F450049

General Info

Members Datasets Scaffolds Average Seq Length
468 215 466 221

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10163906|Ga0207712_101639062
Length 238
Sequence MSHFFSTFSPRQINQYKKSMDKKAILLKLIPEQGILPLYFNKDAEVSVNILHALYKAGIRTVEYTNRGEAALKNFAKLREVCDKELNGMYLGIGTIKDAASAQAFIDTGADYIISPGLVEEVIPVADKYSMLWVPGCMTPSEIIRAEQLGARVVKLFPGNILGPGFLSAIKELFPNLLFMPTGGVDLNKENIGGWFKAGVCAVGMGSKLISKDVMEGKKYGELTASVKEALEIVKACR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
3 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
181 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
191 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
192 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
197 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
198 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
199 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
204 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
205 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 0.21
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3780475 2162886011 Unclassified 931
2 JGI24736J21556_1019579 3300001904 Bacteria 1068
3 JGI24737J22298_10011833 3300001990 Bacteria 2851
4 JGI24735J21928_10007897 3300002067 Bacteria 3457
5 JGI25157J39369_1004030 3300002741 Bacteria 2786
6 Ga0070658_10000526 3300005327 Bacteria 33186
7 Ga0070658_10014347 3300005327 Bacteria 6357
8 Ga0070658_10042145 3300005327 Bacteria 3685
9 Ga0070658_10043193 3300005327 Bacteria 3642
10 Ga0070658_10091061 3300005327 Bacteria 2513
11 Ga0070658_10518653 3300005327 Bacteria 1030
12 Ga0070676_10006484 3300005328 Bacteria 6252
13 Ga0070683_100069964 3300005329 Bacteria 3273
14 Ga0070670_100283568 3300005331 Bacteria 1446
15 Ga0070670_100315067 3300005331 Bacteria 1370
16 Ga0070670_100333271 3300005331 Bacteria 1331
17 Ga0068869_100250427 3300005334 Bacteria 1414
18 Ga0070666_10008837 3300005335 Bacteria 6263
19 Ga0070680_100000878 3300005336 Bacteria 21341
20 Ga0070680_100008990 3300005336 Bacteria 7658
21 Ga0070680_100034304 3300005336 Bacteria 4091
22 Ga0070680_100124127 3300005336 Bacteria 2157
23 Ga0070680_100134324 3300005336 Bacteria 2071
24 Ga0070682_100001122 3300005337 Bacteria 15300
25 Ga0070682_100044193 3300005337 Bacteria 2758
26 Ga0070682_100156096 3300005337 Bacteria 1571
27 Ga0070682_100332262 3300005337 Bacteria 1127
28 Ga0068868_100000064 3300005338 Bacteria 61762
29 Ga0070660_100015982 3300005339 Bacteria 5436
30 Ga0070660_100057292 3300005339 Bacteria 3018
31 Ga0070660_100064832 3300005339 Bacteria 2843
32 Ga0070660_100136520 3300005339 Unclassified 1965
33 Ga0070660_100292430 3300005339 Unclassified 1334
34 Ga0070660_100400752 3300005339 Bacteria 1134
35 Ga0070661_100240776 3300005344 Bacteria 1393
36 Ga0070692_10494655 3300005345 Unclassified 791
37 Ga0070668_100005340 3300005347 Bacteria 9541
38 Ga0070668_100048296 3300005347 Bacteria 3273
39 Ga0070669_100352363 3300005353 Bacteria 1195
40 Ga0070675_100027384 3300005354 Bacteria 4579
41 Ga0070671_100326223 3300005355 Bacteria 1308
42 Ga0070674_100393009 3300005356 Unclassified 1131
43 Ga0070673_100000225 3300005364 Bacteria 28328
44 Ga0070673_100426737 3300005364 Unclassified 1189
45 Ga0070688_100099809 3300005365 Bacteria 1912
46 Ga0070688_100406034 3300005365 Unclassified 1009
47 Ga0070659_100000262 3300005366 Bacteria 41533
48 Ga0070659_100026389 3300005366 Bacteria 4470
49 Ga0070659_100048938 3300005366 Bacteria 3322
50 Ga0070667_100014082 3300005367 Bacteria 6609
51 Ga0070667_100489721 3300005367 Bacteria 1126
52 Ga0070663_100038165 3300005455 Bacteria 3349
53 Ga0070663_100314116 3300005455 Unclassified 1258
54 Ga0070678_100147628 3300005456 Unclassified 1890
55 Ga0070678_100419996 3300005456 Bacteria 1166
56 Ga0070662_100090513 3300005457 Unclassified 2297
57 Ga0070662_100119954 3300005457 Bacteria 2015
58 Ga0070681_10042183 3300005458 Bacteria 4573
59 Ga0070681_10350251 3300005458 Bacteria 1387
60 Ga0068867_100003007 3300005459 Bacteria 11884
61 Ga0070679_100000473 3300005530 Bacteria 34337
62 Ga0070679_100003316 3300005530 Bacteria 14753
63 Ga0070679_100031275 3300005530 Bacteria 5257
64 Ga0070679_100070596 3300005530 Bacteria 3484
65 Ga0070679_100203560 3300005530 Bacteria 1944
66 Ga0070679_100363837 3300005530 Bacteria 1394
67 Ga0070679_100498041 3300005530 Bacteria 1162
68 Ga0070679_100531733 3300005530 Bacteria 1119
69 Ga0070679_100681220 3300005530 Bacteria 971
70 Ga0070684_100267857 3300005535 Bacteria 1563
71 Ga0068853_100017299 3300005539 Bacteria 5952
72 Ga0068853_100053118 3300005539 Bacteria 3490
73 Ga0068853_100133414 3300005539 Bacteria 2224
74 Ga0068853_100314391 3300005539 Bacteria 1451
75 Ga0068853_100347913 3300005539 Bacteria 1378
76 Ga0070672_100000052 3300005543 Bacteria 51529
77 Ga0070672_100225868 3300005543 Bacteria 1571
78 Ga0070686_100052902 3300005544 Bacteria 2590
79 Ga0070693_100000650 3300005547 Bacteria 15328
80 Ga0070665_100000903 3300005548 Bacteria 38097
81 Ga0068855_100004379 3300005563 Bacteria 17253
82 Ga0068855_100017014 3300005563 Bacteria 8745
83 Ga0068855_100021745 3300005563 Bacteria 7693
84 Ga0068855_100031450 3300005563 Bacteria 6337
85 Ga0068855_100036608 3300005563 Bacteria 5839
86 Ga0068855_100055175 3300005563 Bacteria 4668
87 Ga0068855_100512144 3300005563 Bacteria 1303
88 Ga0070664_100014657 3300005564 Bacteria 6400
89 Ga0070664_100073104 3300005564 Bacteria 2941
90 Ga0070664_100220641 3300005564 Bacteria 1696
91 Ga0068857_100006333 3300005577 Bacteria 10136
92 Ga0068857_100178462 3300005577 Bacteria 1932
93 Ga0068857_100928589 3300005577 Unclassified 835
94 Ga0068854_100167444 3300005578 Bacteria 1707
95 Ga0068854_100252681 3300005578 Bacteria 1408
96 Ga0068854_101108963 3300005578 Unclassified 705
97 Ga0068856_100557753 3300005614 Bacteria 1167
98 Ga0070702_100053508 3300005615 Bacteria 2320
99 Ga0068852_100001611 3300005616 Bacteria 15376
100 Ga0068852_100014079 3300005616 Bacteria 6140
101 Ga0068852_100104387 3300005616 Bacteria 2565
102 Ga0068852_100213310 3300005616 Bacteria 1832
103 Ga0068859_100000285 3300005617 Bacteria 50405
104 Ga0068859_100265907 3300005617 Bacteria 1807
105 Ga0068859_100616211 3300005617 Bacteria 1178
106 Ga0068864_100001080 3300005618 Bacteria 22832
107 Ga0068864_100117451 3300005618 Bacteria 2374
108 Ga0068864_100781804 3300005618 Bacteria 937
109 Ga0068866_10128618 3300005718 Unclassified 1437
