metagRoot

F450041

General Info

Members	Datasets	Scaffolds	Average Seq Length
468	224	465	314

Family's Representative Sequence

Representative Sequence	3300021384\|Ga0213876_10004644\|Ga0213876_100046447
Length	389
Sequence	MHDAPNSPPADDPSVTSSSALNRRDFFQRTGLAWAGAALGGSLLGSADARAQDREGYPVPNENSKQPPMTLTPLEERREKGQIPRRKFGKHDLWISAIGVGGFSIGGEKVPEQEGIAIVQEAVDRGVNFFDNAWEYNKHVSEERMGKALAEGGRRDKVFLMTKVCTHGRDAQVGMQQLEESLKRLRTDHLDLWQIHECVYWNDPERHFMKGGVIEALTKAKEQGKVRFVGFTGHKDPAIHLAMLAYDYPFDTCQLPLNVFDASFHSFEQRVLPELHRRGILPIGMKSLNGNARAQQQHVVSVEEALGYAMSLPVLTTVSGMDTLPILRENLQVATDFQRYPAEKMAALRQKFADNVASDGRFELYKTTNDYEASEGRAQHGFPQQPVKA

Samples

	Sample ID	Description	Type	Environment
1	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
2	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
28	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
29	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
30	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
35	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
36	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
37	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
38	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
39	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
40	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
41	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
42	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
43	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
44	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
59	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
64	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
65	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
71	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
72	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
73	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
74	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
75	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
77	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
78	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
83	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
91	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
92	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
93	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
94	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
102	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
103	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
104	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
151	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
155	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
156	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
157	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
158	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
159	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
160	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
161	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
162	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
163	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
164	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
166	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
167	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
168	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
169	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
170	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
171	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
172	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
173	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
174	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
175	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
176	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
177	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
178	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
179	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
180	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
181	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
182	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
183	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
184	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
187	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
188	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
189	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
190	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
191	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
192	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
194	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
195	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
196	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
197	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
198	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
199	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
200	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
202	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
203	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
205	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
206	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
207	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
208	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
211	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
212	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
213	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
214	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
215	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
216	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
217	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
218	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
219	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
220	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
221	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
222	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
223	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
224	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.79
Metatranscriptomes	0.21
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.43
Nodule	0
Rhizoplane	1.92
Rhizosphere	93.38
Stem	0
Stem Tuber	0
Unclassified	4.27

