634_0005532 3300046642 Bacteria 9699
327 Ga0495659_0010927 3300046664 Unclassified 2923
328 Ga0495674_0003749 3300047319 Bacteria 14784
329 Ga0495684_0002855 3300047471 Bacteria 13597
330 Ga0496104_0206994 3300048907 Bacteria 1874
331 Ga0496105_0024007 3300048908 Bacteria 4952
332 Ga0496109_0066435 3300048912 Bacteria 3302
333 Ga0496110_0175984 3300048913 Bacteria 1942
334 Ga0496112_0065256 3300048915 Unclassified 3593
335 Ga0496114_0009173 3300048917 Bacteria 7843
336 Ga0496115_0095544 3300048918 Bacteria 2433
337 Ga0501032_0133073 3300049569 Bacteria 1640
338 Ga0501033_0001063 3300049570 Bacteria 25063
339 Ga0501033_0027845 3300049570 Bacteria 4247
340 Ga0501034_0001075 3300049571 Bacteria 38694
341 Ga0501034_0097550 3300049571 Bacteria 2935
342 Ga0501036_0005745 3300049572 Bacteria 10063
343 Ga0501036_0012326 3300049572 Bacteria 7079
344 Ga0501037_0104171 3300049573 Bacteria 2046
345 Ga0501038_0086220 3300049574 Bacteria 2639
346 Ga0501040_0164347 3300049576 Bacteria 1570
347 Ga0501041_0058297 3300049577 Unclassified 2362
348 Ga0501041_0122671 3300049577 Bacteria 1616
349 Ga0501043_0035657 3300049579 Unclassified 3913
350 Ga0501043_0057082 3300049579 Bacteria 3066
351 Ga0501047_0000013 3300049581 Bacteria 364111
352 Ga0501047_0001502 3300049581 Bacteria 22752
353 Ga0501047_0080019 3300049581 Bacteria 3141
354 Ga0501048_0008518 3300049582 Bacteria 7753
355 Ga0501048_0092418 3300049582 Bacteria 2134
356 Ga0501048_0209760 3300049582 Bacteria 1382
357 Ga0501067_0000016 3300049583 Bacteria 106507
358 Ga0501067_0015264 3300049583 Bacteria 4252
359 Ga0501067_0018425 3300049583 Unclassified 3867
360 Ga0501067_0024372 3300049583 Unclassified 3356
361 Ga0501068_0000690 3300049584 Bacteria 17285
362 Ga0501069_0002735 3300049585 Bacteria 9004
363 Ga0501070_0000009 3300049586 Bacteria 197868
364 Ga0501070_0001654 3300049586 Bacteria 19763
365 Ga0501070_0079517 3300049586 Bacteria 2713
366 Ga0501070_0301466 3300049586 Unclassified 1305
367 Ga0501071_0021948 3300049587 Bacteria 4450
368 Ga0501071_0176167 3300049587 Bacteria 1602
369 Ga0501071_0402939 3300049587 Bacteria 1044
370 Ga0501072_0000024 3300049588 Bacteria 143714
371 Ga0501072_0000193 3300049588 Bacteria 44363
372 Ga0501072_0045006 3300049588 Bacteria 3470
373 Ga0501073_0001531 3300049589 Bacteria 17117
374 Ga0501073_0005122 3300049589 Bacteria 9832
375 Ga0501073_0005933 3300049589 Bacteria 9115
376 Ga0501073_0011505 3300049589 Bacteria 6470
377 Ga0501073_0015078 3300049589 Bacteria 5607
378 Ga0501073_0045031 3300049589 Bacteria 3108
379 Ga0501073_0112534 3300049589 Bacteria 1888
380 Ga0501073_0115487 3300049589 Bacteria 1861
381 Ga0501073_0161987 3300049589 Bacteria 1550
382 Ga0501074_0001071 3300049590 Bacteria 17853
383 Ga0501074_0010841 3300049590 Bacteria 6618
384 Ga0501074_0130032 3300049590 Bacteria 1801
385 Ga0501074_0315696 3300049590 Bacteria 1110
386 Ga0501075_0033710 3300049591 Bacteria 3810
387 Ga0501075_0037852 3300049591 Bacteria 3606
388 Ga0501075_0065364 3300049591 Bacteria 2744
389 Ga0501076_0011007 3300049592 Bacteria 6726
390 Ga0501076_0024409 3300049592 Bacteria 4673
391 Ga0501076_0038275 3300049592 Bacteria 3766
392 Ga0501076_0109048 3300049592 Bacteria 2237
393 Ga0501076_0426079 3300049592 Bacteria 1092
394 Ga0501077_0025273 3300049593 Unclassified 3772
395 Ga0501079_0000833 3300049741 Bacteria 20970
396 Ga0501079_0005950 3300049741 Bacteria 9128
397 Ga0501079_0133456 3300049741 Bacteria 1932
398 Ga0501080_0017440 3300049742 Bacteria 6640
399 Ga0501080_0096031 3300049742 Bacteria 2752
400 Ga0501080_0121322 3300049742 Bacteria 2422
401 Ga0501080_0154134 3300049742 Bacteria 2122
402 Ga0501081_0024802 3300049743 Bacteria 4029
403 Ga0501081_0102178 3300049743 Bacteria 2027
404 Ga0501081_0142016 3300049743 Bacteria 1721
405 Ga0501081_0233314 3300049743 Bacteria 1341
406 Ga0501081_0321960 3300049743 Bacteria 1137
407 Ga0501083_0001328 3300049744 Bacteria 16756
408 Ga0501083_0037073 3300049744 Bacteria 3322
409 Ga0501083_0042399 3300049744 Unclassified 3085
410 Ga0501083_0101764 3300049744 Bacteria 1894
411 Ga0501035_0052407 3300049822 Bacteria 3651
412 Ga0501035_0293078 3300049822 Bacteria 1373
413 Ga0501044_0083221 3300049823 Unclassified 3236
414 Ga0501044_0200431 3300049823 Bacteria 1954
415 Ga0501044_0339702 3300049823 Bacteria 1423
416 Ga0501045_0057318 3300049824 Bacteria 2851
417 Ga0501045_0064206 3300049824 Bacteria 2695
418 Ga0501045_0096046 3300049824 Bacteria 2193
419 nmdc:mga06z11_98747_c1 3300050494 Bacteria 1598
420 nmdc:mga05p37_23240_c1 3300050507 Bacteria 7519
421 nmdc:mga05p37_316852_c1 3300050507 Bacteria 1847
422 nmdc:mga05p37_321028_c1 3300050507 Bacteria 1833
423 nmdc:mga05p37_427018_c1 3300050507 Unclassified 1541