110 Ga0068870_10199928 3300005840 Unclassified 1211
111 Ga0068863_100000281 3300005841 Bacteria 52492
112 Ga0068863_100234830 3300005841 Unclassified 1769
113 Ga0068858_100001379 3300005842 Bacteria 25066
114 Ga0068858_100120823 3300005842 Bacteria 2450
115 Ga0068860_100004472 3300005843 Bacteria 14264
116 Ga0068860_100032340 3300005843 Bacteria 5026
117 Ga0068862_100580084 3300005844 Unclassified 1074
118 Ga0070716_100233452 3300006173 Viruses 1243
119 Ga0075366_10002429 3300006195 Bacteria 9555
120 Ga0075366_10588966 3300006195 Unclassified 689
121 Ga0097621_100006690 3300006237 Bacteria 8192
122 Ga0097621_100012160 3300006237 Bacteria 6371
123 Ga0097621_101104782 3300006237 Bacteria 744
124 Ga0068871_100001571 3300006358 Bacteria 15344
125 Ga0068871_100086910 3300006358 Bacteria 2598
126 Ga0068871_100104770 3300006358 Bacteria 2373
127 Ga0068865_100002600 3300006881 Bacteria 10725
128 Ga0068865_100343937 3300006881 Bacteria 1206
129 Ga0097620_100000285 3300006931 Bacteria 50405
130 Ga0097620_100265906 3300006931 Bacteria 1807
131 Ga0097620_100616290 3300006931 Bacteria 1178
132 Ga0105240_10002364 3300009093 Bacteria 30415
133 Ga0105240_10265278 3300009093 Bacteria 1979
134 Ga0105240_10295191 3300009093 Unclassified 1856
135 Ga0105240_10343223 3300009093 Bacteria 1696
136 Ga0114129_10002230 3300009147 Bacteria 26734
137 Ga0105243_10166828 3300009148 Bacteria 1904
138 Ga0105241_10006161 3300009174 Bacteria 8845
139 Ga0105241_10022759 3300009174 Bacteria 4644
140 Ga0105248_10234137 3300009177 Bacteria 2067
141 Ga0105237_10008661 3300009545 Bacteria 10991
142 Ga0105237_10501308 3300009545 Bacteria 1221
143 Ga0105238_10816144 3300009551 Unclassified 949
144 Ga0105249_10020442 3300009553 Bacteria 5918
145 Ga0105249_10128649 3300009553 Unclassified 2415
146 Ga0105239_10000530 3300010375 Bacteria 55219
147 Ga0105239_10020872 3300010375 Bacteria 7227
148 Ga0105239_10255891 3300010375 Bacteria 1967
149 Ga0105239_10852110 3300010375 Bacteria 1045
150 Ga0105246_10025298 3300011119 Bacteria 3869
151 Ga0105246_10038464 3300011119 Bacteria 3217
152 Ga0157373_10000156 3300013100 Bacteria 55108
153 Ga0157373_10158359 3300013100 Bacteria 1593
154 Ga0157373_10213947 3300013100 Unclassified 1359
155 Ga0157373_10223576 3300013100 Bacteria 1328
156 Ga0157373_10301903 3300013100 Bacteria 1137
157 Ga0157371_10000141 3300013102 Bacteria 104396
158 Ga0157371_10001321 3300013102 Bacteria 26028
159 Ga0157371_10001375 3300013102 Bacteria 25500
160 Ga0157371_10027270 3300013102 Bacteria 4144
161 Ga0157371_10031187 3300013102 Bacteria 3841
162 Ga0157371_10037552 3300013102 Bacteria 3466
163 Ga0157371_10074456 3300013102 Bacteria 2405
164 Ga0157371_10099098 3300013102 Bacteria 2067
165 Ga0157371_10171266 3300013102 Unclassified 1552
166 Ga0157371_10190023 3300013102 Bacteria 1470
167 Ga0157371_10217743 3300013102 Bacteria 1371
168 Ga0157370_10001966 3300013104 Bacteria 25315
169 Ga0157370_10002891 3300013104 Bacteria 20477
170 Ga0157370_10007415 3300013104 Bacteria 11943
171 Ga0157370_10018834 3300013104 Bacteria 6942
172 Ga0157370_10077170 3300013104 Unclassified 3139
173 Ga0157370_10142494 3300013104 Bacteria 2233
174 Ga0157370_10171932 3300013104 Unclassified 2014
175 Ga0157370_10280276 3300013104 Unclassified 1540
176 Ga0157369_10002796 3300013105 Bacteria 20834
177 Ga0157369_10021712 3300013105 Bacteria 7180
178 Ga0157369_10059160 3300013105 Bacteria 4133
179 Ga0157369_10079160 3300013105 Bacteria 3520
180 Ga0157369_10245183 3300013105 Bacteria 1871
181 Ga0157369_10395993 3300013105 Bacteria 1433
182 Ga0157369_10657372 3300013105 Bacteria 1081
183 Ga0157369_10699482 3300013105 Bacteria 1044
184 Ga0157369_10762431 3300013105 Bacteria 995
185 Ga0157374_10000399 3300013296 Bacteria 39374
186 Ga0157374_10137316 3300013296 Bacteria 2371
187 Ga0157374_10165768 3300013296 Bacteria 2153
188 Ga0157374_10225600 3300013296 Bacteria 1840
189 Ga0157374_10231163 3300013296 Bacteria 1816
190 Ga0157374_10260681 3300013296 Bacteria 1707
191 Ga0157374_10970551 3300013296 Bacteria 869
192 Ga0157378_10009834 3300013297 Bacteria 8339
193 Ga0157378_10014413 3300013297 Bacteria 6921
194 Ga0163162_10000365 3300013306 Bacteria 41027
195 Ga0163162_10002052 3300013306 Bacteria 18913
196 Ga0163162_10002933 3300013306 Bacteria 16276
197 Ga0163162_10031482 3300013306 Bacteria 5262
198 Ga0163162_10427572 3300013306 Bacteria 1456
199 Ga0163162_10818741 3300013306 Bacteria 1048
200 Ga0163162_11162425 3300013306 Unclassified 875
201 Ga0157372_10000851 3300013307 Bacteria 33164
202 Ga0157372_10002988 3300013307 Bacteria 18222
203 Ga0157372_10036261 3300013307 Bacteria 5434
204 Ga0157372_10039817 3300013307 Bacteria 5188
205 Ga0157372_10056221 3300013307 Bacteria 4396
206 Ga0157372_10077929 3300013307 Bacteria 3745
207 Ga0157372_10108068 3300013307 Bacteria 3183
208 Ga0157372_10112321 3300013307 Bacteria 3122
209 Ga0157372_10134389 3300013307 Bacteria 2848
210 Ga0157372_10157164 3300013307 Bacteria 2626
211 Ga0157372_10224915 3300013307 Bacteria 2176
212 Ga0157372_10398756 3300013307 Bacteria 1603
213 Ga0157375_10000450 3300013308 Bacteria 37191
214 Ga0157375_10097027 3300013308 Bacteria 3021
215 Ga0157375_10153563 3300013308 Bacteria 2439
216 Ga0163163_10000761 3300014325 Bacteria 27429
217 Ga0157377_10013275 3300014745 Bacteria 4167
218 Ga0157379_10000107 3300014968 Bacteria 57370
219 Ga0157379_10673849 3300014968 Bacteria 969
220 Ga0157379_10811148 3300014968 Bacteria 884
221 Ga0157376_10000336 3300014969 Bacteria 31351
222 Ga0157376_10028571 3300014969 Bacteria 4433
223 Ga0157376_10049377 3300014969 Unclassified 3484
224 Ga0157376_10131347 3300014969 Bacteria 2235
225 Ga0157376_10239040 3300014969 Bacteria 1691
226 Ga0157376_10515183 3300014969 Bacteria 1178
227 Ga0163161_10207318 3300017792 Bacteria 1513
228 Ga0206351_10738204 3300020077 Bacteria 1026
229 Ga0206352_10561188 3300020078 Bacteria 703
230 Ga0213876_10005187 3300021384 Bacteria 7187
231 Ga0209026_1000377 3300025250 Bacteria 40941
232 Ga0209026_1008369 3300025250 Bacteria 2168
233 Ga0209026_1009137 3300025250 Bacteria 1983
234 Ga0209233_1007392 3300025261 Bacteria 3483
235 Ga0207688_10216588 3300025901 Unclassified 1152
236 Ga0207680_10003265 3300025903 Bacteria 7637
237 Ga0207647_10002096 3300025904 Bacteria 15270
238 Ga0207647_10009705 3300025904 Bacteria 6829