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10070031	3300001990	Bacteria	1048
2	rootH2_10035442	3300003320	Bacteria	7842
3	Ga0065712_10145431	3300005290	Bacteria	1408
4	Ga0065715_10129256	3300005293	Bacteria	2049
5	Ga0065715_10242921	3300005293	Bacteria	1193
6	Ga0070658_10007388	3300005327	Bacteria	8878
7	Ga0070658_10023277	3300005327	Bacteria	4973
8	Ga0070658_10174175	3300005327	Bacteria	1809
9	Ga0070676_10295135	3300005328	Bacteria	1097
10	Ga0070683_100044527	3300005329	Bacteria	4092
11	Ga0070683_100059228	3300005329	Bacteria	3557
12	Ga0070683_100277711	3300005329	Unclassified	1594
13	Ga0070683_100386283	3300005329	Bacteria	1334
14	Ga0070690_100011669	3300005330	Bacteria	5145
15	Ga0070690_100049491	3300005330	Bacteria	2679
16	Ga0070670_100039177	3300005331	Bacteria	4075
17	Ga0070670_100080973	3300005331	Bacteria	2790
18	Ga0070677_10024858	3300005333	Bacteria	2231
19	Ga0068869_100018124	3300005334	Bacteria	4787
20	Ga0068869_100084110	3300005334	Bacteria	2381
21	Ga0070666_10018108	3300005335	Bacteria	4523
22	Ga0068868_100160787	3300005338	Bacteria	1855
23	Ga0070689_100016863	3300005340	Bacteria	5354
24	Ga0070691_10011441	3300005341	Bacteria	4052
25	Ga0070691_10086637	3300005341	Bacteria	1539
26	Ga0070687_100089436	3300005343	Bacteria	1700
27	Ga0070687_100214748	3300005343	Bacteria	1174
28	Ga0070692_10131458	3300005345	Unclassified	1407
29	Ga0070668_100020536	3300005347	Bacteria	4986
30	Ga0070669_100009405	3300005353	Bacteria	6959
31	Ga0070669_100138839	3300005353	Bacteria	1872
32	Ga0070669_100289356	3300005353	Bacteria	1315
33	Ga0070675_100003129	3300005354	Bacteria	12516
34	Ga0070675_100011746	3300005354	Bacteria	6860
35	Ga0070675_100013837	3300005354	Bacteria	6352
36	Ga0070675_100109717	3300005354	Bacteria	2333
37	Ga0070671_100018222	3300005355	Bacteria	5700
38	Ga0070674_100005509	3300005356	Bacteria	7315
39	Ga0070674_100070243	3300005356	Bacteria	2474
40	Ga0070674_100162438	3300005356	Bacteria	1696
41	Ga0070674_100338198	3300005356	Bacteria	1212
42	Ga0070673_100010959	3300005364	Bacteria	6168
43	Ga0070673_100044776	3300005364	Bacteria	3428
44	Ga0070673_100149337	3300005364	Bacteria	1978
45	Ga0070673_100211002	3300005364	Bacteria	1677
46	Ga0070688_100011421	3300005365	Bacteria	4934
47	Ga0070688_100045224	3300005365	Bacteria	2719
48	Ga0070659_100194511	3300005366	Bacteria	1668
49	Ga0070667_100007503	3300005367	Bacteria	9045
50	Ga0070667_100035657	3300005367	Bacteria	4168
51	Ga0070714_100094283	3300005435	Bacteria	2627
52	Ga0070713_100027306	3300005436	Bacteria	4492
53	Ga0070701_10006177	3300005438	Bacteria	5021
54	Ga0070705_100058258	3300005440	Bacteria	2282
55	Ga0070705_100162675	3300005440	Bacteria	1494
56	Ga0070700_100002436	3300005441	Bacteria	9468
57	Ga0070700_100020487	3300005441	Bacteria	3831
58	Ga0070694_100055108	3300005444	Bacteria	2696
59	Ga0070694_100128202	3300005444	Bacteria	1830
60	Ga0070708_100087411	3300005445	Bacteria	2832
61	Ga0070663_100023416	3300005455	Bacteria	4140
62	Ga0070678_100085964	3300005456	Bacteria	2398
63	Ga0070678_100188827	3300005456	Bacteria	1693
64	Ga0070662_100074729	3300005457	Bacteria	2508
65	Ga0070662_100164590	3300005457	Bacteria	1737
66	Ga0068867_100001347	3300005459	Bacteria	16987
67	Ga0068867_100059461	3300005459	Bacteria	2833
68	Ga0068867_100070348	3300005459	Bacteria	2616
69	Ga0070685_10026855	3300005466	Bacteria	3177
70	Ga0070706_100131174	3300005467	Bacteria	2338
71	Ga0070707_100312830	3300005468	Bacteria	1526
72	Ga0070698_100229603	3300005471	Bacteria	1789
73	Ga0070699_100022096	3300005518	Bacteria	5481
74	Ga0070679_100513053	3300005530	Bacteria	1143
75	Ga0070684_100000714	3300005535	Bacteria	23012
76	Ga0070684_100141616	3300005535	Unclassified	2174
77	Ga0070672_100007921	3300005543	Bacteria	7256
78	Ga0070672_100033139	3300005543	Bacteria	3909
79	Ga0070672_100043922	3300005543	Bacteria	3450
80	Ga0070672_100066177	3300005543	Bacteria	2861
81	Ga0070672_100097866	3300005543	Unclassified	2376
82	Ga0070672_100302982	3300005543	Bacteria	1355
83	Ga0070672_100314227	3300005543	Bacteria	1330
84	Ga0070695_100002660	3300005545	Bacteria	10334
85	Ga0070665_100004782	3300005548	Bacteria	14096
86	Ga0070704_100001425	3300005549	Bacteria	12765
87	Ga0070704_100121798	3300005549	Bacteria	2005
88	Ga0070664_100003237	3300005564	Bacteria	13160
89	Ga0070664_100012949	3300005564	Bacteria	6786
90	Ga0070664_100018558	3300005564	Bacteria	5716
91	Ga0070664_100019213	3300005564	Bacteria	5621
92	Ga0070664_100140295	3300005564	Bacteria	2128
93	Ga0068857_100003244	3300005577	Bacteria	13510
94	Ga0068854_100409678	3300005578	Bacteria	1124
95	Ga0070702_100027779	3300005615	Bacteria	3057
96	Ga0070702_100037969	3300005615	Bacteria	2678
97	Ga0070702_100072808	3300005615	Bacteria	2034
98	Ga0068852_100009281	3300005616	Bacteria	7293
99	Ga0068852_100055572	3300005616	Bacteria	3418
100	Ga0068852_100247153	3300005616	Unclassified	1708
101	Ga0068859_100032023	3300005617	Bacteria	5282
102	Ga0068864_100040638	3300005618	Bacteria	3978
103	Ga0068864_100065783	3300005618	Bacteria	3145
104	Ga0068866_10190996	3300005718	Bacteria	1217
105	Ga0068861_100001061	3300005719	Bacteria	16918
106	Ga0068861_100046848	3300005719	Bacteria	3261
107	Ga0068870_10005865	3300005840	Bacteria	5393
108	Ga0068870_10008887	3300005840	Bacteria	4538
109	Ga0068870_10016665	3300005840	Bacteria	3517
110	Ga0068863_100160833	3300005841	Bacteria	2151
111	Ga0068858_100008226	3300005842	Bacteria	10030
112	Ga0068858_100071714	3300005842	Bacteria	3213
113	Ga0068858_100108059	3300005842	Bacteria	2597
114	Ga0068858_100136140	3300005842	Bacteria	2305
115	Ga0068858_100466974	3300005842	Unclassified	1217
116	Ga0068860_100027550	3300005843	Bacteria	5471
117	Ga0068860_100063228	3300005843	Bacteria	3516
118	Ga0068860_100532000	3300005843	Bacteria	1176
119	Ga0068862_100008545	3300005844	Bacteria	8471
120	Ga0081539_10077709	3300005985	Bacteria	1754
121	Ga0070717_10254500	3300006028	Bacteria	1552
122	Ga0070717_10455159	3300006028	Bacteria	1154
123	Ga0075365_10010439	3300006038	Bacteria	5411
124	Ga0097621_100003906	3300006237	Bacteria	10333
125	Ga0097621_100025624	3300006237	Bacteria	4615
126	Ga0068871_100001563	3300006358	Bacteria	15359
127	Ga0068871_100197869	3300006358	Bacteria	1734
128	Ga0075428_100010488	3300006844	Bacteria	10297
129	Ga0075428_100052449	3300006844	Bacteria	4470
130	Ga0075430_100002125	3300006846	Bacteria	16402
131	Ga0075430_100022269	3300006846	Bacteria	5389
132	Ga0075430_100041931	3300006846	Bacteria	3871
133	Ga0075430_100151423	3300006846	Bacteria	1931
134	Ga0075430_100232295	3300006846	Bacteria	1529
135	Ga0075431_100021393	3300006847	Bacteria	6614
136	Ga0075431_100022919	3300006847	Bacteria	6382
137	Ga0075431_100043085	3300006847	Bacteria	4657
138	Ga0075433_10017805	3300006852	Bacteria	5894
139	Ga0075434_100394117	3300006871	Bacteria	1405
140	Ga0075429_100016632	3300006880	Bacteria	6371
141	Ga0075429_100132714	3300006880	Unclassified	2179
142	Ga0075429_100135313	3300006880	Bacteria	2157
143	Ga0075429_100328057	3300006880	Bacteria	1339
144	Ga0068865_100013837	3300006881	Bacteria	5114
145	Ga0068865_100025254	3300006881	Bacteria	3906
146	Ga0068865_100095493	3300006881	Bacteria	2166
147	Ga0068865_100098587	3300006881	Bacteria	2135
148	Ga0068865_100191546	3300006881	Bacteria	1582
149	Ga0068865_100218999	3300006881	Unclassified	1487
150	Ga0068865_100229095	3300006881	Bacteria	1457
151	Ga0097620_100032021	3300006931	Bacteria	5282
152	Ga0075435_100024652	3300007076	Bacteria	4671
153	Ga0099794_10003689	3300007265	Bacteria	5892
154	Ga0105240_10000026	3300009093	Bacteria	355569
155	Ga0105240_10115771	3300009093	Bacteria	3235
156	Ga0105240_10210006	3300009093	Bacteria	2276
157	Ga0111539_10000039	3300009094	Bacteria	139160
158	Ga0111539_10006742	3300009094	Bacteria	14776
159	Ga0111539_10011565	3300009094	Bacteria	11078
160	Ga0111539_10037620	3300009094	Bacteria	5842
161	Ga0111539_10156775	3300009094	Bacteria	2664
162	Ga0111539_10214295	3300009094	Bacteria	2243
163	Ga0111539_10416667	3300009094	Bacteria	1564
164	Ga0105245_10029439	3300009098	Bacteria	4852
165	Ga0114129_10001227	3300009147	Bacteria	34095
166	Ga0114129_10010192	3300009147	Bacteria	13398
167	Ga0114129_10013348	3300009147	Bacteria	11703
168	Ga0114129_10042529	3300009147	Bacteria	6398
169	Ga0114129_10090269	3300009147	Bacteria	4247
170	Ga0114129_10120641	3300009147	Bacteria	3610
171	Ga0105243_10011396	3300009148	Bacteria	6728
172	Ga0105243_10027426	3300009148	Bacteria	4364
173	Ga0105243_10639580	3300009148	Bacteria	1029
174	Ga0105241_10512494	3300009174	Bacteria	1071
175	Ga0105242_10028899	3300009176	Bacteria	4417