424 nmdc:mga05p37_504983_c1 3300050507 Bacteria 1387
425 nmdc:mga05p37_56027_c1 3300050507 Bacteria 4853
426 nmdc:mga05p37_63666_c1 3300050507 Bacteria 4538
427 nmdc:mga05p37_70505_c1 3300050507 Bacteria 4298
428 nmdc:mga09592_339950_c1 3300050508 Bacteria 1299
429 nmdc:mga0qj67_227314_c1 3300050509 Unclassified 1514
430 nmdc:mga0qj67_280683_c1 3300050509 Bacteria 1350
431 nmdc:mga06r32_10295_c1 3300050510 Bacteria 8434
432 nmdc:mga06r32_110742_c1 3300050510 Bacteria 2701
433 nmdc:mga06r32_110769_c1 3300050510 Bacteria 2701
434 nmdc:mga06r32_183898_c1 3300050510 Bacteria 2076
435 nmdc:mga06r32_43012_c1 3300050510 Bacteria 4297
436 nmdc:mga06r32_463063_c1 3300050510 Bacteria 1247
437 nmdc:mga08y16_31344_c1 3300050511 Bacteria 5591
438 nmdc:mga08y16_32_c1 3300050511 Bacteria 179220
439 nmdc:mga08y16_33288_c1 3300050511 Bacteria 5413
440 nmdc:mga08y16_6207_c1 3300050511 Bacteria 12537
441 nmdc:mga08y16_62510_c1 3300050511 Bacteria 3889
442 nmdc:mga0n895_2516_c1 3300050512 Bacteria 14356
443 nmdc:mga0n895_756_c1 3300050512 Bacteria 22884
444 nmdc:mga0rr50_306126_c1 3300050513 Unclassified 1330
445 nmdc:mga0rr50_341118_c1 3300050513 Bacteria 1259
446 nmdc:mga0rr50_49565_c1 3300050513 Bacteria 3109
447 nmdc:mga0rr50_77926_c1 3300050513 Bacteria 2549
448 nmdc:mga0rr50_80211_c1 3300050513 Bacteria 2516
449 nmdc:mga08x19_10368_c1 3300050514 Bacteria 5594
450 nmdc:mga08x19_284326_c1 3300050514 Unclassified 1147
451 nmdc:mga08x19_51800_c1 3300050514 Bacteria 2638
452 nmdc:mga0a205_109348_c1 3300050515 Bacteria 2663
453 nmdc:mga0a205_21151_c1 3300050515 Bacteria 6153
454 nmdc:mga0a205_264924_c1 3300050515 Bacteria 1596
455 nmdc:mga0a205_61985_c1 3300050515 Bacteria 3613
456 Ga0500568_0002568 3300053139 Bacteria 10581
457 Ga0501084_0000007 3300054114 Bacteria 215126
458 Ga0501084_0000041 3300054114 Bacteria 103074
459 Ga0501084_0065204 3300054114 Bacteria 3047
460 Ga0501084_0112377 3300054114 Bacteria 2289
461 Ga0501084_0213020 3300054114 Bacteria 1630
462 Ga0501084_0389676 3300054114 Bacteria 1177
463 Ga0501082_0000886 3300060353 Bacteria 26461
464 Ga0501082_0013041 3300060353 Bacteria 7142
465 Ga0501082_0025118 3300060353 Bacteria 5133
466 Ga0501082_0351978 3300060353 Bacteria 1284
467 Ga0530510_0045063 3300061734 Unclassified 3187
468 Ga0530510_0125585 3300061734 Bacteria 1886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0038275 Ga0501076_0038275_2853_3752 266
2 3300050513 nmdc:mga0rr50_306126_c1 nmdc:mga0rr50_306126_c1_16_906 278
3 3300049574 Ga0501038_0086220 Ga0501038_0086220_330_1352 286
4 3300049582 Ga0501048_0092418 Ga0501048_0092418_340_1362 286
5 3300049587 Ga0501071_0176167 Ga0501071_0176167_464_1486 286
6 3300049591 Ga0501075_0033710 Ga0501075_0033710_2510_3532 286
7 3300049592 Ga0501076_0109048 Ga0501076_0109048_1096_2118 286
8 3300049742 Ga0501080_0096031 Ga0501080_0096031_433_1455 286
9 3300049824 Ga0501045_0057318 Ga0501045_0057318_1186_2208 286
10 3300054114 Ga0501084_0389676 Ga0501084_0389676_97_1119 286
11 3300009147 Ga0114129_10030778 Ga0114129_100307786 288
12 3300049569 Ga0501032_0133073 Ga0501032_0133073_22_948 288
13 3300049586 Ga0501070_0301466 Ga0501070_0301466_191_1117 288
14 3300050507 nmdc:mga05p37_23240_c1 nmdc:mga05p37_23240_c1_5564_6586 288
15 3300006846 Ga0075430_100175538 Ga0075430_1001755382 293
16 3300049586 Ga0501070_0079517 Ga0501070_0079517_489_1448 293
17 3300050510 nmdc:mga06r32_463063_c1 nmdc:mga06r32_463063_c1_198_1223 293
18 3300046516 Ga0495628_0001758 Ga0495628_0001758_13098_14081 295
19 3300047471 Ga0495684_0002855 Ga0495684_0002855_211_1194 295
20 3300049577 Ga0501041_0122671 Ga0501041_0122671_18_1067 296
21 3300060353 Ga0501082_0351978 Ga0501082_0351978_183_1235 296
22 3300034818 Ga0373950_0000002 Ga0373950_0000002_782258_783277 300
23 3300049583 Ga0501067_0000016 Ga0501067_0000016_5298_6317 300
24 3300049589 Ga0501073_0001531 Ga0501073_0001531_1462_2481 300
25 3300005327 Ga0070658_10077632 Ga0070658_100776323 303
26 3300006846 Ga0075430_100023460 Ga0075430_1000234605 303
27 3300049590 Ga0501074_0315696 Ga0501074_0315696_15_1079 303
28 3300049743 Ga0501081_0102178 Ga0501081_0102178_16_1071 303
29 3300049822 Ga0501035_0293078 Ga0501035_0293078_263_1327 303
30 3300026118 Ga0207675_100207811 Ga0207675_1002078112 304
31 3300049743 Ga0501081_0024802 Ga0501081_0024802_2010_3029 304
32 3300054114 Ga0501084_0065204 Ga0501084_0065204_1665_2684 304
33 3300009093 Ga0105240_10011991 Ga0105240_100119911 306
34 3300005617 Ga0068859_100225556 Ga0068859_1002255562 309
35 3300006931 Ga0097620_100225556 Ga0097620_1002255561 309
36 3300009094 Ga0111539_10005665 Ga0111539_100056652 309
37 3300009094 Ga0111539_10131479 Ga0111539_101314792 309