239 Ga0207647_10043629 3300025904 Bacteria 2805
240 Ga0207645_10001517 3300025907 Bacteria 18974
241 Ga0207645_10030009 3300025907 Bacteria 3504
242 Ga0207705_10003407 3300025909 Bacteria 12089
243 Ga0207705_10014097 3300025909 Bacteria 5759
244 Ga0207705_10015096 3300025909 Bacteria 5553
245 Ga0207705_10055947 3300025909 Bacteria 2844
246 Ga0207705_10126949 3300025909 Bacteria 1896
247 Ga0207705_10158514 3300025909 Bacteria 1699
248 Ga0207707_10000722 3300025912 Bacteria 32676
249 Ga0207707_10048039 3300025912 Bacteria 3718
250 Ga0207707_10307426 3300025912 Bacteria 1370
251 Ga0207695_10008010 3300025913 Bacteria 13305
252 Ga0207695_10115405 3300025913 Bacteria 2660
253 Ga0207695_10265629 3300025913 Unclassified 1612
254 Ga0207695_10305771 3300025913 Bacteria 1481
255 Ga0207660_10005875 3300025917 Bacteria 7970
256 Ga0207660_10081663 3300025917 Bacteria 2376
257 Ga0207660_10132376 3300025917 Bacteria 1899
258 Ga0207657_10024556 3300025919 Bacteria 5575
259 Ga0207657_10037216 3300025919 Bacteria 4348
260 Ga0207657_10061712 3300025919 Bacteria 3212
261 Ga0207657_10082121 3300025919 Bacteria 2705
262 Ga0207657_10189760 3300025919 Bacteria 1658
263 Ga0207657_10202521 3300025919 Unclassified 1596
264 Ga0207657_10271187 3300025919 Bacteria 1349
265 Ga0207657_10549872 3300025919 Bacteria 903
266 Ga0207657_10712328 3300025919 Unclassified 779
267 Ga0207652_10000074 3300025921 Bacteria 108397
268 Ga0207652_10000546 3300025921 Bacteria 38083
269 Ga0207652_10025130 3300025921 Bacteria 4948
270 Ga0207652_10036654 3300025921 Bacteria 4146
271 Ga0207652_10462579 3300025921 Bacteria 1143
272 Ga0207681_10586290 3300025923 Bacteria 920
273 Ga0207650_10108094 3300025925 Bacteria 2149
274 Ga0207659_10028873 3300025926 Bacteria 3774
275 Ga0207690_10001178 3300025932 Bacteria 16550
276 Ga0207690_10138332 3300025932 Bacteria 1791
277 Ga0207706_10115731 3300025933 Bacteria 2358
278 Ga0207706_10118200 3300025933 Unclassified 2331
279 Ga0207709_10263712 3300025935 Bacteria 1264
280 Ga0207669_10316069 3300025937 Unclassified 1193
281 Ga0207704_10001241 3300025938 Bacteria 11372
282 Ga0207704_10229345 3300025938 Bacteria 1380
283 Ga0207691_10000001 3300025940 Bacteria 220829
284 Ga0207691_10027280 3300025940 Bacteria 5356
285 Ga0207691_10691224 3300025940 Bacteria 860
286 Ga0207711_10126136 3300025941 Bacteria 2290
287 Ga0207689_10174047 3300025942 Bacteria 1775
288 Ga0207689_10695144 3300025942 Bacteria 857
289 Ga0207661_10051167 3300025944 Bacteria 3295
290 Ga0207661_10485461 3300025944 Bacteria 1128
291 Ga0207661_10779609 3300025944 Bacteria 880
292 Ga0207679_10154796 3300025945 Bacteria 1870
293 Ga0207679_10159562 3300025945 Bacteria 1845
294 Ga0207679_10165745 3300025945 Unclassified 1814
295 Ga0207667_10006104 3300025949 Bacteria 14642
296 Ga0207667_10012857 3300025949 Bacteria 9619
297 Ga0207667_10023558 3300025949 Bacteria 6778
298 Ga0207667_10050728 3300025949 Bacteria 4377
299 Ga0207667_10101543 3300025949 Bacteria 2967
300 Ga0207667_10165794 3300025949 Bacteria 2271
301 Ga0207667_10210773 3300025949 Unclassified 1991
302 Ga0207651_10000927 3300025960 Bacteria 12937
303 Ga0207712_10163906 3300025961 Unclassified 1730
304 Ga0207668_10004515 3300025972 Bacteria 8183
305 Ga0207668_10204639 3300025972 Bacteria 1574
306 Ga0207640_10065720 3300025981 Bacteria 2421
307 Ga0207658_10002225 3300025986 Bacteria 14396
308 Ga0207658_10573961 3300025986 Bacteria 1011
309 Ga0207677_10016156 3300026023 Bacteria 4413
310 Ga0207677_10225022 3300026023 Bacteria 1507
311 Ga0207703_10070767 3300026035 Bacteria 2880
312 Ga0207703_10117871 3300026035 Bacteria 2275
313 Ga0207639_10109324 3300026041 Bacteria 2249
314 Ga0207639_10274743 3300026041 Bacteria 1479
315 Ga0207678_10063349 3300026067 Bacteria 3177
316 Ga0207678_10108191 3300026067 Bacteria 2372
317 Ga0207702_10244246 3300026078 Bacteria 1683
318 Ga0207702_10306526 3300026078 Bacteria 1508
319 Ga0207641_10034405 3300026088 Bacteria 4215
320 Ga0207648_10156685 3300026089 Bacteria 2010
321 Ga0207648_10208497 3300026089 Unclassified 1734
322 Ga0207676_10003381 3300026095 Bacteria 11283
323 Ga0207676_10208325 3300026095 Unclassified 1733
324 Ga0207674_10015872 3300026116 Bacteria 8255
325 Ga0207674_10067679 3300026116 Bacteria 3595
326 Ga0207674_10069814 3300026116 Bacteria 3533
327 Ga0207674_10080296 3300026116 Bacteria 3265
328 Ga0207674_11075166 3300026116 Unclassified 774
329 Ga0207683_10050022 3300026121 Bacteria 3660
330 Ga0207683_10057425 3300026121 Bacteria 3416
331 Ga0207683_10190352 3300026121 Bacteria 1863
332 Ga0207698_10012945 3300026142 Bacteria 5484
333 Ga0207698_10133001 3300026142 Unclassified 2129
334 Ga0207698_10148833 3300026142 Unclassified 2029
335 Ga0207698_10201748 3300026142 Bacteria 1781
336 Ga0268266_10004508 3300028379 Bacteria 13311
337 Ga0268265_10016719 3300028380 Bacteria 5047
338 Ga0268264_10000558 3300028381 Bacteria 45913
339 Ga0268264_10036247 3300028381 Bacteria 4062
340 Ga0268264_10226841 3300028381 Unclassified 1722
341 Ga0265324_10027758 3300029957 Bacteria 1998
342 Ga0316183_1211236 3300030742 Bacteria 944
343 Ga0316182_1113755 3300030745 Bacteria 1206
344 Ga0265327_10046766 3300031251 Bacteria 2287
345 Ga0307513_10027739 3300031456 Bacteria 6492
346 Ga0307509_10160148 3300031507 Bacteria 2150
347 Ga0307408_100000236 3300031548 Bacteria 57955
348 Ga0307408_100001050 3300031548 Bacteria 21208
349 Ga0307408_100132026 3300031548 Bacteria 1949
350 Ga0307508_10001107 3300031616 Bacteria 31214
351 Ga0307405_10030432 3300031731 Bacteria 3166
352 Ga0307405_10411320 3300031731 Unclassified 1062
353 Ga0307413_10002502 3300031824 Bacteria 7496
354 Ga0307410_10220690 3300031852 Bacteria 1458
355 Ga0307410_10330167 3300031852 Bacteria 1213
356 Ga0307407_10347939 3300031903 Bacteria 1049
357 Ga0307412_10043564 3300031911 Bacteria 2923
358 Ga0307412_10067371 3300031911 Bacteria 2430
359 Ga0307412_10189550 3300031911 Bacteria 1553
360 Ga0307412_10218229 3300031911 Unclassified 1460
361 Ga0307416_100036220 3300032002 Bacteria 3781
362 Ga0307414_10020065 3300032004 Bacteria 4157
363 Ga0307411_10002270 3300032005 Bacteria 8409
364 Ga0307415_100036449 3300032126 Bacteria 3223
365 Ga0373936_0019438 3300035113 Bacteria 2632
366 Ga0373935_0356156 3300035692 Unclassified 1044
367 Ga0373937_0054092 3300036401 Bacteria 3683
368 Ga0373937_0135896 3300036401 Unclassified 2299
369 Ga0373937_0771872 3300036401 Bacteria 909