176	Ga0105242_10050612	3300009176	Bacteria	3383
177	Ga0105242_10072658	3300009176	Bacteria	2857
178	Ga0105248_10021065	3300009177	Bacteria	7224
179	Ga0105248_10049888	3300009177	Bacteria	4693
180	Ga0105248_10057673	3300009177	Bacteria	4359
181	Ga0105248_10308719	3300009177	Bacteria	1781
182	Ga0105248_10314897	3300009177	Bacteria	1763
183	Ga0105248_10343352	3300009177	Bacteria	1681
184	Ga0105248_10378581	3300009177	Bacteria	1593
185	Ga0105248_10757093	3300009177	Bacteria	1096
186	Ga0105237_10006912	3300009545	Bacteria	12512
187	Ga0105238_10000174	3300009551	Bacteria	70407
188	Ga0105238_10027674	3300009551	Bacteria	5778
189	Ga0105238_10287454	3300009551	Bacteria	1626
190	Ga0105249_10197634	3300009553	Bacteria	1966
191	Ga0105249_10568616	3300009553	Bacteria	1186
192	Ga0105239_10006869	3300010375	Bacteria	13131
193	Ga0105239_10121038	3300010375	Bacteria	2907
194	Ga0157373_10045659	3300013100	Bacteria	3127
195	Ga0157369_10015669	3300013105	Bacteria	8543
196	Ga0157369_10232907	3300013105	Bacteria	1925
197	Ga0157374_10084525	3300013296	Bacteria	3016
198	Ga0157374_10203860	3300013296	Unclassified	1937
199	Ga0157378_10160162	3300013297	Bacteria	2104
200	Ga0157378_10642629	3300013297	Bacteria	1076
201	Ga0163162_10554018	3300013306	Bacteria	1278
202	Ga0157375_10015236	3300013308	Bacteria	6879
203	Ga0163163_10154251	3300014325	Bacteria	2340
204	Ga0157380_10099645	3300014326	Bacteria	2417
205	Ga0157380_10240617	3300014326	Bacteria	1631
206	Ga0157380_10247158	3300014326	Bacteria	1612
207	Ga0157377_10061783	3300014745	Unclassified	2142
208	Ga0157379_10049782	3300014968	Bacteria	3741
209	Ga0157376_10148310	3300014969	Bacteria	2112
210	Ga0157376_10227544	3300014969	Bacteria	1731
211	Ga0182007_10071651	3300015262	Unclassified	1135
212	Ga0213876_10003354	3300021384	Bacteria	9166
213	Ga0213876_10004644	3300021384	Bacteria	7654
214	Ga0213875_10000002	3300021388	Bacteria	921066
215	Ga0213875_10008931	3300021388	Bacteria	5105
216	Ga0207697_10012128	3300025315	Bacteria	3625
217	Ga0207682_10003611	3300025893	Bacteria	6685
218	Ga0207682_10024903	3300025893	Bacteria	2372
219	Ga0207682_10047474	3300025893	Bacteria	1768
220	Ga0207688_10106547	3300025901	Bacteria	1623
221	Ga0207680_10048632	3300025903	Bacteria	2520
222	Ga0207645_10003643	3300025907	Bacteria	11628
223	Ga0207645_10007945	3300025907	Bacteria	7448
224	Ga0207645_10010811	3300025907	Bacteria	6254
225	Ga0207643_10016482	3300025908	Bacteria	4031
226	Ga0207643_10031170	3300025908	Bacteria	2970
227	Ga0207705_10011092	3300025909	Bacteria	6533
228	Ga0207705_10023385	3300025909	Bacteria	4409
229	Ga0207695_10000246	3300025913	Bacteria	140972
230	Ga0207695_10268101	3300025913	Bacteria	1604
231	Ga0207662_10007722	3300025918	Bacteria	5861
232	Ga0207657_10083455	3300025919	Bacteria	2680
233	Ga0207646_10084812	3300025922	Bacteria	2834
234	Ga0207681_10005876	3300025923	Bacteria	7525
235	Ga0207681_10016520	3300025923	Bacteria	4618
236	Ga0207694_10001106	3300025924	Bacteria	23353
237	Ga0207694_10016323	3300025924	Bacteria	5605
238	Ga0207650_10049004	3300025925	Unclassified	3118
239	Ga0207650_10050652	3300025925	Bacteria	3072
240	Ga0207650_10214398	3300025925	Bacteria	1547
241	Ga0207659_10003883	3300025926	Bacteria	9011
242	Ga0207659_10016458	3300025926	Bacteria	4812
243	Ga0207687_10083655	3300025927	Bacteria	2311
244	Ga0207687_10208175	3300025927	Bacteria	1533
245	Ga0207700_10036097	3300025928	Bacteria	3567
246	Ga0207644_10007379	3300025931	Bacteria	7162
247	Ga0207644_10088568	3300025931	Bacteria	2302
248	Ga0207644_10100892	3300025931	Unclassified	2168
249	Ga0207690_10107701	3300025932	Bacteria	2002
250	Ga0207690_10192805	3300025932	Bacteria	1542
251	Ga0207706_10069323	3300025933	Bacteria	3102
252	Ga0207706_10180355	3300025933	Bacteria	1855
253	Ga0207706_10326767	3300025933	Bacteria	1334
254	Ga0207686_10011615	3300025934	Bacteria	4827
255	Ga0207709_10042934	3300025935	Bacteria	2723
256	Ga0207709_10171866	3300025935	Bacteria	1522
257	Ga0207709_10234569	3300025935	Bacteria	1331
258	Ga0207670_10055604	3300025936	Bacteria	2675
259	Ga0207669_10061328	3300025937	Bacteria	2310
260	Ga0207669_10097561	3300025937	Bacteria	1933
261	Ga0207704_10010975	3300025938	Bacteria	4442
262	Ga0207704_10034227	3300025938	Bacteria	2897
263	Ga0207704_10134516	3300025938	Bacteria	1718
264	Ga0207704_10152492	3300025938	Unclassified	1632
265	Ga0207704_10166674	3300025938	Bacteria	1574
266	Ga0207704_10185744	3300025938	Unclassified	1507
267	Ga0207691_10012932	3300025940	Bacteria	7993
268	Ga0207691_10023670	3300025940	Bacteria	5782
269	Ga0207691_10042749	3300025940	Bacteria	4176
270	Ga0207691_10061413	3300025940	Bacteria	3414
271	Ga0207691_10188172	3300025940	Bacteria	1802
272	Ga0207711_10010874	3300025941	Bacteria	7563
273	Ga0207711_10030540	3300025941	Bacteria	4545
274	Ga0207711_10036787	3300025941	Bacteria	4154
275	Ga0207711_10146520	3300025941	Bacteria	2128
276	Ga0207711_10258245	3300025941	Unclassified	1601
277	Ga0207711_10446266	3300025941	Bacteria	1204
278	Ga0207689_10000753	3300025942	Bacteria	31100
279	Ga0207689_10085652	3300025942	Bacteria	2590
280	Ga0207689_10137582	3300025942	Bacteria	2011
281	Ga0207689_10259232	3300025942	Bacteria	1438
282	Ga0207661_10268225	3300025944	Bacteria	1522
283	Ga0207679_10007740	3300025945	Bacteria	6827
284	Ga0207679_10154091	3300025945	Unclassified	1874
285	Ga0207679_10155742	3300025945	Unclassified	1865
286	Ga0207679_10169435	3300025945	Bacteria	1796
287	Ga0207679_10243656	3300025945	Bacteria	1524
288	Ga0207679_10384668	3300025945	Unclassified	1231
289	Ga0207667_10120053	3300025949	Bacteria	2709
290	Ga0207651_10004777	3300025960	Bacteria	6889
291	Ga0207651_10019365	3300025960	Bacteria	4076
292	Ga0207651_10019736	3300025960	Bacteria	4048
293	Ga0207651_10074689	3300025960	Unclassified	2415
294	Ga0207651_10105910	3300025960	Bacteria	2099
295	Ga0207640_10018070	3300025981	Bacteria	4137
296	Ga0207658_10016912	3300025986	Bacteria	5020
297	Ga0207658_10032944	3300025986	Bacteria	3693
298	Ga0207658_10117597	3300025986	Bacteria	2113
299	Ga0207658_10402290	3300025986	Bacteria	1204
300	Ga0207677_10079013	3300026023	Bacteria	2351
301	Ga0207703_10018492	3300026035	Bacteria	5441
302	Ga0207703_10073638	3300026035	Bacteria	2826
303	Ga0207703_10084270	3300026035	Bacteria	2658
304	Ga0207703_10125720	3300026035	Bacteria	2207
305	Ga0207703_10138523	3300026035	Bacteria	2110
306	Ga0207703_10356250	3300026035	Bacteria	1348
307	Ga0207708_10005003	3300026075	Bacteria	9766
308	Ga0207708_10033901	3300026075	Bacteria	3882
309	Ga0207708_10098221	3300026075	Bacteria	2263
310	Ga0207708_10104823	3300026075	Bacteria	2191
311	Ga0207708_10162174	3300026075	Unclassified	1766
312	Ga0207702_10267783	3300026078	Bacteria	1611
313	Ga0207648_10000742	3300026089	Bacteria	36617
314	Ga0207648_10001525	3300026089	Bacteria	25514
315	Ga0207676_10049832	3300026095	Bacteria	3261
316	Ga0207676_10071784	3300026095	Bacteria	2781
317	Ga0207676_10412718	3300026095	Bacteria	1264
318	Ga0207674_10011052	3300026116	Bacteria	10153
319	Ga0207674_10035858	3300026116	Bacteria	5174
320	Ga0207674_10165716	3300026116	Bacteria	2164
321	Ga0207675_100001571	3300026118	Bacteria	22840
322	Ga0207675_100043323	3300026118	Bacteria	4203
323	Ga0207675_100043449	3300026118	Bacteria	4196
324	Ga0207675_100193454	3300026118	Bacteria	1952
325	Ga0207683_10032838	3300026121	Bacteria	4509
326	Ga0207683_10079258	3300026121	Bacteria	2912
327	Ga0207683_10150975	3300026121	Bacteria	2096
328	Ga0207683_10208186	3300026121	Bacteria	1779
329	Ga0207683_10388166	3300026121	Bacteria	1284
330	Ga0207698_10049644	3300026142	Bacteria	3195
331	Ga0209588_1001515	3300027671	Bacteria	6125
332	Ga0209974_10076712	3300027876	Bacteria	1145
333	Ga0207428_10017637	3300027907	Bacteria	6121
334	Ga0207428_10039580	3300027907	Bacteria	3828
335	Ga0207428_10094739	3300027907	Bacteria	2314
336	Ga0207428_10180496	3300027907	Bacteria	1595
337	Ga0268266_10183138	3300028379	Bacteria	1908
338	Ga0268265_10002727	3300028380	Bacteria	13061
339	Ga0268265_10053342	3300028380	Bacteria	3063
340	Ga0268264_10048741	3300028381	Bacteria	3523
341	Ga0268264_10053303	3300028381	Bacteria	3374
342	Ga0265762_1002843	3300030760	Bacteria	3095
343	Ga0307408_100071983	3300031548	Unclassified	2558
344	Ga0307408_100074482	3300031548	Bacteria	2519
345	Ga0307408_100403049	3300031548	Bacteria	1175
346	Ga0307405_10011113	3300031731	Bacteria	4700
347	Ga0307413_10287265	3300031824	Bacteria	1240
348	Ga0307409_100218172	3300031995	Unclassified	1720
349	Ga0307416_100050247	3300032002	Bacteria	3323
350	Ga0307416_100193338	3300032002	Bacteria	1922