38 3300009177 Ga0105248_10032031 Ga0105248_100320312 309
39 3300014325 Ga0163163_10000030 Ga0163163_1000003073 309
40 3300014326 Ga0157380_10205425 Ga0157380_102054251 309
41 3300025941 Ga0207711_10055233 Ga0207711_100552333 309
42 3300027907 Ga0207428_10035612 Ga0207428_100356122 309
43 3300035117 Ga0373953_0090457 Ga0373953_0090457_247_1245 309
44 3300036401 Ga0373937_0314782 Ga0373937_0314782_197_1195 309
45 3300048913 Ga0496110_0175984 Ga0496110_0175984_54_1052 309
46 3300049587 Ga0501071_0402939 Ga0501071_0402939_22_1017 309
47 3300049590 Ga0501074_0130032 Ga0501074_0130032_637_1641 309
48 3300050511 nmdc:mga08y16_31344_c1 nmdc:mga08y16_31344_c1_1115_2113 309
49 3300050511 nmdc:mga08y16_62510_c1 nmdc:mga08y16_62510_c1_826_1824 309
50 3300049824 Ga0501045_0096046 Ga0501045_0096046_26_1030 310
51 3300049589 Ga0501073_0115487 Ga0501073_0115487_575_1582 312
52 3300049744 Ga0501083_0037073 Ga0501083_0037073_1724_2731 312
53 3300054114 Ga0501084_0213020 Ga0501084_0213020_278_1285 312
54 3300005328 Ga0070676_10172446 Ga0070676_101724461 314
55 3300005331 Ga0070670_100214509 Ga0070670_1002145092 314
56 3300005337 Ga0070682_100095892 Ga0070682_1000958922 314
57 3300005345 Ga0070692_10006487 Ga0070692_100064874 314
58 3300005347 Ga0070668_100126352 Ga0070668_1001263522 314
59 3300005354 Ga0070675_100119492 Ga0070675_1001194923 314
60 3300005364 Ga0070673_100106979 Ga0070673_1001069792 314
61 3300005440 Ga0070705_100213522 Ga0070705_1002135222 314
62 3300005535 Ga0070684_100001186 Ga0070684_10000118612 314
63 3300009094 Ga0111539_10003100 Ga0111539_1000310016 314
64 3300025918 Ga0207662_10076288 Ga0207662_100762882 314
65 3300025933 Ga0207706_10050423 Ga0207706_100504232 314
66 3300025940 Ga0207691_10452402 Ga0207691_104524021 314
67 3300025960 Ga0207651_10027065 Ga0207651_100270653 314
68 3300025972 Ga0207668_10025773 Ga0207668_100257733 314
69 3300026023 Ga0207677_10435428 Ga0207677_104354281 314
70 3300026075 Ga0207708_10018978 Ga0207708_100189784 314
71 3300026089 Ga0207648_10048114 Ga0207648_100481143 314
72 3300035242 Ga0373962_0047196 Ga0373962_0047196_196_1200 314
73 3300048907 Ga0496104_0206994 Ga0496104_0206994_631_1635 314
74 3300049583 Ga0501067_0024372 Ga0501067_0024372_2248_3252 314
75 3300049589 Ga0501073_0011505 Ga0501073_0011505_5379_6383 314
76 3300005364 Ga0070673_100057519 Ga0070673_1000575193 315
77 3300005406 Ga0070703_10003059 Ga0070703_100030593 315
78 3300005406 Ga0070703_10016763 Ga0070703_100167632 315
79 3300005434 Ga0070709_10013892 Ga0070709_100138926 315
80 3300005436 Ga0070713_100140328 Ga0070713_1001403282 315
81 3300005439 Ga0070711_100000009 Ga0070711_10000000930 315
82 3300005440 Ga0070705_100026976 Ga0070705_1000269763 315
83 3300005444 Ga0070694_100004848 Ga0070694_1000048488 315
84 3300005444 Ga0070694_100006901 Ga0070694_1000069013 315
85 3300005444 Ga0070694_100025211 Ga0070694_1000252112 315
86 3300005445 Ga0070708_100002678 Ga0070708_1000026785 315
87 3300005445 Ga0070708_100086904 Ga0070708_1000869042 315
88 3300005445 Ga0070708_100144711 Ga0070708_1001447112 315
89 3300005467 Ga0070706_100120916 Ga0070706_1001209161 315
90 3300005468 Ga0070707_100240904 Ga0070707_1002409042 315
91 3300005471 Ga0070698_100000315 Ga0070698_10000031524 315
92 3300005471 Ga0070698_100021817 Ga0070698_1000218172 315
93 3300005471 Ga0070698_100072135 Ga0070698_1000721352 315
94 3300005518 Ga0070699_100039408 Ga0070699_1000394082 315
95 3300005518 Ga0070699_100089769 Ga0070699_1000897693 315
96 3300005518 Ga0070699_100160209 Ga0070699_1001602092 315
97 3300005545 Ga0070695_100024261 Ga0070695_1000242612 315
98 3300005545 Ga0070695_100040510 Ga0070695_1000405103 315
99 3300005545 Ga0070695_100077316 Ga0070695_1000773162 315
100 3300005549 Ga0070704_100011683 Ga0070704_1000116834 315
101 3300005549 Ga0070704_100074490 Ga0070704_1000744902 315
102 3300006163 Ga0070715_10061887 Ga0070715_100618872 315
103 3300006173 Ga0070716_100002873 Ga0070716_1000028737 315
104 3300006852 Ga0075433_10003208 Ga0075433_1000320811 315
105 3300006852 Ga0075433_10026257 Ga0075433_100262571 315
106 3300006852 Ga0075433_10070312 Ga0075433_100703122 315
107 3300006871 Ga0075434_100000674 Ga0075434_10000067410 315
108 3300006871 Ga0075434_100004841 Ga0075434_10000484111 315
109 3300006871 Ga0075434_100061891 Ga0075434_1000618914 315
110 3300006871 Ga0075434_100525014 Ga0075434_1005250141 315
111 3300006914 Ga0075436_100010206 Ga0075436_1000102065 315
112 3300006914 Ga0075436_100014493 Ga0075436_1000144933 315
113 3300007076 Ga0075435_100076818 Ga0075435_1000768183 315
114 3300009094 Ga0111539_10012093 Ga0111539_100120933 315
115 3300009094 Ga0111539_10353428 Ga0111539_103534282 315
116 3300009147 Ga0114129_11038654 Ga0114129_110386541 315