370 Ga0395899_0001461 3300037312 Bacteria 20134
371 Ga0395899_0012182 3300037312 Bacteria 6584
372 Ga0395899_0035579 3300037312 Bacteria 3738
373 Ga0395899_0051734 3300037312 Bacteria 3047
374 Ga0395899_0111195 3300037312 Bacteria 1969
375 Ga0395899_0159480 3300037312 Bacteria 1594
376 Ga0395899_0288400 3300037312 Bacteria 1114
377 Ga0395900_0002994 3300037418 Bacteria 18381
378 Ga0395900_0017893 3300037418 Bacteria 7233
379 Ga0395900_0023731 3300037418 Bacteria 6275
380 Ga0395900_0024776 3300037418 Bacteria 6142
381 Ga0395900_0040172 3300037418 Bacteria 4821
382 Ga0395900_0046089 3300037418 Bacteria 4489
383 Ga0395900_0333359 3300037418 Bacteria 1494
384 Ga0395898_0001093 3300037466 Bacteria 41845
385 Ga0395898_0088316 3300037466 Bacteria 2984
386 Ga0395898_0102293 3300037466 Bacteria 2750
387 Ga0395898_0126499 3300037466 Bacteria 2448
388 Ga0395898_0487917 3300037466 Bacteria 1172
389 Ga0395905_0035816 3300037471 Bacteria 4661
390 Ga0395905_0044479 3300037471 Bacteria 4168
391 Ga0395905_0278755 3300037471 Unclassified 1558
392 Ga0395901_0000555 3300038443 Bacteria 43182
393 Ga0395901_0018019 3300038443 Bacteria 7207
394 Ga0395901_0053808 3300038443 Bacteria 4183
395 Ga0395901_0070002 3300038443 Bacteria 3654
396 Ga0395901_0188378 3300038443 Unclassified 2164
397 Ga0395901_0496185 3300038443 Bacteria 1243
398 Ga0395901_0556912 3300038443 Bacteria 1161
399 Ga0436365_0239519 3300039437 Unclassified 794
400 Ga0436365_1251897 3300039437 Bacteria 24739
401 Ga0451849_0894440 3300041505 Unclassified 1763
402 Ga0439445_0107501 3300042004 Unclassified 794
403 Ga0466959_0040885 3300045049 Bacteria 3425
404 Ga0495580_0150070 3300046472 Unclassified 1615
405 Ga0495582_0162826 3300046473 Unclassified 1269
406 Ga0495628_0695207 3300046516 Unclassified 719
407 Ga0495630_0026820 3300046517 Bacteria 4268
408 Ga0495587_0231535 3300046536 Bacteria 1041
409 Ga0495645_0420193 3300046543 Bacteria 849
410 Ga0495633_0032869 3300046558 Bacteria 2504
411 Ga0495625_0091308 3300046660 Bacteria 2105
412 Ga0495625_0240205 3300046660 Bacteria 1179
413 Ga0495647_0149566 3300046681 Bacteria 1000
414 Ga0495658_0006304 3300046683 Bacteria 5830
415 Ga0495670_0064441 3300046691 Bacteria 1846
416 Ga0495649_0097543 3300046694 Bacteria 1564
417 Ga0495674_0221167 3300047319 Unclassified 1565
418 Ga0495681_0095963 3300047470 Bacteria 1303
419 Ga0495686_0008980 3300047472 Bacteria 7255
420 Ga0495686_0084972 3300047472 Bacteria 1928
421 Ga0496115_0314207 3300048918 Bacteria 1283
422 Ga0496122_0015923 3300048925 Bacteria 7156
423 Ga0501292_049683 3300049515 Unclassified 741
424 Ga0501295_037718 3300049518 Unclassified 987
425 Ga0501034_0036586 3300049571 Bacteria 4972
426 Ga0501034_0037172 3300049571 Bacteria 4930
427 Ga0501034_0108600 3300049571 Bacteria 2766
428 Ga0501034_0641933 3300049571 Unclassified 964
429 Ga0501043_0212078 3300049579 Bacteria 1501
430 Ga0501046_0222167 3300049580 Unclassified 1398
431 Ga0501047_0359995 3300049581 Unclassified 1291
432 Ga0501067_0112085 3300049583 Unclassified 1517
433 Ga0501069_0110307 3300049585 Unclassified 1566
434 Ga0501070_0037576 3300049586 Bacteria 4042
435 Ga0501070_0171025 3300049586 Unclassified 1789
436 Ga0501071_0458725 3300049587 Bacteria 976
437 Ga0501198_006957 3300049649 Bacteria 1620
438 Ga0501202_000480 3300049652 Bacteria 5701
439 Ga0501209_002293 3300049656 Bacteria 2910
440 Ga0501217_068584 3300049661 Bacteria 961
441 Ga0501217_094356 3300049661 Unclassified 843
442 Ga0501222_025932 3300049662 Unclassified 795
443 Ga0501223_000973 3300049663 Bacteria 6749
444 Ga0501233_008318 3300049668 Bacteria 1995
445 Ga0501250_016264 3300049680 Bacteria 922
446 Ga0501253_012846 3300049683 Bacteria 1321
447 Ga0501253_056315 3300049683 Unclassified 837
448 Ga0501257_030662 3300049686 Bacteria 1295
449 Ga0501221_005371 3300049704 Bacteria 2137
450 Ga0501225_0004256 3300049705 Bacteria 4277
451 Ga0501080_0989558 3300049742 Unclassified 730
452 Ga0501273_016238 3300049770 Unclassified 973
453 Ga0501274_008728 3300049771 Bacteria 913
454 Ga0501276_002524 3300049773 Unclassified 1293
455 Ga0501035_0113387 3300049822 Bacteria 2375
456 Ga0501035_0114294 3300049822 Bacteria 2364
457 Ga0501044_0022240 3300049823 Bacteria 6758
458 Ga0501044_0187082 3300049823 Bacteria 2035
459 Ga0501284_00079 3300050005 Bacteria 24902
460 nmdc:mga0k408_2100_c1 3300050493 Bacteria 10668
461 nmdc:mga05p37_12118_c1 3300050507 Bacteria 10294
462 Ga0500635_0001050 3300053080 Bacteria 6612
463 Ga0500604_0007129 3300053151 Bacteria 2959
464 Ga0500616_0009931 3300053153 Bacteria 5729
465 Ga0500622_0003683 3300053156 Bacteria 10060
466 Ga0500645_043345 3300053730 Bacteria 1325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0695207 Ga0495628_0695207_113_700 195
2 3300031616 Ga0307508_10001107 Ga0307508_100011072 202
3 3300048925 Ga0496122_0015923 Ga0496122_0015923_3267_3887 204
4 3300025940 Ga0207691_10691224 Ga0207691_106912242 205
5 iso_pu_bacteria 2865002811 2865004916 206
6 iso_pu_bacteria 2904113452 2904117156 206
7 3300006195 Ga0075366_10002429 Ga0075366_1000242910 211
8 3300010375 Ga0105239_10852110 Ga0105239_108521101 211
9 3300046660 Ga0495625_0240205 Ga0495625_0240205_218_877 211
10 3300050493 nmdc:mga0k408_2100_c1 nmdc:mga0k408_2100_c1_2038_2697 211
11 3300053156 Ga0500622_0003683 Ga0500622_0003683_7746_8405 211
12 3300053151 Ga0500604_0007129 Ga0500604_0007129_1952_2605 217
13 3300036401 Ga0373937_0054092 Ga0373937_0054092_1134_1790 218
14 3300001904 JGI24736J21556_1019579 JGI24736J21556_10195791 219
15 3300001990 JGI24737J22298_10011833 JGI24737J22298_100118334 219
16 3300002067 JGI24735J21928_10007897 JGI24735J21928_100078972 219
17 3300002741 JGI25157J39369_1004030 JGI25157J39369_10040302 219
18 3300005327 Ga0070658_10014347 Ga0070658_100143472 219
19 3300005327 Ga0070658_10042145 Ga0070658_100421452 219
20 3300005327 Ga0070658_10043193 Ga0070658_100431934 219
21 3300005327 Ga0070658_10518653 Ga0070658_105186531 219
22 3300005329 Ga0070683_100069964 Ga0070683_1000699644 219
23 3300005336 Ga0070680_100034304 Ga0070680_1000343042 219
24 3300005336 Ga0070680_100124127 Ga0070680_1001241272 219
25 3300005337 Ga0070682_100044193 Ga0070682_1000441932 219
26 3300005337 Ga0070682_100156096 Ga0070682_1001560962 219
27 3300005337 Ga0070682_100332262 Ga0070682_1003322622 219
28 3300005339 Ga0070660_100015982 Ga0070660_1000159826 219