351	Ga0307416_100213382	3300032002	Unclassified	1843
352	Ga0307416_100263952	3300032002	Unclassified	1685
353	Ga0307416_100333222	3300032002	Bacteria	1526
354	Ga0307416_100614365	3300032002	Bacteria	1168
355	Ga0307414_10471117	3300032004	Unclassified	1106
356	Ga0307411_10012108	3300032005	Bacteria	4688
357	Ga0307411_10055830	3300032005	Unclassified	2600
358	Ga0307411_10082261	3300032005	Bacteria	2220
359	Ga0307415_100419982	3300032126	Bacteria	1147
360	Ga0373959_0029368	3300034820	Bacteria	1102
361	Ga0373937_0038517	3300036401	Bacteria	4356
362	Ga0395899_0037447	3300037312	Bacteria	3636
363	Ga0395900_0005247	3300037418	Bacteria	13593
364	Ga0395898_0093831	3300037466	Bacteria	2884
365	Ga0395905_0139699	3300037471	Bacteria	2279
366	Ga0436364_0160153	3300037853	Bacteria	6292
367	Ga0436364_0882652	3300037853	Bacteria	1243
368	Ga0436364_0940248	3300037853	Bacteria	592364
369	Ga0436364_1021902	3300037853	Bacteria	4526
370	Ga0436364_1171052	3300037853	Bacteria	10517
371	Ga0436365_0040027	3300039437	Bacteria	51300
372	Ga0436365_0348832	3300039437	Unclassified	2578
373	Ga0436365_0531945	3300039437	Bacteria	7655
374	Ga0436365_0795294	3300039437	Bacteria	2864
375	Ga0436365_0957155	3300039437	Bacteria	5283
376	Ga0436365_0987280	3300039437	Unclassified	2176
377	Ga0436361_0844037	3300039447	Bacteria	2761
378	Ga0436362_0850319	3300039453	Bacteria	1519
379	Ga0451853_1594176	3300041512	Bacteria	1239
380	Ga0439435_0004845	3300042436	Unclassified	2924
381	Ga0439435_0013082	3300042436	Bacteria	2023
382	Ga0439435_0051439	3300042436	Unclassified	1180
383	Ga0439464_0000309	3300042439	Bacteria	9288
384	Ga0439464_0016624	3300042439	Unclassified	1991
385	Ga0466963_0020738	3300044694	Bacteria	4136
386	Ga0495603_0107183	3300046455	Bacteria	1631
387	Ga0495629_0005834	3300046459	Bacteria	9187
388	Ga0495594_0091834	3300046499	Bacteria	1702
389	Ga0495643_0003208	3300046522	Bacteria	12133
390	Ga0495663_0074369	3300046525	Bacteria	1086
391	Ga0495621_0099877	3300046539	Bacteria	1103
392	Ga0495621_0107291	3300046539	Unclassified	1068
393	Ga0495658_0115452	3300046683	Bacteria	1618
394	Ga0495669_0050622	3300046684	Bacteria	1863
395	Ga0496101_0027159	3300048904	Bacteria	3984
396	Ga0496104_0274301	3300048907	Bacteria	1599
397	Ga0496108_0112154	3300048911	Bacteria	2333
398	Ga0496108_0166664	3300048911	Bacteria	1905
399	Ga0496112_0058018	3300048915	Bacteria	3812
400	Ga0496112_0133377	3300048915	Bacteria	2454
401	Ga0496112_0353672	3300048915	Bacteria	1411
402	Ga0496113_0024646	3300048916	Bacteria	4279
403	Ga0496114_0334940	3300048917	Bacteria	1338
404	Ga0501032_0212923	3300049569	Bacteria	1259
405	Ga0501036_0161038	3300049572	Bacteria	1892
406	Ga0501038_0175784	3300049574	Bacteria	1730
407	Ga0501047_0006588	3300049581	Bacteria	10931
408	Ga0501067_0062070	3300049583	Bacteria	2069
409	Ga0501069_0093007	3300049585	Bacteria	1706
410	Ga0501070_0030520	3300049586	Bacteria	4517
411	Ga0501072_0049160	3300049588	Bacteria	3320
412	Ga0501072_0229250	3300049588	Bacteria	1480
413	Ga0501073_0217515	3300049589	Unclassified	1320
414	Ga0501074_0064107	3300049590	Bacteria	2646
415	Ga0501074_0293985	3300049590	Bacteria	1154
416	Ga0501075_0018285	3300049591	Bacteria	5071
417	Ga0501075_0201735	3300049591	Bacteria	1517
418	Ga0501076_0047236	3300049592	Bacteria	3403
419	Ga0501076_0134594	3300049592	Bacteria	2006
420	Ga0501076_0344072	3300049592	Bacteria	1224
421	Ga0501077_0037184	3300049593	Bacteria	3102
422	Ga0501079_0080615	3300049741	Bacteria	2517
423	Ga0501080_0039258	3300049742	Bacteria	4419
424	Ga0501081_0044883	3300049743	Bacteria	3035
425	Ga0501081_0179929	3300049743	Bacteria	1529
426	Ga0501283_005988	3300049779	Bacteria	1689
427	Ga0501044_0222956	3300049823	Bacteria	1836
428	Ga0501045_0038725	3300049824	Bacteria	3468
429	nmdc:mga0k408_60603_c1	3300050493	Unclassified	2199
430	nmdc:mga05p37_1037_c1	3300050507	Bacteria	31680
431	nmdc:mga05p37_113799_c1	3300050507	Bacteria	3326
432	nmdc:mga05p37_266942_c1	3300050507	Bacteria	2046
433	nmdc:mga05p37_295432_c1	3300050507	Bacteria	1927
434	nmdc:mga05p37_43183_c1	3300050507	Bacteria	5544
435	nmdc:mga05p37_48376_c1	3300050507	Bacteria	5231
436	nmdc:mga05p37_619_c1	3300050507	Bacteria	39280
437	nmdc:mga05p37_704583_c1	3300050507	Bacteria	1121
438	nmdc:mga09592_308395_c1	3300050508	Bacteria	1372
439	nmdc:mga09592_314770_c1	3300050508	Bacteria	1356
440	nmdc:mga09592_34933_c1	3300050508	Bacteria	4205
441	nmdc:mga09592_479416_c1	3300050508	Bacteria	1072
442	nmdc:mga0qj67_278885_c1	3300050509	Bacteria	1355
443	nmdc:mga0qj67_395595_c1	3300050509	Bacteria	1115
444	nmdc:mga0qj67_49151_c1	3300050509	Bacteria	3334
445	nmdc:mga0qj67_5902_c1	3300050509	Bacteria	8973
446	nmdc:mga06r32_53329_c1	3300050510	Bacteria	3874
447	nmdc:mga06r32_93334_c1	3300050510	Bacteria	2944
448	nmdc:mga08y16_1490_c1	3300050511	Bacteria	23552
449	nmdc:mga08y16_170316_c1	3300050511	Bacteria	2262
450	nmdc:mga08y16_70080_c1	3300050511	Bacteria	3655
451	nmdc:mga08y16_8115_c1	3300050511	Bacteria	10977
452	nmdc:mga08y16_9001_c1	3300050511	Bacteria	10486
453	nmdc:mga0n895_449748_c1	3300050512	Bacteria	1301
454	nmdc:mga0rr50_20442_c1	3300050513	Bacteria	4497
455	nmdc:mga0rr50_331538_c1	3300050513	Bacteria	1277
456	nmdc:mga0a205_9719_c1	3300050515	Bacteria	8810
457	Ga0501084_0124465	3300054114	Bacteria	2169
458	Ga0501084_0217582	3300054114	Bacteria	1612
459	Ga0501084_0455997	3300054114	Unclassified	1081
460	Ga0590071_001127	3300059421	Bacteria	7232
461	Ga0590075_000078	3300059424	Bacteria	24962
462	Ga0590077_009657	3300059426	Bacteria	1983
463	Ga0501082_0070053	3300060353	Bacteria	3020
464	Ga0530510_0191551	3300061734	Bacteria	1518
465	Ga0530510_0402816	3300061734	Bacteria	1031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009093	Ga0105240_10210006	Ga0105240_102100062	283
2	3300025913	Ga0207695_10268101	Ga0207695_102681012	283
3	3300048907	Ga0496104_0274301	Ga0496104_0274301_70_936	288
4	3300049569	Ga0501032_0212923	Ga0501032_0212923_62_928	288
5	3300049823	Ga0501044_0222956	Ga0501044_0222956_36_902	288
6	3300050493	nmdc:mga0k408_60603_c1	nmdc:mga0k408_60603_c1_1045_1914	289
7	3300006844	Ga0075428_100052449	Ga0075428_1000524493	290
8	3300049574	Ga0501038_0175784	Ga0501038_0175784_827_1714	295
9	3300005327	Ga0070658_10007388	Ga0070658_100073883	299
10	3300009093	Ga0105240_10115771	Ga0105240_101157712	299
11	3300009545	Ga0105237_10006912	Ga0105237_1000691211	299
12	3300009551	Ga0105238_10287454	Ga0105238_102874542	299
13	3300010375	Ga0105239_10006869	Ga0105239_100068692	299
14	3300025909	Ga0207705_10011092	Ga0207705_100110928	299
15	3300037312	Ga0395899_0037447	Ga0395899_0037447_2608_3519	302
16	3300037418	Ga0395900_0005247	Ga0395900_0005247_3371_4282	302
17	3300037466	Ga0395898_0093831	Ga0395898_0093831_40_951	302
18	3300037471	Ga0395905_0139699	Ga0395905_0139699_1324_2235	302
19	3300049592	Ga0501076_0047236	Ga0501076_0047236_18_935	304
20	3300050509	nmdc:mga0qj67_278885_c1	nmdc:mga0qj67_278885_c1_48_962	304
21	3300005330	Ga0070690_100049491	Ga0070690_1000494912	305
22	3300005331	Ga0070670_100039177	Ga0070670_1000391773	305
23	3300005335	Ga0070666_10018108	Ga0070666_100181087	305
24	3300005338	Ga0068868_100160787	Ga0068868_1001607872	305
25	3300005341	Ga0070691_10011441	Ga0070691_100114412	305
26	3300005355	Ga0070671_100018222	Ga0070671_1000182228	305
27	3300005440	Ga0070705_100058258	Ga0070705_1000582582	305
28	3300005444	Ga0070694_100055108	Ga0070694_1000551084	305
29	3300005456	Ga0070678_100188827	Ga0070678_1001888272	305
30	3300005459	Ga0068867_100001347	Ga0068867_10000134716	305
31	3300005543	Ga0070672_100043922	Ga0070672_1000439223	305
32	3300005549	Ga0070704_100121798	Ga0070704_1001217982	305
33	3300005578	Ga0068854_100409678	Ga0068854_1004096782	305
34	3300005615	Ga0070702_100037969	Ga0070702_1000379693	305
35	3300005841	Ga0068863_100160833	Ga0068863_1001608333	305
36	3300007076	Ga0075435_100024652	Ga0075435_1000246525	305
37	3300009098	Ga0105245_10029439	Ga0105245_100294393	305
38	3300009176	Ga0105242_10050612	Ga0105242_100506124	305
39	3300009177	Ga0105248_10049888	Ga0105248_100498882	305
40	3300009177	Ga0105248_10343352	Ga0105248_103433522	305
41	3300009551	Ga0105238_10027674	Ga0105238_100276743	305
42	3300009553	Ga0105249_10568616	Ga0105249_105686161	305
43	3300010375	Ga0105239_10121038	Ga0105239_101210383	305
44	3300013297	Ga0157378_10160162	Ga0157378_101601622	305
45	3300021388	Ga0213875_10000002	Ga0213875_10000002551	305
46	3300025893	Ga0207682_10047474	Ga0207682_100474741	305
47	3300025907	Ga0207645_10010811	Ga0207645_100108113	305
48	3300025918	Ga0207662_10007722	Ga0207662_100077223	305