117 3300025885 Ga0207653_10001365 Ga0207653_100013652 315
118 3300025885 Ga0207653_10013361 Ga0207653_100133612 315
119 3300025910 Ga0207684_10002682 Ga0207684_100026827 315
120 3300025910 Ga0207684_10029792 Ga0207684_100297923 315
121 3300025910 Ga0207684_10212474 Ga0207684_102124742 315
122 3300025916 Ga0207663_10000013 Ga0207663_10000013126 315
123 3300025922 Ga0207646_10003090 Ga0207646_1000309011 315
124 3300025922 Ga0207646_10007634 Ga0207646_100076344 315
125 3300025922 Ga0207646_10241034 Ga0207646_102410342 315
126 3300025939 Ga0207665_10011119 Ga0207665_100111194 315
127 3300050511 nmdc:mga08y16_33288_c1 nmdc:mga08y16_33288_c1_3307_4344 315
128 3300050512 nmdc:mga0n895_2516_c1 nmdc:mga0n895_2516_c1_3919_4923 315
129 3300050512 nmdc:mga0n895_756_c1 nmdc:mga0n895_756_c1_10595_11599 315
130 3300050513 nmdc:mga0rr50_49565_c1 nmdc:mga0rr50_49565_c1_132_1136 315
131 3300050514 nmdc:mga08x19_10368_c1 nmdc:mga08x19_10368_c1_65_1069 315
132 3300050514 nmdc:mga08x19_51800_c1 nmdc:mga08x19_51800_c1_187_1191 315
133 3300050515 nmdc:mga0a205_109348_c1 nmdc:mga0a205_109348_c1_1391_2395 315
134 3300050515 nmdc:mga0a205_21151_c1 nmdc:mga0a205_21151_c1_4219_5223 315
135 3300005330 Ga0070690_100049217 Ga0070690_1000492172 316
136 3300005336 Ga0070680_100008659 Ga0070680_1000086596 316
137 3300005406 Ga0070703_10000328 Ga0070703_1000032822 316
138 3300005438 Ga0070701_10009262 Ga0070701_100092624 316
139 3300005440 Ga0070705_100014849 Ga0070705_1000148492 316
140 3300005440 Ga0070705_100076354 Ga0070705_1000763542 316
141 3300005440 Ga0070705_100108540 Ga0070705_1001085402 316
142 3300005444 Ga0070694_100001548 Ga0070694_1000015486 316
143 3300005444 Ga0070694_100011424 Ga0070694_1000114246 316
144 3300005444 Ga0070694_100045322 Ga0070694_1000453222 316
145 3300005445 Ga0070708_100008243 Ga0070708_1000082436 316
146 3300005445 Ga0070708_100008398 Ga0070708_1000083987 316
147 3300005445 Ga0070708_100043046 Ga0070708_1000430463 316
148 3300005467 Ga0070706_100017797 Ga0070706_1000177975 316
149 3300005467 Ga0070706_100146244 Ga0070706_1001462442 316
150 3300005467 Ga0070706_100180840 Ga0070706_1001808402 316
151 3300005467 Ga0070706_100290017 Ga0070706_1002900172 316
152 3300005468 Ga0070707_100060516 Ga0070707_1000605163 316
153 3300005468 Ga0070707_100077918 Ga0070707_1000779182 316
154 3300005471 Ga0070698_100085277 Ga0070698_1000852772 316
155 3300005518 Ga0070699_100022023 Ga0070699_1000220234 316
156 3300005518 Ga0070699_100035603 Ga0070699_1000356034 316
157 3300005518 Ga0070699_100036890 Ga0070699_1000368902 316
158 3300005518 Ga0070699_100045500 Ga0070699_1000455002 316
159 3300005518 Ga0070699_100256754 Ga0070699_1002567542 316
160 3300005536 Ga0070697_100001232 Ga0070697_1000012326 316
161 3300005536 Ga0070697_100001636 Ga0070697_10000163614 316
162 3300005545 Ga0070695_100000459 Ga0070695_10000045917 316
163 3300005545 Ga0070695_100007915 Ga0070695_1000079152 316
164 3300005545 Ga0070695_100025512 Ga0070695_1000255123 316
165 3300005546 Ga0070696_100000903 Ga0070696_1000009036 316
166 3300005546 Ga0070696_100001232 Ga0070696_10000123213 316
167 3300005546 Ga0070696_100007692 Ga0070696_1000076926 316
168 3300005546 Ga0070696_100082320 Ga0070696_1000823203 316
169 3300005549 Ga0070704_100004763 Ga0070704_1000047637 316
170 3300005549 Ga0070704_100040992 Ga0070704_1000409922 316
171 3300005615 Ga0070702_100015063 Ga0070702_1000150633 316
172 3300005617 Ga0068859_100354406 Ga0068859_1003544062 316
173 3300006844 Ga0075428_100004416 Ga0075428_10000441610 316
174 3300006844 Ga0075428_100375469 Ga0075428_1003754692 316
175 3300006846 Ga0075430_100016372 Ga0075430_1000163723 316
176 3300006847 Ga0075431_100037515 Ga0075431_1000375154 316
177 3300006847 Ga0075431_100043634 Ga0075431_1000436343 316
178 3300006852 Ga0075433_10093889 Ga0075433_100938892 316
179 3300006871 Ga0075434_100002155 Ga0075434_1000021557 316
180 3300006871 Ga0075434_100045708 Ga0075434_1000457082 316
181 3300006880 Ga0075429_100019831 Ga0075429_1000198312 316
182 3300006914 Ga0075436_100017824 Ga0075436_1000178244 316
183 3300006914 Ga0075436_100086666 Ga0075436_1000866662 316
184 3300006914 Ga0075436_100301004 Ga0075436_1003010042 316
185 3300006931 Ga0097620_100354414 Ga0097620_1003544142 316
186 3300007076 Ga0075435_100002309 Ga0075435_1000023099 316
187 3300007076 Ga0075435_100380572 Ga0075435_1003805722 316
188 3300007265 Ga0099794_10000007 Ga0099794_1000000730 316
189 3300007265 Ga0099794_10028552 Ga0099794_100285523 316
190 3300009147 Ga0114129_10065094 Ga0114129_100650942 316
191 3300009147 Ga0114129_10185290 Ga0114129_101852902 316
192 3300009147 Ga0114129_10252522 Ga0114129_102525222 316