29 3300005339 Ga0070660_100136520 Ga0070660_1001365202 219
30 3300005339 Ga0070660_100400752 Ga0070660_1004007522 219
31 3300005366 Ga0070659_100000262 Ga0070659_1000002622 219
32 3300005366 Ga0070659_100026389 Ga0070659_1000263894 219
33 3300005455 Ga0070663_100038165 Ga0070663_1000381652 219
34 3300005458 Ga0070681_10042183 Ga0070681_100421833 219
35 3300005458 Ga0070681_10350251 Ga0070681_103502512 219
36 3300005530 Ga0070679_100000473 Ga0070679_1000004733 219
37 3300005530 Ga0070679_100070596 Ga0070679_1000705962 219
38 3300005530 Ga0070679_100203560 Ga0070679_1002035601 219
39 3300005530 Ga0070679_100363837 Ga0070679_1003638372 219
40 3300005530 Ga0070679_100498041 Ga0070679_1004980412 219
41 3300005530 Ga0070679_100531733 Ga0070679_1005317332 219
42 3300005530 Ga0070679_100681220 Ga0070679_1006812201 219
43 3300005539 Ga0068853_100133414 Ga0068853_1001334143 219
44 3300005539 Ga0068853_100314391 Ga0068853_1003143911 219
45 3300005563 Ga0068855_100004379 Ga0068855_10000437913 219
46 3300005563 Ga0068855_100017014 Ga0068855_1000170142 219
47 3300005563 Ga0068855_100055175 Ga0068855_1000551754 219
48 3300005563 Ga0068855_100512144 Ga0068855_1005121442 219
49 3300005577 Ga0068857_100006333 Ga0068857_1000063335 219
50 3300005577 Ga0068857_100178462 Ga0068857_1001784622 219
51 3300005578 Ga0068854_100167444 Ga0068854_1001674442 219
52 3300005578 Ga0068854_100252681 Ga0068854_1002526812 219
53 3300005578 Ga0068854_101108963 Ga0068854_1011089631 219
54 3300005614 Ga0068856_100557753 Ga0068856_1005577532 219
55 3300005616 Ga0068852_100001611 Ga0068852_10000161113 219
56 3300005616 Ga0068852_100213310 Ga0068852_1002133102 219
57 3300005617 Ga0068859_100000285 Ga0068859_10000028521 219
58 3300006195 Ga0075366_10588966 Ga0075366_105889661 219
59 3300006931 Ga0097620_100000285 Ga0097620_10000028521 219
60 3300009093 Ga0105240_10265278 Ga0105240_102652782 219
61 3300009174 Ga0105241_10022759 Ga0105241_100227594 219
62 3300009545 Ga0105237_10008661 Ga0105237_100086616 219
63 3300009553 Ga0105249_10128649 Ga0105249_101286492 219
64 3300010375 Ga0105239_10000530 Ga0105239_1000053032 219
65 3300010375 Ga0105239_10020872 Ga0105239_100208725 219
66 3300013100 Ga0157373_10000156 Ga0157373_100001567 219
67 3300013100 Ga0157373_10158359 Ga0157373_101583592 219
68 3300013100 Ga0157373_10213947 Ga0157373_102139472 219
69 3300013100 Ga0157373_10223576 Ga0157373_102235761 219
70 3300013102 Ga0157371_10000141 Ga0157371_10000141100 219
71 3300013102 Ga0157371_10001321 Ga0157371_1000132113 219
72 3300013102 Ga0157371_10001375 Ga0157371_1000137516 219
73 3300013102 Ga0157371_10027270 Ga0157371_100272702 219
74 3300013102 Ga0157371_10031187 Ga0157371_100311873 219
75 3300013102 Ga0157371_10190023 Ga0157371_101900232 219
76 3300013102 Ga0157371_10217743 Ga0157371_102177431 219
77 3300013104 Ga0157370_10001966 Ga0157370_1000196625 219
78 3300013104 Ga0157370_10002891 Ga0157370_100028917 219
79 3300013104 Ga0157370_10018834 Ga0157370_100188345 219
80 3300013104 Ga0157370_10077170 Ga0157370_100771702 219
81 3300013104 Ga0157370_10171932 Ga0157370_101719322 219
82 3300013104 Ga0157370_10280276 Ga0157370_102802762 219
83 3300013105 Ga0157369_10002796 Ga0157369_100027965 219
84 3300013105 Ga0157369_10059160 Ga0157369_100591602 219
85 3300013105 Ga0157369_10079160 Ga0157369_100791602 219
86 3300013105 Ga0157369_10245183 Ga0157369_102451832 219
87 3300013105 Ga0157369_10395993 Ga0157369_103959931 219
88 3300013105 Ga0157369_10657372 Ga0157369_106573722 219
89 3300013296 Ga0157374_10165768 Ga0157374_101657682 219
90 3300013296 Ga0157374_10260681 Ga0157374_102606812 219
91 3300013296 Ga0157374_10970551 Ga0157374_109705511 219
92 3300013306 Ga0163162_10002052 Ga0163162_1000205214 219
93 3300013307 Ga0157372_10000851 Ga0157372_1000085116 219
94 3300013307 Ga0157372_10002988 Ga0157372_1000298815 219
95 3300013307 Ga0157372_10036261 Ga0157372_100362614 219
96 3300013307 Ga0157372_10039817 Ga0157372_100398175 219
97 3300013307 Ga0157372_10056221 Ga0157372_100562213 219
98 3300013307 Ga0157372_10077929 Ga0157372_100779293 219
99 3300013307 Ga0157372_10108068 Ga0157372_101080682 219
100 3300013307 Ga0157372_10112321 Ga0157372_101123213 219
101 3300013307 Ga0157372_10157164 Ga0157372_101571641 219
102 3300014968 Ga0157379_10673849 Ga0157379_106738492 219
103 3300020077 Ga0206351_10738204 Ga0206351_107382042 219
104 3300020078 Ga0206352_10561188 Ga0206352_105611881 219
105 3300025250 Ga0209026_1000377 Ga0209026_100037723 219
106 3300025250 Ga0209026_1008369 Ga0209026_10083692 219
107 3300025250 Ga0209026_1009137 Ga0209026_10091372 219
108 3300025261 Ga0209233_1007392 Ga0209233_10073922 219
109 3300025904 Ga0207647_10002096 Ga0207647_1000209613 219
110 3300025904 Ga0207647_10043629 Ga0207647_100436293 219
111 3300025909 Ga0207705_10014097 Ga0207705_100140976 219
112 3300025909 Ga0207705_10015096 Ga0207705_100150962 219
113 3300025909 Ga0207705_10055947 Ga0207705_100559472 219
114 3300025912 Ga0207707_10048039 Ga0207707_100480392 219
115 3300025912 Ga0207707_10307426 Ga0207707_103074262 219
116 3300025913 Ga0207695_10115405 Ga0207695_101154052 219
117 3300025917 Ga0207660_10005875 Ga0207660_100058757 219
118 3300025917 Ga0207660_10132376 Ga0207660_101323762 219
119 3300025919 Ga0207657_10024556 Ga0207657_100245562 219
120 3300025919 Ga0207657_10037216 Ga0207657_100372166 219
121 3300025919 Ga0207657_10061712 Ga0207657_100617122 219
122 3300025919 Ga0207657_10202521 Ga0207657_102025212 219
123 3300025919 Ga0207657_10271187 Ga0207657_102711872 219
124 3300025921 Ga0207652_10000074 Ga0207652_1000007459 219
125 3300025921 Ga0207652_10000546 Ga0207652_1000054634 219
126 3300025921 Ga0207652_10025130 Ga0207652_100251304 219
127 3300025932 Ga0207690_10001178 Ga0207690_1000117816 219
128 3300025932 Ga0207690_10138332 Ga0207690_101383322 219
129 3300025944 Ga0207661_10051167 Ga0207661_100511674 219
130 3300025944 Ga0207661_10485461 Ga0207661_104854612 219
131 3300025949 Ga0207667_10006104 Ga0207667_100061046 219
132 3300025949 Ga0207667_10012857 Ga0207667_100128573 219
133 3300025949 Ga0207667_10023558 Ga0207667_100235582 219
134 3300025949 Ga0207667_10165794 Ga0207667_101657942 219
135 3300025961 Ga0207712_10163906 Ga0207712_101639062 219
136 3300025981 Ga0207640_10065720 Ga0207640_100657203 219
137 3300026041 Ga0207639_10274743 Ga0207639_102747432 219