49	3300025924	Ga0207694_10016323	Ga0207694_100163233	305
50	3300025925	Ga0207650_10050652	Ga0207650_100506523	305
51	3300025927	Ga0207687_10208175	Ga0207687_102081752	305
52	3300025931	Ga0207644_10088568	Ga0207644_100885682	305
53	3300025932	Ga0207690_10192805	Ga0207690_101928052	305
54	3300025933	Ga0207706_10180355	Ga0207706_101803552	305
55	3300025938	Ga0207704_10034227	Ga0207704_100342274	305
56	3300025940	Ga0207691_10061413	Ga0207691_100614133	305
57	3300025941	Ga0207711_10030540	Ga0207711_100305403	305
58	3300025960	Ga0207651_10004777	Ga0207651_100047773	305
59	3300025981	Ga0207640_10018070	Ga0207640_100180705	305
60	3300026035	Ga0207703_10125720	Ga0207703_101257202	305
61	3300026075	Ga0207708_10033901	Ga0207708_100339013	305
62	3300026089	Ga0207648_10001525	Ga0207648_1000152523	305
63	3300026095	Ga0207676_10071784	Ga0207676_100717842	305
64	3300026118	Ga0207675_100043323	Ga0207675_1000433233	305
65	3300026121	Ga0207683_10150975	Ga0207683_101509751	305
66	3300034820	Ga0373959_0029368	Ga0373959_0029368_78_998	305
67	3300037853	Ga0436364_0160153	Ga0436364_0160153_4680_5663	305
68	3300037853	Ga0436364_0940248	Ga0436364_0940248_264812_265792	305
69	3300048911	Ga0496108_0166664	Ga0496108_0166664_155_1075	305
70	3300048915	Ga0496112_0353672	Ga0496112_0353672_252_1172	305
71	3300050513	nmdc:mga0rr50_20442_c1	nmdc:mga0rr50_20442_c1_1770_2690	305
72	3300005471	Ga0070698_100229603	Ga0070698_1002296032	306
73	3300005518	Ga0070699_100022096	Ga0070699_1000220963	306
74	3300006028	Ga0070717_10455159	Ga0070717_104551591	306
75	3300006038	Ga0075365_10010439	Ga0075365_100104392	306
76	3300009147	Ga0114129_10010192	Ga0114129_1001019211	306
77	3300014326	Ga0157380_10247158	Ga0157380_102471582	306
78	3300025933	Ga0207706_10326767	Ga0207706_103267671	306
79	3300037853	Ga0436364_0160153	Ga0436364_0160153_3625_4638	306
80	3300037853	Ga0436364_1171052	Ga0436364_1171052_5384_6457	306
81	3300039447	Ga0436361_0844037	Ga0436361_0844037_1643_2650	306
82	3300049583	Ga0501067_0062070	Ga0501067_0062070_687_1610	306
83	3300049585	Ga0501069_0093007	Ga0501069_0093007_112_1035	306
84	3300050507	nmdc:mga05p37_295432_c1	nmdc:mga05p37_295432_c1_830_1753	306
85	3300005330	Ga0070690_100011669	Ga0070690_1000116692	307
86	3300005334	Ga0068869_100084110	Ga0068869_1000841102	307
87	3300005343	Ga0070687_100089436	Ga0070687_1000894363	307
88	3300005354	Ga0070675_100011746	Ga0070675_1000117465	307
89	3300005354	Ga0070675_100013837	Ga0070675_1000138376	307
90	3300005455	Ga0070663_100023416	Ga0070663_1000234163	307
91	3300005459	Ga0068867_100059461	Ga0068867_1000594614	307
92	3300005543	Ga0070672_100097866	Ga0070672_1000978662	307
93	3300005840	Ga0068870_10005865	Ga0068870_100058655	307
94	3300006881	Ga0068865_100025254	Ga0068865_1000252542	307
95	3300006881	Ga0068865_100218999	Ga0068865_1002189992	307
96	3300009094	Ga0111539_10156775	Ga0111539_101567753	307
97	3300009177	Ga0105248_10314897	Ga0105248_103148972	307
98	3300014326	Ga0157380_10099645	Ga0157380_100996453	307
99	3300014745	Ga0157377_10061783	Ga0157377_100617833	307
100	3300025907	Ga0207645_10003643	Ga0207645_1000364313	307
101	3300025908	Ga0207643_10031170	Ga0207643_100311704	307
102	3300025926	Ga0207659_10016458	Ga0207659_100164583	307
103	3300025937	Ga0207669_10097561	Ga0207669_100975612	307
104	3300025938	Ga0207704_10134516	Ga0207704_101345162	307
105	3300025938	Ga0207704_10185744	Ga0207704_101857442	307
106	3300025940	Ga0207691_10012932	Ga0207691_100129328	307
107	3300025940	Ga0207691_10042749	Ga0207691_100427492	307
108	3300025942	Ga0207689_10000753	Ga0207689_1000075311	307
109	3300025942	Ga0207689_10259232	Ga0207689_102592321	307
110	3300025960	Ga0207651_10074689	Ga0207651_100746894	307
111	3300026075	Ga0207708_10098221	Ga0207708_100982212	307
112	3300026075	Ga0207708_10162174	Ga0207708_101621743	307
113	3300026089	Ga0207648_10000742	Ga0207648_1000074222	307
114	3300026121	Ga0207683_10032838	Ga0207683_100328384	307
115	3300028381	Ga0268264_10048741	Ga0268264_100487413	307
116	3300032002	Ga0307416_100614365	Ga0307416_1006143652	307
117	3300032005	Ga0307411_10082261	Ga0307411_100822612	307
118	3300054114	Ga0501084_0217582	Ga0501084_0217582_507_1430	307
119	3300005329	Ga0070683_100386283	Ga0070683_1003862831	308
120	3300027907	Ga0207428_10039580	Ga0207428_100395805	308
121	3300030760	Ga0265762_1002843	Ga0265762_10028431	308
122	3300032002	Ga0307416_100333222	Ga0307416_1003332222	308
123	3300050511	nmdc:mga08y16_9001_c1	nmdc:mga08y16_9001_c1_79_1005	308
124	3300003320	rootH2_10035442	rootH2_100354427	309
125	3300005356	Ga0070674_100005509	Ga0070674_1000055095	309
126	3300005364	Ga0070673_100149337	Ga0070673_1001493372	309
127	3300005367	Ga0070667_100007503	Ga0070667_1000075038	309
128	3300005543	Ga0070672_100033139	Ga0070672_1000331392	309
129	3300005615	Ga0070702_100072808	Ga0070702_1000728082	309
130	3300005843	Ga0068860_100027550	Ga0068860_1000275503	309
131	3300009147	Ga0114129_10120641	Ga0114129_101206414	309
132	3300009177	Ga0105248_10021065	Ga0105248_100210655	309
133	3300009177	Ga0105248_10057673	Ga0105248_100576733	309
134	3300014968	Ga0157379_10049782	Ga0157379_100497822	309
135	3300021388	Ga0213875_10000002	Ga0213875_10000002552	309
136	3300025931	Ga0207644_10007379	Ga0207644_100073795	309
137	3300025937	Ga0207669_10061328	Ga0207669_100613282	309
138	3300025940	Ga0207691_10023670	Ga0207691_100236705	309
139	3300026035	Ga0207703_10084270	Ga0207703_100842702	309
140	3300026121	Ga0207683_10079258	Ga0207683_100792581	309
141	3300031548	Ga0307408_100071983	Ga0307408_1000719832	309
142	3300031548	Ga0307408_100403049	Ga0307408_1004030491	309
143	3300037853	Ga0436364_0882652	Ga0436364_0882652_138_1091	309
144	3300037853	Ga0436364_0940248	Ga0436364_0940248_263770_264723	309
145	3300049588	Ga0501072_0229250	Ga0501072_0229250_477_1406	309
146	3300049591	Ga0501075_0201735	Ga0501075_0201735_141_1070	309
147	3300049592	Ga0501076_0344072	Ga0501076_0344072_168_1097	309
148	3300050507	nmdc:mga05p37_113799_c1	nmdc:mga05p37_113799_c1_929_1885	309
149	3300050509	nmdc:mga0qj67_395595_c1	nmdc:mga0qj67_395595_c1_13_942	309
150	3300059426	Ga0590077_009657	Ga0590077_009657_917_1846	309
151	3300061734	Ga0530510_0191551	Ga0530510_0191551_25_954	309
152	3300005327	Ga0070658_10023277	Ga0070658_100232774	310
153	3300005365	Ga0070688_100045224	Ga0070688_1000452242	310
154	3300009147	Ga0114129_10042529	Ga0114129_100425295	310
155	3300013100	Ga0157373_10045659	Ga0157373_100456594	310
156	3300013105	Ga0157369_10015669	Ga0157369_1001566913	310
157	3300027876	Ga0209974_10076712	Ga0209974_100767122	310
158	3300032002	Ga0307416_100050247	Ga0307416_1000502472	310
159	3300042436	Ga0439435_0004845	Ga0439435_0004845_1106_2038	310
160	3300042439	Ga0439464_0016624	Ga0439464_0016624_691_1623	310
161	3300049581	Ga0501047_0006588	Ga0501047_0006588_7840_8772	310
162	3300049586	Ga0501070_0030520	Ga0501070_0030520_439_1371	310
163	3300049588	Ga0501072_0049160	Ga0501072_0049160_534_1466	310
164	3300049590	Ga0501074_0064107	Ga0501074_0064107_1141_2073	310
165	3300049591	Ga0501075_0018285	Ga0501075_0018285_243_1175	310
166	3300049592	Ga0501076_0134594	Ga0501076_0134594_517_1449	310
167	3300049593	Ga0501077_0037184	Ga0501077_0037184_1035_1967	310
168	3300049741	Ga0501079_0080615	Ga0501079_0080615_1168_2100	310
169	3300049742	Ga0501080_0039258	Ga0501080_0039258_2024_2956	310
170	3300049743	Ga0501081_0179929	Ga0501081_0179929_265_1197	310
171	3300050507	nmdc:mga05p37_1037_c1	nmdc:mga05p37_1037_c1_29686_30618	310
172	3300050507	nmdc:mga05p37_704583_c1	nmdc:mga05p37_704583_c1_177_1109	310
173	3300059421	Ga0590071_001127	Ga0590071_001127_2618_3550	310
174	3300059424	Ga0590075_000078	Ga0590075_000078_18498_19430	310
175	3300060353	Ga0501082_0070053	Ga0501082_0070053_1487_2419	310
176	3300006844	Ga0075428_100010488	Ga0075428_1000104886	311
177	3300006846	Ga0075430_100041931	Ga0075430_1000419312	311
178	3300006847	Ga0075431_100022919	Ga0075431_1000229197	311
179	3300006852	Ga0075433_10017805	Ga0075433_100178053	311
180	3300006880	Ga0075429_100016632	Ga0075429_1000166322	311
181	3300006881	Ga0068865_100229095	Ga0068865_1002290952	311
182	3300009093	Ga0105240_10000026	Ga0105240_1000002652	311
183	3300009094	Ga0111539_10214295	Ga0111539_102142951	311
184	3300009147	Ga0114129_10090269	Ga0114129_100902692	311
185	3300025913	Ga0207695_10000246	Ga0207695_1000024681	311
186	3300025938	Ga0207704_10152492	Ga0207704_101524921	311
187	3300025941	Ga0207711_10446266	Ga0207711_104462662	311
188	3300031731	Ga0307405_10011113	Ga0307405_100111134	311
189	3300031824	Ga0307413_10287265	Ga0307413_102872652	311