193 3300025885 Ga0207653_10000005 Ga0207653_10000005106 316
194 3300025917 Ga0207660_10030468 Ga0207660_100304682 316
195 3300025922 Ga0207646_10037760 Ga0207646_100377605 316
196 3300025922 Ga0207646_10062668 Ga0207646_100626684 316
197 3300025922 Ga0207646_10089079 Ga0207646_100890792 316
198 3300027671 Ga0209588_1007365 Ga0209588_10073652 316
199 3300042876 Ga0451577_0015418 Ga0451577_0015418_954_1952 316
200 3300044673 Ga0453683_0096964 Ga0453683_0096964_726_1724 316
201 3300045051 Ga0451576_0002086 Ga0451576_0002086_2146_3144 316
202 3300045051 Ga0451576_0004588 Ga0451576_0004588_2946_3944 316
203 3300045051 Ga0451576_0092220 Ga0451576_0092220_438_1436 316
204 3300045051 Ga0451576_0241619 Ga0451576_0241619_278_1276 316
205 3300045051 Ga0451576_0385503 Ga0451576_0385503_220_1218 316
206 3300046517 Ga0495630_0077333 Ga0495630_0077333_1032_2042 316
207 3300046539 Ga0495621_0037818 Ga0495621_0037818_615_1613 316
208 3300050507 nmdc:mga05p37_321028_c1 nmdc:mga05p37_321028_c1_797_1816 316
209 3300050507 nmdc:mga05p37_504983_c1 nmdc:mga05p37_504983_c1_254_1291 316
210 3300050507 nmdc:mga05p37_70505_c1 nmdc:mga05p37_70505_c1_2439_3449 316
211 3300050509 nmdc:mga0qj67_227314_c1 nmdc:mga0qj67_227314_c1_328_1347 316
212 3300050509 nmdc:mga0qj67_280683_c1 nmdc:mga0qj67_280683_c1_14_1012 316
213 3300050510 nmdc:mga06r32_10295_c1 nmdc:mga06r32_10295_c1_5497_6507 316
214 3300050510 nmdc:mga06r32_43012_c1 nmdc:mga06r32_43012_c1_2801_3820 316
215 3300050513 nmdc:mga0rr50_341118_c1 nmdc:mga0rr50_341118_c1_43_1041 316
216 3300050513 nmdc:mga0rr50_77926_c1 nmdc:mga0rr50_77926_c1_48_1046 316
217 3300050513 nmdc:mga0rr50_80211_c1 nmdc:mga0rr50_80211_c1_510_1508 316
218 3300050514 nmdc:mga08x19_284326_c1 nmdc:mga08x19_284326_c1_90_1088 316
219 3300050515 nmdc:mga0a205_61985_c1 nmdc:mga0a205_61985_c1_1731_2741 316
220 3300005295 Ga0065707_10090896 Ga0065707_100908962 318
221 3300005345 Ga0070692_10064312 Ga0070692_100643122 318
222 3300005347 Ga0070668_100008122 Ga0070668_1000081228 318
223 3300005364 Ga0070673_100043383 Ga0070673_1000433833 318
224 3300005438 Ga0070701_10108673 Ga0070701_101086732 318
225 3300005444 Ga0070694_100009463 Ga0070694_1000094632 318
226 3300005444 Ga0070694_100250493 Ga0070694_1002504932 318
227 3300005445 Ga0070708_100118018 Ga0070708_1001180183 318
228 3300005468 Ga0070707_100324873 Ga0070707_1003248732 318
229 3300005471 Ga0070698_100044395 Ga0070698_1000443953 318
230 3300005536 Ga0070697_100129098 Ga0070697_1001290982 318
231 3300005546 Ga0070696_100048833 Ga0070696_1000488332 318
232 3300005719 Ga0068861_100287800 Ga0068861_1002878002 318
233 3300005844 Ga0068862_100013463 Ga0068862_1000134631 318
234 3300006048 Ga0075363_100038170 Ga0075363_1000381702 318
235 3300006844 Ga0075428_100027406 Ga0075428_1000274064 318
236 3300006844 Ga0075428_100178132 Ga0075428_1001781321 318
237 3300006847 Ga0075431_100099381 Ga0075431_1000993812 318
238 3300006847 Ga0075431_100119392 Ga0075431_1001193922 318
239 3300009094 Ga0111539_10010733 Ga0111539_100107335 318
240 3300009094 Ga0111539_10066425 Ga0111539_100664253 318
241 3300009101 Ga0105247_10101390 Ga0105247_101013902 318
242 3300009147 Ga0114129_10019488 Ga0114129_100194885 318
243 3300009147 Ga0114129_10105257 Ga0114129_101052573 318
244 3300009147 Ga0114129_10429534 Ga0114129_104295342 318
245 3300013306 Ga0163162_10254970 Ga0163162_102549702 318
246 3300014326 Ga0157380_10004651 Ga0157380_100046512 318
247 3300014326 Ga0157380_10005824 Ga0157380_100058244 318
248 3300021384 Ga0213876_10049943 Ga0213876_100499432 318
249 3300025910 Ga0207684_10012529 Ga0207684_100125297 318
250 3300025910 Ga0207684_10023971 Ga0207684_100239713 318
251 3300025922 Ga0207646_10021562 Ga0207646_100215624 318
252 3300025961 Ga0207712_10119095 Ga0207712_101190952 318
253 3300026116 Ga0207674_10127321 Ga0207674_101273212 318
254 3300027907 Ga0207428_10004486 Ga0207428_100044864 318
255 3300028380 Ga0268265_10191838 Ga0268265_101918382 318
256 3300031727 Ga0316576_10042212 Ga0316576_100422123 318
257 3300036647 Ga0316582_0285599 Ga0316582_0285599_97_1122 318
258 3300039437 Ga0436365_0045906 Ga0436365_0045906_2628_3653 318
259 3300046460 Ga0495638_0006031 Ga0495638_0006031_125_1186 318
260 3300049570 Ga0501033_0001063 Ga0501033_0001063_6459_7502 318
261 3300049572 Ga0501036_0012326 Ga0501036_0012326_4615_5667 318
262 3300049573 Ga0501037_0104171 Ga0501037_0104171_745_1779 318
263 3300049576 Ga0501040_0164347 Ga0501040_0164347_289_1341 318
264 3300049579 Ga0501043_0035657 Ga0501043_0035657_1228_2262 318
265 3300049581 Ga0501047_0001502 Ga0501047_0001502_8669_9703 318
266 3300049583 Ga0501067_0018425 Ga0501067_0018425_2115_3149 318
267 3300049584 Ga0501068_0000690 Ga0501068_0000690_11316_12350 318