138 3300026067 Ga0207678_10063349 Ga0207678_100633492 219
139 3300026067 Ga0207678_10108191 Ga0207678_101081913 219
140 3300026078 Ga0207702_10244246 Ga0207702_102442462 219
141 3300026078 Ga0207702_10306526 Ga0207702_103065261 219
142 3300026088 Ga0207641_10034405 Ga0207641_100344051 219
143 3300026116 Ga0207674_10015872 Ga0207674_100158723 219
144 3300026116 Ga0207674_10067679 Ga0207674_100676792 219
145 3300026142 Ga0207698_10012945 Ga0207698_100129452 219
146 3300026142 Ga0207698_10148833 Ga0207698_101488332 219
147 3300026142 Ga0207698_10201748 Ga0207698_102017481 219
148 3300030742 Ga0316183_1211236 Ga0316183_12112361 219
149 3300030745 Ga0316182_1113755 Ga0316182_11137552 219
150 3300031548 Ga0307408_100000236 Ga0307408_10000023636 219
151 3300031548 Ga0307408_100001050 Ga0307408_10000105010 219
152 3300031548 Ga0307408_100132026 Ga0307408_1001320262 219
153 3300031911 Ga0307412_10067371 Ga0307412_100673713 219
154 3300031911 Ga0307412_10189550 Ga0307412_101895502 219
155 3300031911 Ga0307412_10218229 Ga0307412_102182292 219
156 3300036401 Ga0373937_0771872 Ga0373937_0771872_172_831 219
157 3300037312 Ga0395899_0001461 Ga0395899_0001461_2955_3614 219
158 3300037312 Ga0395899_0012182 Ga0395899_0012182_804_1466 219
159 3300037312 Ga0395899_0035579 Ga0395899_0035579_1543_2202 219
160 3300037312 Ga0395899_0051734 Ga0395899_0051734_1471_2130 219
161 3300037312 Ga0395899_0111195 Ga0395899_0111195_154_813 219
162 3300037312 Ga0395899_0159480 Ga0395899_0159480_398_1057 219
163 3300037312 Ga0395899_0288400 Ga0395899_0288400_376_1035 219
164 3300037418 Ga0395900_0002994 Ga0395900_0002994_14671_15330 219
165 3300037418 Ga0395900_0017893 Ga0395900_0017893_450_1109 219
166 3300037418 Ga0395900_0024776 Ga0395900_0024776_756_1415 219
167 3300037418 Ga0395900_0040172 Ga0395900_0040172_400_1059 219
168 3300037418 Ga0395900_0046089 Ga0395900_0046089_2541_3200 219
169 3300037418 Ga0395900_0333359 Ga0395900_0333359_533_1192 219
170 3300037466 Ga0395898_0001093 Ga0395898_0001093_37459_38118 219
171 3300037466 Ga0395898_0088316 Ga0395898_0088316_2023_2682 219
172 3300037466 Ga0395898_0102293 Ga0395898_0102293_1604_2263 219
173 3300037466 Ga0395898_0126499 Ga0395898_0126499_676_1338 219
174 3300037466 Ga0395898_0487917 Ga0395898_0487917_230_889 219
175 3300037471 Ga0395905_0035816 Ga0395905_0035816_2060_2719 219
176 3300037471 Ga0395905_0278755 Ga0395905_0278755_553_1212 219
177 3300038443 Ga0395901_0000555 Ga0395901_0000555_28239_28901 219
178 3300038443 Ga0395901_0018019 Ga0395901_0018019_1866_2525 219
179 3300038443 Ga0395901_0053808 Ga0395901_0053808_905_1564 219
180 3300038443 Ga0395901_0070002 Ga0395901_0070002_685_1344 219
181 3300038443 Ga0395901_0188378 Ga0395901_0188378_383_1042 219
182 3300038443 Ga0395901_0496185 Ga0395901_0496185_265_924 219
183 3300038443 Ga0395901_0556912 Ga0395901_0556912_253_912 219
184 3300047472 Ga0495686_0008980 Ga0495686_0008980_2143_2802 219
185 3300049571 Ga0501034_0108600 Ga0501034_0108600_739_1398 219
186 3300049649 Ga0501198_006957 Ga0501198_006957_52_711 219
187 3300049661 Ga0501217_068584 Ga0501217_068584_31_690 219
188 3300049663 Ga0501223_000973 Ga0501223_000973_3114_3773 219
189 3300050005 Ga0501284_00079 Ga0501284_00079_22214_22873 219
190 3300053080 Ga0500635_0001050 Ga0500635_0001050_4407_5066 219
191 3300005331 Ga0070670_100315067 Ga0070670_1003150672 220
192 3300005339 Ga0070660_100292430 Ga0070660_1002924301 220
193 3300005344 Ga0070661_100240776 Ga0070661_1002407762 220
194 3300005347 Ga0070668_100048296 Ga0070668_1000482962 220
195 3300005364 Ga0070673_100426737 Ga0070673_1004267372 220
196 3300005456 Ga0070678_100419996 Ga0070678_1004199962 220
197 3300005539 Ga0068853_100347913 Ga0068853_1003479132 220
198 3300005616 Ga0068852_100014079 Ga0068852_1000140793 220
199 3300006173 Ga0070716_100233452 Ga0070716_1002334522 220
200 3300006237 Ga0097621_100006690 Ga0097621_1000066905 220
201 3300006358 Ga0068871_100086910 Ga0068871_1000869102 220
202 3300006881 Ga0068865_100343937 Ga0068865_1003439372 220
203 3300009147 Ga0114129_10002230 Ga0114129_1000223022 220
204 3300013105 Ga0157369_10699482 Ga0157369_106994821 220
205 3300013306 Ga0163162_10031482 Ga0163162_100314824 220
206 3300013307 Ga0157372_10134389 Ga0157372_101343892 220
207 3300013307 Ga0157372_10398756 Ga0157372_103987562 220
208 3300014968 Ga0157379_10811148 Ga0157379_108111482 220
209 3300014969 Ga0157376_10028571 Ga0157376_100285711 220
210 3300014969 Ga0157376_10515183 Ga0157376_105151831 220
211 3300021384 Ga0213876_10005187 Ga0213876_100051877 220
212 3300025904 Ga0207647_10009705 Ga0207647_100097053 220
213 3300025919 Ga0207657_10712328 Ga0207657_107123281 220
214 3300025925 Ga0207650_10108094 Ga0207650_101080942 220
215 3300025938 Ga0207704_10229345 Ga0207704_102293453 220
216 3300025972 Ga0207668_10204639 Ga0207668_102046391 220
217 3300026121 Ga0207683_10050022 Ga0207683_100500223 220
218 3300029957 Ga0265324_10027758 Ga0265324_100277582 220
219 3300031251 Ga0265327_10046766 Ga0265327_100467662 220
220 3300031456 Ga0307513_10027739 Ga0307513_100277397 220
221 3300031507 Ga0307509_10160148 Ga0307509_101601481 220
222 3300031731 Ga0307405_10411320 Ga0307405_104113202 220
223 3300031903 Ga0307407_10347939 Ga0307407_103479392 220
224 3300032004 Ga0307414_10020065 Ga0307414_100200653 220
225 3300035113 Ga0373936_0019438 Ga0373936_0019438_1914_2576 220
226 3300035692 Ga0373935_0356156 Ga0373935_0356156_297_959 220
227 3300036401 Ga0373937_0135896 Ga0373937_0135896_1020_1682 220
228 3300039437 Ga0436365_1251897 Ga0436365_1251897_14973_15635 220
229 3300041505 Ga0451849_0894440 Ga0451849_0894440_729_1391 220
230 3300045049 Ga0466959_0040885 Ga0466959_0040885_1961_2647 220
231 3300046472 Ga0495580_0150070 Ga0495580_0150070_212_874 220
232 3300046473 Ga0495582_0162826 Ga0495582_0162826_382_1044 220
233 3300046517 Ga0495630_0026820 Ga0495630_0026820_799_1461 220
234 3300046536 Ga0495587_0231535 Ga0495587_0231535_172_834 220
235 3300046543 Ga0495645_0420193 Ga0495645_0420193_152_814 220
236 3300046558 Ga0495633_0032869 Ga0495633_0032869_563_1225 220
237 3300046660 Ga0495625_0091308 Ga0495625_0091308_1109_1771 220
238 3300046681 Ga0495647_0149566 Ga0495647_0149566_275_937 220
239 3300046683 Ga0495658_0006304 Ga0495658_0006304_4634_5296 220
240 3300046691 Ga0495670_0064441 Ga0495670_0064441_341_1003 220