190	3300032002	Ga0307416_100213382	Ga0307416_1002133822	311
191	3300032004	Ga0307414_10471117	Ga0307414_104711171	311
192	3300032005	Ga0307411_10012108	Ga0307411_100121083	311
193	3300032126	Ga0307415_100419982	Ga0307415_1004199822	311
194	3300042436	Ga0439435_0013082	Ga0439435_0013082_212_1147	311
195	3300048917	Ga0496114_0334940	Ga0496114_0334940_314_1249	311
196	3300049589	Ga0501073_0217515	Ga0501073_0217515_314_1249	311
197	3300049779	Ga0501283_005988	Ga0501283_005988_497_1432	311
198	3300050507	nmdc:mga05p37_266942_c1	nmdc:mga05p37_266942_c1_612_1547	311
199	3300050507	nmdc:mga05p37_48376_c1	nmdc:mga05p37_48376_c1_3019_3954	311
200	3300050508	nmdc:mga09592_479416_c1	nmdc:mga09592_479416_c1_108_1043	311
201	3300050511	nmdc:mga08y16_170316_c1	nmdc:mga08y16_170316_c1_1134_2069	311
202	3300050515	nmdc:mga0a205_9719_c1	nmdc:mga0a205_9719_c1_5269_6204	311
203	3300005290	Ga0065712_10145431	Ga0065712_101454312	312
204	3300005293	Ga0065715_10129256	Ga0065715_101292563	312
205	3300005445	Ga0070708_100087411	Ga0070708_1000874112	312
206	3300005467	Ga0070706_100131174	Ga0070706_1001311742	312
207	3300005468	Ga0070707_100312830	Ga0070707_1003128301	312
208	3300005543	Ga0070672_100302982	Ga0070672_1003029822	312
209	3300005564	Ga0070664_100019213	Ga0070664_1000192133	312
210	3300005617	Ga0068859_100032023	Ga0068859_1000320236	312
211	3300006846	Ga0075430_100002125	Ga0075430_1000021259	312
212	3300006847	Ga0075431_100021393	Ga0075431_1000213933	312
213	3300006871	Ga0075434_100394117	Ga0075434_1003941171	312
214	3300006880	Ga0075429_100132714	Ga0075429_1001327143	312
215	3300006881	Ga0068865_100095493	Ga0068865_1000954933	312
216	3300006931	Ga0097620_100032021	Ga0097620_1000320216	312
217	3300009094	Ga0111539_10000039	Ga0111539_1000003991	312
218	3300009094	Ga0111539_10006742	Ga0111539_100067424	312
219	3300009147	Ga0114129_10001227	Ga0114129_1000122721	312
220	3300013296	Ga0157374_10084525	Ga0157374_100845251	312
221	3300014326	Ga0157380_10240617	Ga0157380_102406172	312
222	3300014969	Ga0157376_10227544	Ga0157376_102275442	312
223	3300021388	Ga0213875_10008931	Ga0213875_100089314	312
224	3300025901	Ga0207688_10106547	Ga0207688_101065472	312
225	3300025922	Ga0207646_10084812	Ga0207646_100848122	312
226	3300025935	Ga0207709_10171866	Ga0207709_101718662	312
227	3300025938	Ga0207704_10166674	Ga0207704_101666742	312
228	3300025945	Ga0207679_10243656	Ga0207679_102436561	312
229	3300026116	Ga0207674_10165716	Ga0207674_101657162	312
230	3300026121	Ga0207683_10208186	Ga0207683_102081862	312
231	3300027907	Ga0207428_10017637	Ga0207428_100176372	312
232	3300027907	Ga0207428_10180496	Ga0207428_101804962	312
233	3300031548	Ga0307408_100074482	Ga0307408_1000744822	312
234	3300031995	Ga0307409_100218172	Ga0307409_1002181722	312
235	3300032002	Ga0307416_100263952	Ga0307416_1002639522	312
236	3300032005	Ga0307411_10055830	Ga0307411_100558301	312
237	3300037853	Ga0436364_1021902	Ga0436364_1021902_2035_3051	312
238	3300042439	Ga0439464_0000309	Ga0439464_0000309_3939_4877	312
239	3300046683	Ga0495658_0115452	Ga0495658_0115452_215_1153	312
240	3300050507	nmdc:mga05p37_619_c1	nmdc:mga05p37_619_c1_24021_24959	312
241	3300050508	nmdc:mga09592_34933_c1	nmdc:mga09592_34933_c1_57_995	312
242	3300050509	nmdc:mga0qj67_49151_c1	nmdc:mga0qj67_49151_c1_1328_2266	312
243	3300050510	nmdc:mga06r32_53329_c1	nmdc:mga06r32_53329_c1_328_1266	312
244	3300050511	nmdc:mga08y16_1490_c1	nmdc:mga08y16_1490_c1_17108_18046	312
245	3300050512	nmdc:mga0n895_449748_c1	nmdc:mga0n895_449748_c1_23_961	312
246	3300050513	nmdc:mga0rr50_331538_c1	nmdc:mga0rr50_331538_c1_329_1267	312
247	3300005334	Ga0068869_100018124	Ga0068869_1000181244	313
248	3300005353	Ga0070669_100289356	Ga0070669_1002893562	313
249	3300005364	Ga0070673_100010959	Ga0070673_1000109596	313
250	3300005364	Ga0070673_100211002	Ga0070673_1002110023	313
251	3300005441	Ga0070700_100020487	Ga0070700_1000204873	313
252	3300005456	Ga0070678_100085964	Ga0070678_1000859642	313
253	3300005457	Ga0070662_100164590	Ga0070662_1001645903	313
254	3300005459	Ga0068867_100070348	Ga0068867_1000703483	313
255	3300005543	Ga0070672_100007921	Ga0070672_1000079219	313
256	3300005548	Ga0070665_100004782	Ga0070665_1000047824	313
257	3300005564	Ga0070664_100012949	Ga0070664_1000129495	313
258	3300005618	Ga0068864_100040638	Ga0068864_1000406385	313
259	3300005618	Ga0068864_100065783	Ga0068864_1000657832	313
260	3300005718	Ga0068866_10190996	Ga0068866_101909962	313
261	3300005719	Ga0068861_100046848	Ga0068861_1000468483	313
262	3300005840	Ga0068870_10016665	Ga0068870_100166652	313
263	3300005842	Ga0068858_100008226	Ga0068858_1000082268	313
264	3300005842	Ga0068858_100108059	Ga0068858_1001080594	313
265	3300005843	Ga0068860_100063228	Ga0068860_1000632283	313
266	3300005844	Ga0068862_100008545	Ga0068862_1000085458	313
267	3300006237	Ga0097621_100003906	Ga0097621_1000039065	313
268	3300006237	Ga0097621_100025624	Ga0097621_1000256243	313
269	3300006358	Ga0068871_100001563	Ga0068871_1000015634	313
270	3300006358	Ga0068871_100197869	Ga0068871_1001978692	313
271	3300006846	Ga0075430_100232295	Ga0075430_1002322952	313
272	3300006881	Ga0068865_100013837	Ga0068865_1000138376	313
273	3300006881	Ga0068865_100098587	Ga0068865_1000985872	313
274	3300009094	Ga0111539_10037620	Ga0111539_100376205	313
275	3300009094	Ga0111539_10416667	Ga0111539_104166672	313
276	3300009148	Ga0105243_10639580	Ga0105243_106395801	313
277	3300009176	Ga0105242_10072658	Ga0105242_100726582	313
278	3300009177	Ga0105248_10378581	Ga0105248_103785812	313
279	3300009177	Ga0105248_10757093	Ga0105248_107570931	313
280	3300013297	Ga0157378_10642629	Ga0157378_106426291	313
281	3300013306	Ga0163162_10554018	Ga0163162_105540181	313
282	3300025903	Ga0207680_10048632	Ga0207680_100486323	313
283	3300025923	Ga0207681_10005876	Ga0207681_100058763	313
284	3300025925	Ga0207650_10049004	Ga0207650_100490042	313
285	3300025927	Ga0207687_10083655	Ga0207687_100836553	313
286	3300025934	Ga0207686_10011615	Ga0207686_100116154	313
287	3300025935	Ga0207709_10234569	Ga0207709_102345692	313
288	3300025940	Ga0207691_10188172	Ga0207691_101881722	313
289	3300025941	Ga0207711_10010874	Ga0207711_100108744	313
290	3300025941	Ga0207711_10036787	Ga0207711_100367874	313
291	3300025942	Ga0207689_10137582	Ga0207689_101375822	313
292	3300025945	Ga0207679_10007740	Ga0207679_100077405	313
293	3300025960	Ga0207651_10019365	Ga0207651_100193653	313
294	3300025960	Ga0207651_10105910	Ga0207651_101059102	313
295	3300025986	Ga0207658_10117597	Ga0207658_101175973	313
296	3300026023	Ga0207677_10079013	Ga0207677_100790131	313
297	3300026035	Ga0207703_10073638	Ga0207703_100736383	313
298	3300026035	Ga0207703_10356250	Ga0207703_103562501	313
299	3300026095	Ga0207676_10049832	Ga0207676_100498322	313
300	3300026095	Ga0207676_10412718	Ga0207676_104127182	313
301	3300026118	Ga0207675_100193454	Ga0207675_1001934542	313
302	3300026121	Ga0207683_10388166	Ga0207683_103881662	313
303	3300028379	Ga0268266_10183138	Ga0268266_101831382	313
304	3300028380	Ga0268265_10002727	Ga0268265_1000272710	313
305	3300028380	Ga0268265_10053342	Ga0268265_100533424	313
306	3300028381	Ga0268264_10053303	Ga0268264_100533033	313
307	3300032002	Ga0307416_100193338	Ga0307416_1001933382	313
308	3300039437	Ga0436365_0795294	Ga0436365_0795294_138_1220	313
309	3300042436	Ga0439435_0051439	Ga0439435_0051439_121_1062	313
310	3300046455	Ga0495603_0107183	Ga0495603_0107183_91_1032	313
311	3300049572	Ga0501036_0161038	Ga0501036_0161038_123_1064	313
312	3300049590	Ga0501074_0293985	Ga0501074_0293985_32_973	313
313	3300049743	Ga0501081_0044883	Ga0501081_0044883_1390_2331	313
314	3300049824	Ga0501045_0038725	Ga0501045_0038725_2237_3178	313
315	3300050507	nmdc:mga05p37_43183_c1	nmdc:mga05p37_43183_c1_3210_4151	313
316	3300050511	nmdc:mga08y16_70080_c1	nmdc:mga08y16_70080_c1_1475_2416	313
317	3300054114	Ga0501084_0124465	Ga0501084_0124465_1198_2139	313
318	3300054114	Ga0501084_0455997	Ga0501084_0455997_120_1061	313
319	3300061734	Ga0530510_0402816	Ga0530510_0402816_72_1013	313
320	3300005328	Ga0070676_10295135	Ga0070676_102951351	314
321	3300005341	Ga0070691_10086637	Ga0070691_100866372	314
322	3300005343	Ga0070687_100214748	Ga0070687_1002147482	314
323	3300005353	Ga0070669_100138839	Ga0070669_1001388392	314
324	3300005356	Ga0070674_100338198	Ga0070674_1003381981	314
325	3300005436	Ga0070713_100027306	Ga0070713_1000273064	314
326	3300005438	Ga0070701_10006177	Ga0070701_100061774	314
327	3300005440	Ga0070705_100162675	Ga0070705_1001626751	314
328	3300005441	Ga0070700_100002436	Ga0070700_1000024362	314