268 3300049585 Ga0501069_0002735 Ga0501069_0002735_4731_5765 318
269 3300049587 Ga0501071_0021948 Ga0501071_0021948_1517_2569 318
270 3300049588 Ga0501072_0000024 Ga0501072_0000024_29069_30103 318
271 3300049589 Ga0501073_0045031 Ga0501073_0045031_759_1793 318
272 3300049589 Ga0501073_0112534 Ga0501073_0112534_789_1826 318
273 3300049590 Ga0501074_0010841 Ga0501074_0010841_3638_4672 318
274 3300049591 Ga0501075_0037852 Ga0501075_0037852_1212_2264 318
275 3300049592 Ga0501076_0011007 Ga0501076_0011007_17_1051 318
276 3300049592 Ga0501076_0426079 Ga0501076_0426079_30_1055 318
277 3300049593 Ga0501077_0025273 Ga0501077_0025273_2116_3150 318
278 3300049741 Ga0501079_0005950 Ga0501079_0005950_1644_2678 318
279 3300049742 Ga0501080_0154134 Ga0501080_0154134_759_1793 318
280 3300049743 Ga0501081_0142016 Ga0501081_0142016_239_1264 318
281 3300049743 Ga0501081_0233314 Ga0501081_0233314_20_1072 318
282 3300049743 Ga0501081_0321960 Ga0501081_0321960_12_1061 318
283 3300049744 Ga0501083_0042399 Ga0501083_0042399_1207_2241 318
284 3300049823 Ga0501044_0083221 Ga0501044_0083221_1316_2350 318
285 3300049824 Ga0501045_0064206 Ga0501045_0064206_1228_2280 318
286 3300050494 nmdc:mga06z11_98747_c1 nmdc:mga06z11_98747_c1_63_1124 318
287 3300050507 nmdc:mga05p37_427018_c1 nmdc:mga05p37_427018_c1_195_1223 318
288 3300050507 nmdc:mga05p37_56027_c1 nmdc:mga05p37_56027_c1_746_1795 318
289 3300050507 nmdc:mga05p37_63666_c1 nmdc:mga05p37_63666_c1_3118_4155 318
290 3300050510 nmdc:mga06r32_110742_c1 nmdc:mga06r32_110742_c1_1341_2390 318
291 3300050510 nmdc:mga06r32_110769_c1 nmdc:mga06r32_110769_c1_1562_2611 318
292 3300050510 nmdc:mga06r32_183898_c1 nmdc:mga06r32_183898_c1_331_1380 318
293 3300050511 nmdc:mga08y16_6207_c1 nmdc:mga08y16_6207_c1_4981_6030 318
294 3300053139 Ga0500568_0002568 Ga0500568_0002568_1284_2309 318
295 3300054114 Ga0501084_0000041 Ga0501084_0000041_55402_56436 318
296 3300060353 Ga0501082_0000886 Ga0501082_0000886_23239_24273 318
297 3300061734 Ga0530510_0045063 Ga0530510_0045063_1309_2343 318
298 3300003320 rootH2_10006051 rootH2_100060511 319
299 3300003323 rootH1_10012253 rootH1_100122534 319
300 3300003323 rootH1_10041377 rootH1_100413773 319
301 3300005327 Ga0070658_10000646 Ga0070658_1000064617 319
302 3300005330 Ga0070690_100097494 Ga0070690_1000974942 319
303 3300005337 Ga0070682_100036994 Ga0070682_1000369942 319
304 3300005337 Ga0070682_100241160 Ga0070682_1002411601 319
305 3300005338 Ga0068868_100078929 Ga0068868_1000789292 319
306 3300005340 Ga0070689_100000002 Ga0070689_100000002493 319
307 3300005340 Ga0070689_100205524 Ga0070689_1002055241 319
308 3300005343 Ga0070687_100032932 Ga0070687_1000329322 319
309 3300005353 Ga0070669_100003851 Ga0070669_1000038516 319
310 3300005353 Ga0070669_100007077 Ga0070669_1000070776 319
311 3300005356 Ga0070674_100012392 Ga0070674_1000123922 319
312 3300005356 Ga0070674_100056440 Ga0070674_1000564403 319
313 3300005364 Ga0070673_100113747 Ga0070673_1001137472 319
314 3300005364 Ga0070673_100185598 Ga0070673_1001855982 319
315 3300005365 Ga0070688_100011707 Ga0070688_1000117073 319
316 3300005365 Ga0070688_100190270 Ga0070688_1001902701 319
317 3300005365 Ga0070688_100207206 Ga0070688_1002072061 319
318 3300005367 Ga0070667_100188019 Ga0070667_1001880192 319
319 3300005436 Ga0070713_100204944 Ga0070713_1002049442 319
320 3300005530 Ga0070679_100008763 Ga0070679_1000087636 319
321 3300005530 Ga0070679_100159032 Ga0070679_1001590322 319
322 3300005543 Ga0070672_100015096 Ga0070672_1000150964 319
323 3300005543 Ga0070672_100067316 Ga0070672_1000673163 319
324 3300005544 Ga0070686_100067456 Ga0070686_1000674563 319
325 3300005548 Ga0070665_100400624 Ga0070665_1004006241 319
326 3300005563 Ga0068855_100018066 Ga0068855_1000180663 319
327 3300005563 Ga0068855_100147288 Ga0068855_1001472882 319
328 3300005718 Ga0068866_10113353 Ga0068866_101133532 319
329 3300005842 Ga0068858_100117085 Ga0068858_1001170853 319
330 3300005981 Ga0081538_10046562 Ga0081538_100465622 319
331 3300006880 Ga0075429_100242960 Ga0075429_1002429601 319
332 3300006881 Ga0068865_100046051 Ga0068865_1000460512 319
333 3300009093 Ga0105240_10000990 Ga0105240_1000099020 319
334 3300009093 Ga0105240_10122812 Ga0105240_101228123 319
335 3300009094 Ga0111539_10001533 Ga0111539_1000153324 319
336 3300009148 Ga0105243_10217360 Ga0105243_102173602 319
337 3300009545 Ga0105237_10000101 Ga0105237_1000010132 319
338 3300009551 Ga0105238_10025179 Ga0105238_100251795 319
339 3300009551 Ga0105238_10047866 Ga0105238_100478663 319
340 3300009553 Ga0105249_10151217 Ga0105249_101512172 319
341 3300009553 Ga0105249_10176603 Ga0105249_101766032 319
342 3300013297 Ga0157378_10169810 Ga0157378_101698103 319