241 3300046694 Ga0495649_0097543 Ga0495649_0097543_382_1044 220
242 3300047319 Ga0495674_0221167 Ga0495674_0221167_75_737 220
243 3300047470 Ga0495681_0095963 Ga0495681_0095963_485_1147 220
244 3300047472 Ga0495686_0084972 Ga0495686_0084972_938_1600 220
245 3300048918 Ga0496115_0314207 Ga0496115_0314207_29_691 220
246 3300049680 Ga0501250_016264 Ga0501250_016264_38_700 220
247 3300049683 Ga0501253_012846 Ga0501253_012846_439_1101 220
248 3300049686 Ga0501257_030662 Ga0501257_030662_554_1216 220
249 3300049771 Ga0501274_008728 Ga0501274_008728_149_835 220
250 3300050507 nmdc:mga05p37_12118_c1 nmdc:mga05p37_12118_c1_8887_9549 220
251 3300005327 Ga0070658_10000526 Ga0070658_100005267 221
252 3300005327 Ga0070658_10091061 Ga0070658_100910611 221
253 3300005328 Ga0070676_10006484 Ga0070676_100064843 221
254 3300005335 Ga0070666_10008837 Ga0070666_100088372 221
255 3300005336 Ga0070680_100000878 Ga0070680_10000087810 221
256 3300005336 Ga0070680_100008990 Ga0070680_1000089902 221
257 3300005336 Ga0070680_100134324 Ga0070680_1001343242 221
258 3300005337 Ga0070682_100001122 Ga0070682_10000112213 221
259 3300005338 Ga0068868_100000064 Ga0068868_1000000643 221
260 3300005339 Ga0070660_100057292 Ga0070660_1000572923 221
261 3300005339 Ga0070660_100064832 Ga0070660_1000648322 221
262 3300005347 Ga0070668_100005340 Ga0070668_1000053405 221
263 3300005353 Ga0070669_100352363 Ga0070669_1003523631 221
264 3300005354 Ga0070675_100027384 Ga0070675_1000273843 221
265 3300005364 Ga0070673_100000225 Ga0070673_1000002254 221
266 3300005366 Ga0070659_100048938 Ga0070659_1000489383 221
267 3300005367 Ga0070667_100014082 Ga0070667_1000140825 221
268 3300005367 Ga0070667_100489721 Ga0070667_1004897212 221
269 3300005455 Ga0070663_100314116 Ga0070663_1003141162 221
270 3300005456 Ga0070678_100147628 Ga0070678_1001476282 221
271 3300005457 Ga0070662_100090513 Ga0070662_1000905132 221
272 3300005459 Ga0068867_100003007 Ga0068867_1000030072 221
273 3300005530 Ga0070679_100003316 Ga0070679_1000033169 221
274 3300005530 Ga0070679_100031275 Ga0070679_1000312753 221
275 3300005539 Ga0068853_100017299 Ga0068853_1000172992 221
276 3300005539 Ga0068853_100053118 Ga0068853_1000531182 221
277 3300005543 Ga0070672_100000052 Ga0070672_10000005236 221
278 3300005547 Ga0070693_100000650 Ga0070693_1000006508 221
279 3300005548 Ga0070665_100000903 Ga0070665_1000009037 221
280 3300005563 Ga0068855_100021745 Ga0068855_1000217454 221
281 3300005563 Ga0068855_100031450 Ga0068855_1000314505 221
282 3300005563 Ga0068855_100036608 Ga0068855_1000366083 221
283 3300005564 Ga0070664_100220641 Ga0070664_1002206412 221
284 3300005616 Ga0068852_100104387 Ga0068852_1001043872 221
285 3300005617 Ga0068859_100265907 Ga0068859_1002659072 221
286 3300005617 Ga0068859_100616211 Ga0068859_1006162112 221
287 3300005618 Ga0068864_100001080 Ga0068864_1000010804 221
288 3300005618 Ga0068864_100117451 Ga0068864_1001174512 221
289 3300005718 Ga0068866_10128618 Ga0068866_101286182 221
290 3300005841 Ga0068863_100000281 Ga0068863_10000028123 221
291 3300005842 Ga0068858_100001379 Ga0068858_10000137914 221
292 3300005843 Ga0068860_100004472 Ga0068860_1000044727 221
293 3300005843 Ga0068860_100032340 Ga0068860_1000323403 221
294 3300005844 Ga0068862_100580084 Ga0068862_1005800842 221
295 3300006237 Ga0097621_100012160 Ga0097621_1000121606 221
296 3300006237 Ga0097621_101104782 Ga0097621_1011047821 221
297 3300006358 Ga0068871_100001571 Ga0068871_1000015712 221
298 3300006881 Ga0068865_100002600 Ga0068865_1000026005 221
299 3300006931 Ga0097620_100265906 Ga0097620_1002659062 221
300 3300006931 Ga0097620_100616290 Ga0097620_1006162902 221
301 3300009093 Ga0105240_10002364 Ga0105240_1000236413 221
302 3300009093 Ga0105240_10295191 Ga0105240_102951912 221
303 3300009093 Ga0105240_10343223 Ga0105240_103432232 221
304 3300009148 Ga0105243_10166828 Ga0105243_101668282 221
305 3300009174 Ga0105241_10006161 Ga0105241_100061615 221
306 3300009177 Ga0105248_10234137 Ga0105248_102341372 221
307 3300009545 Ga0105237_10501308 Ga0105237_105013082 221
308 3300009551 Ga0105238_10816144 Ga0105238_108161441 221
309 3300009553 Ga0105249_10020442 Ga0105249_100204425 221
310 3300010375 Ga0105239_10255891 Ga0105239_102558912 221
311 3300011119 Ga0105246_10038464 Ga0105246_100384643 221
312 3300013100 Ga0157373_10301903 Ga0157373_103019032 221
313 3300013102 Ga0157371_10037552 Ga0157371_100375522 221
314 3300013102 Ga0157371_10074456 Ga0157371_100744563 221
315 3300013102 Ga0157371_10099098 Ga0157371_100990982 221
316 3300013102 Ga0157371_10171266 Ga0157371_101712661 221
317 3300013104 Ga0157370_10007415 Ga0157370_100074156 221
318 3300013104 Ga0157370_10142494 Ga0157370_101424941 221
319 3300013105 Ga0157369_10021712 Ga0157369_100217125 221
320 3300013105 Ga0157369_10762431 Ga0157369_107624311 221
321 3300013296 Ga0157374_10000399 Ga0157374_1000039927 221
322 3300013296 Ga0157374_10231163 Ga0157374_102311632 221
323 3300013297 Ga0157378_10014413 Ga0157378_100144132 221
324 3300013306 Ga0163162_10000365 Ga0163162_1000036538 221
325 3300013306 Ga0163162_10002933 Ga0163162_1000293314 221
326 3300013306 Ga0163162_10818741 Ga0163162_108187411 221
327 3300013307 Ga0157372_10224915 Ga0157372_102249152 221
328 3300013308 Ga0157375_10000450 Ga0157375_1000045025 221
329 3300014325 Ga0163163_10000761 Ga0163163_1000076122 221
330 3300014968 Ga0157379_10000107 Ga0157379_1000010740 221
331 3300014969 Ga0157376_10000336 Ga0157376_100003362 221
332 3300014969 Ga0157376_10049377 Ga0157376_100493772 221
333 3300017792 Ga0163161_10207318 Ga0163161_102073182 221
334 3300025903 Ga0207680_10003265 Ga0207680_100032656 221
335 3300025907 Ga0207645_10001517 Ga0207645_1000151714 221
336 3300025909 Ga0207705_10003407 Ga0207705_100034072 221
337 3300025909 Ga0207705_10126949 Ga0207705_101269492 221
338 3300025912 Ga0207707_10000722 Ga0207707_1000072212 221
339 3300025913 Ga0207695_10008010 Ga0207695_100080108 221
340 3300025913 Ga0207695_10265629 Ga0207695_102656292 221
341 3300025913 Ga0207695_10305771 Ga0207695_103057712 221
342 3300025917 Ga0207660_10081663 Ga0207660_100816631 221
343 3300025919 Ga0207657_10082121 Ga0207657_100821212 221
344 3300025919 Ga0207657_10189760 Ga0207657_101897602 221
345 3300025919 Ga0207657_10549872 Ga0207657_105498722 221
346 3300025921 Ga0207652_10036654 Ga0207652_100366543 221