329	3300005444	Ga0070694_100128202	Ga0070694_1001282022	314
330	3300005545	Ga0070695_100002660	Ga0070695_1000026606	314
331	3300005549	Ga0070704_100001425	Ga0070704_1000014252	314
332	3300005615	Ga0070702_100027779	Ga0070702_1000277792	314
333	3300005616	Ga0068852_100055572	Ga0068852_1000555722	314
334	3300005719	Ga0068861_100001061	Ga0068861_1000010619	314
335	3300005843	Ga0068860_100532000	Ga0068860_1005320001	314
336	3300006028	Ga0070717_10254500	Ga0070717_102545001	314
337	3300009094	Ga0111539_10011565	Ga0111539_1001156512	314
338	3300009148	Ga0105243_10011396	Ga0105243_100113962	314
339	3300009177	Ga0105248_10308719	Ga0105248_103087192	314
340	3300009553	Ga0105249_10197634	Ga0105249_101976342	314
341	3300025893	Ga0207682_10024903	Ga0207682_100249032	314
342	3300025907	Ga0207645_10007945	Ga0207645_100079457	314
343	3300025928	Ga0207700_10036097	Ga0207700_100360975	314
344	3300025935	Ga0207709_10042934	Ga0207709_100429342	314
345	3300025941	Ga0207711_10258245	Ga0207711_102582452	314
346	3300025942	Ga0207689_10085652	Ga0207689_100856522	314
347	3300026075	Ga0207708_10005003	Ga0207708_1000500310	314
348	3300026075	Ga0207708_10104823	Ga0207708_101048232	314
349	3300026118	Ga0207675_100001571	Ga0207675_10000157119	314
350	3300026118	Ga0207675_100043449	Ga0207675_1000434492	314
351	3300026142	Ga0207698_10049644	Ga0207698_100496444	314
352	3300027907	Ga0207428_10094739	Ga0207428_100947392	314
353	3300046522	Ga0495643_0003208	Ga0495643_0003208_3429_4373	314
354	3300050508	nmdc:mga09592_314770_c1	nmdc:mga09592_314770_c1_287_1339	314
355	3300050511	nmdc:mga08y16_8115_c1	nmdc:mga08y16_8115_c1_9314_10258	314
356	3300005354	Ga0070675_100109717	Ga0070675_1001097173	315
357	3300005366	Ga0070659_100194511	Ga0070659_1001945112	315
358	3300005457	Ga0070662_100074729	Ga0070662_1000747291	315
359	3300005842	Ga0068858_100466974	Ga0068858_1004669741	315
360	3300005985	Ga0081539_10077709	Ga0081539_100777092	315
361	3300006846	Ga0075430_100022269	Ga0075430_1000222695	315
362	3300006847	Ga0075431_100043085	Ga0075431_1000430854	315
363	3300006880	Ga0075429_100135313	Ga0075429_1001353131	315
364	3300007265	Ga0099794_10003689	Ga0099794_100036894	315
365	3300009147	Ga0114129_10013348	Ga0114129_100133485	315
366	3300009551	Ga0105238_10000174	Ga0105238_100001747	315
367	3300013296	Ga0157374_10203860	Ga0157374_102038603	315
368	3300021384	Ga0213876_10003354	Ga0213876_100033544	315
369	3300021384	Ga0213876_10004644	Ga0213876_100046447	315
370	3300025924	Ga0207694_10001106	Ga0207694_1000110623	315
371	3300025931	Ga0207644_10100892	Ga0207644_101008922	315
372	3300025932	Ga0207690_10107701	Ga0207690_101077012	315
373	3300025945	Ga0207679_10155742	Ga0207679_101557422	315
374	3300025986	Ga0207658_10402290	Ga0207658_104022901	315
375	3300027671	Ga0209588_1001515	Ga0209588_10015154	315
376	3300039437	Ga0436365_0040027	Ga0436365_0040027_29503_30516	315
377	3300039437	Ga0436365_0348832	Ga0436365_0348832_652_1746	315
378	3300039437	Ga0436365_0531945	Ga0436365_0531945_6326_7495	315
379	3300039437	Ga0436365_0957155	Ga0436365_0957155_3370_4428	315
380	3300039437	Ga0436365_0987280	Ga0436365_0987280_266_1318	315
381	3300039453	Ga0436362_0850319	Ga0436362_0850319_212_1381	315
382	3300041512	Ga0451853_1594176	Ga0451853_1594176_269_1222	315
383	3300044694	Ga0466963_0020738	Ga0466963_0020738_221_1378	315
384	3300046459	Ga0495629_0005834	Ga0495629_0005834_6252_7229	315
385	3300046499	Ga0495594_0091834	Ga0495594_0091834_69_1046	315
386	3300048904	Ga0496101_0027159	Ga0496101_0027159_2584_3531	315
387	3300050509	nmdc:mga0qj67_5902_c1	nmdc:mga0qj67_5902_c1_1375_2340	315
388	3300050510	nmdc:mga06r32_93334_c1	nmdc:mga06r32_93334_c1_1926_2891	315
389	3300001990	JGI24737J22298_10070031	JGI24737J22298_100700311	316
390	3300005293	Ga0065715_10242921	Ga0065715_102429211	316
391	3300005327	Ga0070658_10174175	Ga0070658_101741751	316
392	3300005329	Ga0070683_100044527	Ga0070683_1000445275	316
393	3300005329	Ga0070683_100059228	Ga0070683_1000592281	316
394	3300005329	Ga0070683_100277711	Ga0070683_1002777112	316
395	3300005331	Ga0070670_100080973	Ga0070670_1000809731	316
396	3300005333	Ga0070677_10024858	Ga0070677_100248581	316
397	3300005340	Ga0070689_100016863	Ga0070689_1000168632	316
398	3300005345	Ga0070692_10131458	Ga0070692_101314582	316
399	3300005347	Ga0070668_100020536	Ga0070668_1000205361	316
400	3300005353	Ga0070669_100009405	Ga0070669_1000094052	316
401	3300005354	Ga0070675_100003129	Ga0070675_1000031292	316
402	3300005356	Ga0070674_100070243	Ga0070674_1000702433	316
403	3300005356	Ga0070674_100162438	Ga0070674_1001624381	316
404	3300005364	Ga0070673_100044776	Ga0070673_1000447763	316
405	3300005365	Ga0070688_100011421	Ga0070688_1000114214	316
406	3300005367	Ga0070667_100035657	Ga0070667_1000356572	316
407	3300005435	Ga0070714_100094283	Ga0070714_1000942832	316
408	3300005466	Ga0070685_10026855	Ga0070685_100268552	316
409	3300005530	Ga0070679_100513053	Ga0070679_1005130531	316
410	3300005535	Ga0070684_100000714	Ga0070684_10000071415	316
411	3300005535	Ga0070684_100141616	Ga0070684_1001416163	316
412	3300005543	Ga0070672_100066177	Ga0070672_1000661772	316
413	3300005543	Ga0070672_100314227	Ga0070672_1003142272	316
414	3300005564	Ga0070664_100003237	Ga0070664_10000323714	316
415	3300005564	Ga0070664_100018558	Ga0070664_1000185586	316
416	3300005564	Ga0070664_100140295	Ga0070664_1001402952	316
417	3300005577	Ga0068857_100003244	Ga0068857_10000324412	316
418	3300005616	Ga0068852_100009281	Ga0068852_1000092813	316
419	3300005616	Ga0068852_100247153	Ga0068852_1002471533	316
420	3300005840	Ga0068870_10008887	Ga0068870_100088875	316
421	3300005842	Ga0068858_100071714	Ga0068858_1000717142	316
422	3300005842	Ga0068858_100136140	Ga0068858_1001361402	316
423	3300006846	Ga0075430_100151423	Ga0075430_1001514231	316
424	3300006880	Ga0075429_100328057	Ga0075429_1003280572	316
425	3300006881	Ga0068865_100191546	Ga0068865_1001915462	316
426	3300009148	Ga0105243_10027426	Ga0105243_100274262	316
427	3300009174	Ga0105241_10512494	Ga0105241_105124941	316
428	3300009176	Ga0105242_10028899	Ga0105242_100288993	316
429	3300013105	Ga0157369_10232907	Ga0157369_102329072	316
430	3300013308	Ga0157375_10015236	Ga0157375_100152369	316
431	3300014325	Ga0163163_10154251	Ga0163163_101542513	316
432	3300014969	Ga0157376_10148310	Ga0157376_101483102	316
433	3300015262	Ga0182007_10071651	Ga0182007_100716511	316
434	3300025315	Ga0207697_10012128	Ga0207697_100121281	316
435	3300025893	Ga0207682_10003611	Ga0207682_100036112	316
436	3300025908	Ga0207643_10016482	Ga0207643_100164822	316
437	3300025909	Ga0207705_10023385	Ga0207705_100233853	316
438	3300025919	Ga0207657_10083455	Ga0207657_100834552	316
439	3300025923	Ga0207681_10016520	Ga0207681_100165204	316
440	3300025925	Ga0207650_10214398	Ga0207650_102143982	316
441	3300025926	Ga0207659_10003883	Ga0207659_100038839	316
442	3300025933	Ga0207706_10069323	Ga0207706_100693232	316
443	3300025936	Ga0207670_10055604	Ga0207670_100556043	316
444	3300025938	Ga0207704_10010975	Ga0207704_100109755	316
445	3300025941	Ga0207711_10146520	Ga0207711_101465202	316
446	3300025944	Ga0207661_10268225	Ga0207661_102682252	316
447	3300025945	Ga0207679_10154091	Ga0207679_101540912	316
448	3300025945	Ga0207679_10169435	Ga0207679_101694352	316
449	3300025945	Ga0207679_10384668	Ga0207679_103846682	316
450	3300025949	Ga0207667_10120053	Ga0207667_101200533	316
451	3300025960	Ga0207651_10019736	Ga0207651_100197363	316
452	3300025986	Ga0207658_10016912	Ga0207658_100169122	316
453	3300025986	Ga0207658_10032944	Ga0207658_100329444	316
454	3300026035	Ga0207703_10018492	Ga0207703_100184926	316
455	3300026035	Ga0207703_10138523	Ga0207703_101385231	316
456	3300026078	Ga0207702_10267783	Ga0207702_102677831	316
457	3300026116	Ga0207674_10011052	Ga0207674_1001105210	316
458	3300026116	Ga0207674_10035858	Ga0207674_100358583	316
459	3300036401	Ga0373937_0038517	Ga0373937_0038517_1649_2599	316
460	3300046525	Ga0495663_0074369	Ga0495663_0074369_56_1006	316
461	3300046539	Ga0495621_0099877	Ga0495621_0099877_92_1042	316
462	3300046539	Ga0495621_0107291	Ga0495621_0107291_89_1039	316
463	3300046684	Ga0495669_0050622	Ga0495669_0050622_141_1091	316
464	3300048911	Ga0496108_0112154	Ga0496108_0112154_857_1807	316
465	3300048915	Ga0496112_0058018	Ga0496112_0058018_98_1048	316
466	3300048915	Ga0496112_0133377	Ga0496112_0133377_426_1376	316
467	3300048916	Ga0496113_0024646	Ga0496113_0024646_3129_4079	316
468	3300050508	nmdc:mga09592_308395_c1	nmdc:mga09592_308395_c1_299_1249	316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