343 3300014326 Ga0157380_10012096 Ga0157380_100120963 319
344 3300021384 Ga0213876_10015397 Ga0213876_100153974 319
345 3300021384 Ga0213876_10110358 Ga0213876_101103581 319
346 3300025315 Ga0207697_10048431 Ga0207697_100484312 319
347 3300025903 Ga0207680_10027049 Ga0207680_100270493 319
348 3300025907 Ga0207645_10002793 Ga0207645_100027932 319
349 3300025909 Ga0207705_10001863 Ga0207705_1000186311 319
350 3300025912 Ga0207707_10459183 Ga0207707_104591831 319
351 3300025913 Ga0207695_10000991 Ga0207695_1000099120 319
352 3300025913 Ga0207695_10081719 Ga0207695_100817192 319
353 3300025914 Ga0207671_10000194 Ga0207671_1000019420 319
354 3300025917 Ga0207660_10021148 Ga0207660_100211482 319
355 3300025918 Ga0207662_10046692 Ga0207662_100466922 319
356 3300025921 Ga0207652_10001123 Ga0207652_1000112310 319
357 3300025921 Ga0207652_10008246 Ga0207652_100082462 319
358 3300025921 Ga0207652_10058113 Ga0207652_100581132 319
359 3300025921 Ga0207652_10072697 Ga0207652_100726972 319
360 3300025923 Ga0207681_10001213 Ga0207681_100012139 319
361 3300025924 Ga0207694_10030256 Ga0207694_100302563 319
362 3300025926 Ga0207659_10134047 Ga0207659_101340471 319
363 3300025928 Ga0207700_10093960 Ga0207700_100939601 319
364 3300025936 Ga0207670_10000001 Ga0207670_10000001702 319
365 3300025936 Ga0207670_10169348 Ga0207670_101693482 319
366 3300025937 Ga0207669_10001360 Ga0207669_100013609 319
367 3300025937 Ga0207669_10009826 Ga0207669_100098263 319
368 3300025940 Ga0207691_10090954 Ga0207691_100909543 319
369 3300025942 Ga0207689_10061537 Ga0207689_100615372 319
370 3300025949 Ga0207667_10039169 Ga0207667_100391693 319
371 3300025960 Ga0207651_10002995 Ga0207651_100029952 319
372 3300025960 Ga0207651_10151342 Ga0207651_101513421 319
373 3300025981 Ga0207640_10074614 Ga0207640_100746142 319
374 3300026023 Ga0207677_10047779 Ga0207677_100477793 319
375 3300026023 Ga0207677_10242034 Ga0207677_102420342 319
376 3300026035 Ga0207703_10093663 Ga0207703_100936633 319
377 3300026118 Ga0207675_100021823 Ga0207675_1000218232 319
378 3300026142 Ga0207698_10220831 Ga0207698_102208311 319
379 3300027907 Ga0207428_10000071 Ga0207428_1000007161 319
380 3300027907 Ga0207428_10025999 Ga0207428_100259994 319
381 3300028379 Ga0268266_10343622 Ga0268266_103436221 319
382 3300028380 Ga0268265_10071579 Ga0268265_100715792 319
383 3300028573 Ga0265334_10003874 Ga0265334_100038743 319
384 3300028577 Ga0265318_10000064 Ga0265318_1000006478 319
385 3300028577 Ga0265318_10000183 Ga0265318_1000018315 319
386 3300028800 Ga0265338_10100586 Ga0265338_101005862 319
387 3300031235 Ga0265330_10000074 Ga0265330_100000744 319
388 3300031235 Ga0265330_10000609 Ga0265330_1000060915 319
389 3300031238 Ga0265332_10000086 Ga0265332_1000008662 319
390 3300031238 Ga0265332_10000347 Ga0265332_1000034715 319
391 3300031239 Ga0265328_10001529 Ga0265328_100015292 319
392 3300031240 Ga0265320_10000063 Ga0265320_1000006375 319
393 3300031240 Ga0265320_10001287 Ga0265320_1000128713 319
394 3300031241 Ga0265325_10034322 Ga0265325_100343222 319
395 3300031242 Ga0265329_10000152 Ga0265329_1000015216 319
396 3300031242 Ga0265329_10003841 Ga0265329_100038413 319
397 3300031249 Ga0265339_10001674 Ga0265339_100016746 319
398 3300031250 Ga0265331_10000127 Ga0265331_1000012775 319
399 3300031250 Ga0265331_10002550 Ga0265331_100025502 319
400 3300031344 Ga0265316_10001237 Ga0265316_100012377 319
401 3300031344 Ga0265316_10011881 Ga0265316_100118813 319
402 3300031595 Ga0265313_10000036 Ga0265313_1000003670 319
403 3300031711 Ga0265314_10000167 Ga0265314_1000016775 319
404 3300031711 Ga0265314_10006749 Ga0265314_100067497 319
405 3300031711 Ga0265314_10062159 Ga0265314_100621592 319
406 3300031712 Ga0265342_10001059 Ga0265342_1000105913 319
407 3300031712 Ga0265342_10003461 Ga0265342_1000346110 319
408 3300031852 Ga0307410_10076890 Ga0307410_100768903 319
409 3300031901 Ga0307406_10014944 Ga0307406_100149443 319
410 3300031995 Ga0307409_100165646 Ga0307409_1001656462 319
411 3300032005 Ga0307411_10046280 Ga0307411_100462803 319
412 3300034818 Ga0373950_0000055 Ga0373950_0000055_31652_32671 319
413 3300035692 Ga0373935_0044947 Ga0373935_0044947_395_1426 319
414 3300035692 Ga0373935_0090047 Ga0373935_0090047_823_1845 319
415 3300035724 Ga0373933_0000142 Ga0373933_0000142_31028_32047 319
416 3300037068 Ga0373925_0049992 Ga0373925_0049992_625_1647 319
417 3300037853 Ga0436364_0843729 Ga0436364_0843729_643_1668 319
418 3300039437 Ga0436365_0908986 Ga0436365_0908986_178_1203 319
419 3300046517 Ga0495630_0061291 Ga0495630_0061291_1174_2196 319
420 3300046528 Ga0495642_0059549 Ga0495642_0059549_291_1307 319
421 3300046642 Ga0495634_0005532 Ga0495634_0005532_7362_8384 319