97

299

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4exa-assembly2.cif.gz_C	crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa	0.8621	10	263
7svq-assembly2.cif.gz_B	crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with nad+	0.8476	11	286
4exa-assembly1.cif.gz_A	crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa	0.8433	10	263
7ezl-assembly1.cif.gz_A	rice l-galactose dehydrogenase (holo form)	0.8426	11	286
4exb-assembly2.cif.gz_C	putative aldo-keto reductase from pseudomona aeruginosa	0.837	10	263

ID	Description	Score	Start	End	Superfamily
af_A0A1D6KXU0_49_191_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9041	14	122	3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8959	12	120	3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8666	13	92	3.20.20.100
af_Q9VGF2_1_211_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8628	13	184	3.20.20.100
af_Q2QQV2_1_312_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8436	14	286	3.20.20.100

ID	Description	Score	Start	End	GO Terms
AF-A0A330L866-F1-model_v4	Putative NADPH-dependent oxidoreductase (EC 1.-.-.-)	0.9918	11	308	GO:0016491
AF-A0A2V7I2G6-F1-model_v4	Aldo/keto reductase	0.9874	5	314
AF-A0A2V8HTJ6-F1-model_v4	Aldo/keto reductase	0.9865	11	251
AF-A0A7W0MH67-F1-model_v4	Aldo/keto reductase	0.9863	37	314
AF-A0A838GAI0-F1-model_v4	Aldo/keto reductase	0.9785	11	154

Feature Viewer

pLDDT	pTM	Quality
93.67	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450041

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00248

Aldo_ket_red

Aldo/keto reductase family

97

299

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map