422 3300046664 Ga0495659_0010927 Ga0495659_0010927_34_1050 319
423 3300047319 Ga0495674_0003749 Ga0495674_0003749_13276_14298 319
424 3300048908 Ga0496105_0024007 Ga0496105_0024007_751_1779 319
425 3300048912 Ga0496109_0066435 Ga0496109_0066435_1852_2874 319
426 3300048915 Ga0496112_0065256 Ga0496112_0065256_2226_3248 319
427 3300048917 Ga0496114_0009173 Ga0496114_0009173_4488_5507 319
428 3300048918 Ga0496115_0095544 Ga0496115_0095544_265_1284 319
429 3300049570 Ga0501033_0027845 Ga0501033_0027845_2432_3454 319
430 3300049571 Ga0501034_0001075 Ga0501034_0001075_15830_16849 319
431 3300049571 Ga0501034_0097550 Ga0501034_0097550_1054_2076 319
432 3300049572 Ga0501036_0005745 Ga0501036_0005745_7744_8763 319
433 3300049577 Ga0501041_0058297 Ga0501041_0058297_1234_2286 319
434 3300049579 Ga0501043_0057082 Ga0501043_0057082_539_1561 319
435 3300049581 Ga0501047_0000013 Ga0501047_0000013_125064_126083 319
436 3300049581 Ga0501047_0080019 Ga0501047_0080019_1282_2304 319
437 3300049582 Ga0501048_0008518 Ga0501048_0008518_6332_7351 319
438 3300049582 Ga0501048_0209760 Ga0501048_0209760_83_1135 319
439 3300049583 Ga0501067_0015264 Ga0501067_0015264_666_1691 319
440 3300049586 Ga0501070_0000009 Ga0501070_0000009_57380_58399 319
441 3300049586 Ga0501070_0001654 Ga0501070_0001654_18624_19643 319
442 3300049588 Ga0501072_0000193 Ga0501072_0000193_10160_11179 319
443 3300049588 Ga0501072_0045006 Ga0501072_0045006_1663_2694 319
444 3300049589 Ga0501073_0005122 Ga0501073_0005122_2193_3215 319
445 3300049589 Ga0501073_0005933 Ga0501073_0005933_7863_8882 319
446 3300049589 Ga0501073_0015078 Ga0501073_0015078_2969_3988 319
447 3300049589 Ga0501073_0161987 Ga0501073_0161987_263_1288 319
448 3300049590 Ga0501074_0001071 Ga0501074_0001071_12643_13662 319
449 3300049591 Ga0501075_0065364 Ga0501075_0065364_598_1629 319
450 3300049592 Ga0501076_0024409 Ga0501076_0024409_628_1659 319
451 3300049741 Ga0501079_0000833 Ga0501079_0000833_4122_5141 319
452 3300049741 Ga0501079_0133456 Ga0501079_0133456_189_1211 319
453 3300049742 Ga0501080_0017440 Ga0501080_0017440_3225_4244 319
454 3300049742 Ga0501080_0121322 Ga0501080_0121322_1326_2345 319
455 3300049744 Ga0501083_0001328 Ga0501083_0001328_6281_7300 319
456 3300049744 Ga0501083_0101764 Ga0501083_0101764_617_1639 319
457 3300049822 Ga0501035_0052407 Ga0501035_0052407_1217_2239 319
458 3300049823 Ga0501044_0200431 Ga0501044_0200431_864_1886 319
459 3300049823 Ga0501044_0339702 Ga0501044_0339702_307_1326 319
460 3300050507 nmdc:mga05p37_316852_c1 nmdc:mga05p37_316852_c1_348_1376 319
461 3300050508 nmdc:mga09592_339950_c1 nmdc:mga09592_339950_c1_24_1052 319
462 3300050511 nmdc:mga08y16_32_c1 nmdc:mga08y16_32_c1_30604_31632 319
463 3300050515 nmdc:mga0a205_264924_c1 nmdc:mga0a205_264924_c1_38_1066 319
464 3300054114 Ga0501084_0000007 Ga0501084_0000007_33401_34420 319
465 3300054114 Ga0501084_0112377 Ga0501084_0112377_1055_2086 319
466 3300060353 Ga0501082_0013041 Ga0501082_0013041_1299_2318 319
467 3300060353 Ga0501082_0025118 Ga0501082_0025118_2501_3520 319
468 3300061734 Ga0530510_0125585 Ga0530510_0125585_663_1694 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

162

364

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8735 4 317
3lwb-assembly1.cif.gz_B crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis 0.8593 3 317
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8552 4 317
4egj-assembly6.cif.gz_D-2 crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.8545 5 315
3r23-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis 0.8517 4 317
ID Description Score Start End Superfamily
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9087 195 298 3.30.470.20
af_Q4DAR2_102_200_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8924 113 197 3.30.1490.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8917 101 315 3.30.470.20
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8914 101 317 3.40.50.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8828 194 315 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A353EST0-F1-model_v4 D-alanine--D-alanine ligase 0.9783 31 317 GO:0005524
GO:0008716
GO:0046872
AF-X1CHP1-F1-model_v4 ATP-grasp domain-containing protein 0.9706 105 317 GO:0005524
GO:0008716
GO:0046872
AF-A0A7W0K6Z7-F1-model_v4 ATP-grasp domain-containing protein 0.9695 150 317 GO:0005524
GO:0008716
GO:0046872
AF-A0A7V1N8J5-F1-model_v4 D-alanine--D-alanine ligase 0.9691 105 317 GO:0005524
GO:0008716
GO:0046872
AF-A0A2V6JVV0-F1-model_v4 ATP-grasp domain-containing protein 0.9691 38 275 GO:0005524
GO:0008716
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.49 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map