347 3300025921 Ga0207652_10462579 Ga0207652_104625791 221
348 3300025923 Ga0207681_10586290 Ga0207681_105862902 221
349 3300025926 Ga0207659_10028873 Ga0207659_100288733 221
350 3300025933 Ga0207706_10118200 Ga0207706_101182002 221
351 3300025935 Ga0207709_10263712 Ga0207709_102637122 221
352 3300025938 Ga0207704_10001241 Ga0207704_100012414 221
353 3300025940 Ga0207691_10000001 Ga0207691_10000001181 221
354 3300025941 Ga0207711_10126136 Ga0207711_101261362 221
355 3300025942 Ga0207689_10695144 Ga0207689_106951441 221
356 3300025945 Ga0207679_10159562 Ga0207679_101595622 221
357 3300025949 Ga0207667_10050728 Ga0207667_100507284 221
358 3300025949 Ga0207667_10101543 Ga0207667_101015431 221
359 3300025949 Ga0207667_10210773 Ga0207667_102107732 221
360 3300025960 Ga0207651_10000927 Ga0207651_100009273 221
361 3300025972 Ga0207668_10004515 Ga0207668_100045154 221
362 3300025986 Ga0207658_10002225 Ga0207658_1000222510 221
363 3300025986 Ga0207658_10573961 Ga0207658_105739611 221
364 3300026023 Ga0207677_10016156 Ga0207677_100161564 221
365 3300026035 Ga0207703_10070767 Ga0207703_100707673 221
366 3300026041 Ga0207639_10109324 Ga0207639_101093242 221
367 3300026089 Ga0207648_10156685 Ga0207648_101566852 221
368 3300026095 Ga0207676_10003381 Ga0207676_100033813 221
369 3300026116 Ga0207674_10069814 Ga0207674_100698142 221
370 3300026116 Ga0207674_10080296 Ga0207674_100802961 221
371 3300026121 Ga0207683_10190352 Ga0207683_101903523 221
372 3300026142 Ga0207698_10133001 Ga0207698_101330012 221
373 3300028379 Ga0268266_10004508 Ga0268266_100045085 221
374 3300028380 Ga0268265_10016719 Ga0268265_100167193 221
375 3300028381 Ga0268264_10000558 Ga0268264_1000055839 221
376 3300028381 Ga0268264_10036247 Ga0268264_100362472 221
377 3300028381 Ga0268264_10226841 Ga0268264_102268413 221
378 3300031852 Ga0307410_10330167 Ga0307410_103301672 221
379 3300037471 Ga0395905_0044479 Ga0395905_0044479_876_1541 221
380 3300039437 Ga0436365_0239519 Ga0436365_0239519_111_776 221
381 3300042004 Ga0439445_0107501 Ga0439445_0107501_17_682 221
382 3300049571 Ga0501034_0036586 Ga0501034_0036586_4102_4767 221
383 3300049571 Ga0501034_0037172 Ga0501034_0037172_2279_2944 221
384 3300049571 Ga0501034_0641933 Ga0501034_0641933_90_755 221
385 3300049579 Ga0501043_0212078 Ga0501043_0212078_666_1331 221
386 3300049580 Ga0501046_0222167 Ga0501046_0222167_300_965 221
387 3300049581 Ga0501047_0359995 Ga0501047_0359995_327_992 221
388 3300049583 Ga0501067_0112085 Ga0501067_0112085_317_982 221
389 3300049585 Ga0501069_0110307 Ga0501069_0110307_382_1047 221
390 3300049586 Ga0501070_0037576 Ga0501070_0037576_1596_2261 221
391 3300049586 Ga0501070_0171025 Ga0501070_0171025_1033_1698 221
392 3300049587 Ga0501071_0458725 Ga0501071_0458725_29_694 221
393 3300049742 Ga0501080_0989558 Ga0501080_0989558_25_690 221
394 3300049822 Ga0501035_0114294 Ga0501035_0114294_106_771 221
395 3300053153 Ga0500616_0009931 Ga0500616_0009931_437_1102 221
396 3300025909 Ga0207705_10158514 Ga0207705_101585142 222
397 3300031731 Ga0307405_10030432 Ga0307405_100304322 222
398 3300031824 Ga0307413_10002502 Ga0307413_100025024 222
399 3300031852 Ga0307410_10220690 Ga0307410_102206902 222
400 3300031911 Ga0307412_10043564 Ga0307412_100435643 222
401 3300032002 Ga0307416_100036220 Ga0307416_1000362203 222
402 3300032005 Ga0307411_10002270 Ga0307411_100022704 222
403 3300032126 Ga0307415_100036449 Ga0307415_1000364493 222
404 3300049515 Ga0501292_049683 Ga0501292_049683_48_716 222
405 3300049518 Ga0501295_037718 Ga0501295_037718_57_725 222
406 3300049652 Ga0501202_000480 Ga0501202_000480_2718_3386 222
407 3300049656 Ga0501209_002293 Ga0501209_002293_1717_2385 222
408 3300049661 Ga0501217_094356 Ga0501217_094356_75_743 222
409 3300049662 Ga0501222_025932 Ga0501222_025932_68_736 222
410 3300049668 Ga0501233_008318 Ga0501233_008318_1232_1900 222
411 3300049683 Ga0501253_056315 Ga0501253_056315_151_819 222
412 3300049704 Ga0501221_005371 Ga0501221_005371_776_1444 222
413 3300049705 Ga0501225_0004256 Ga0501225_0004256_1138_1806 222
414 3300049770 Ga0501273_016238 Ga0501273_016238_19_687 222
415 3300049773 Ga0501276_002524 Ga0501276_002524_456_1124 222
416 3300049822 Ga0501035_0113387 Ga0501035_0113387_1495_2163 222
417 3300049823 Ga0501044_0022240 Ga0501044_0022240_1054_1722 222
418 3300049823 Ga0501044_0187082 Ga0501044_0187082_821_1489 222
419 3300005331 Ga0070670_100283568 Ga0070670_1002835682 223
420 3300005365 Ga0070688_100406034 Ga0070688_1004060342 223
421 3300014969 Ga0157376_10131347 Ga0157376_101313473 223
422 3300014969 Ga0157376_10239040 Ga0157376_102390402 223
423 3300037418 Ga0395900_0023731 Ga0395900_0023731_1958_2629 223
424 3300053730 Ga0500645_043345 Ga0500645_043345_638_1309 223
425 2162886011 MRS1b_contig_3780475 MRS1b_0862.00001880 226
426 3300005331 Ga0070670_100333271 Ga0070670_1003332712 226
427 3300005334 Ga0068869_100250427 Ga0068869_1002504271 226
428 3300005345 Ga0070692_10494655 Ga0070692_104946551 226
429 3300005355 Ga0070671_100326223 Ga0070671_1003262232 226
430 3300005356 Ga0070674_100393009 Ga0070674_1003930092 226
431 3300005365 Ga0070688_100099809 Ga0070688_1000998091 226
432 3300005457 Ga0070662_100119954 Ga0070662_1001199542 226
433 3300005535 Ga0070684_100267857 Ga0070684_1002678572 226
434 3300005543 Ga0070672_100225868 Ga0070672_1002258682 226
435 3300005544 Ga0070686_100052902 Ga0070686_1000529023 226
436 3300005564 Ga0070664_100014657 Ga0070664_1000146573 226
437 3300005564 Ga0070664_100073104 Ga0070664_1000731043 226
438 3300005577 Ga0068857_100928589 Ga0068857_1009285891 226
439 3300005615 Ga0070702_100053508 Ga0070702_1000535081 226
440 3300005618 Ga0068864_100781804 Ga0068864_1007818042 226
441 3300005840 Ga0068870_10199928 Ga0068870_101999282 226
442 3300005841 Ga0068863_100234830 Ga0068863_1002348301 226
443 3300005842 Ga0068858_100120823 Ga0068858_1001208233 226
444 3300006358 Ga0068871_100104770 Ga0068871_1001047702 226
445 3300011119 Ga0105246_10025298 Ga0105246_100252985 226
446 3300013296 Ga0157374_10137316 Ga0157374_101373162 226
447 3300013296 Ga0157374_10225600 Ga0157374_102256002 226
448 3300013297 Ga0157378_10009834 Ga0157378_100098343 226
449 3300013306 Ga0163162_10427572 Ga0163162_104275722 226
450 3300013306 Ga0163162_11162425 Ga0163162_111624252 226
451 3300013308 Ga0157375_10097027 Ga0157375_100970272 226
452 3300013308 Ga0157375_10153563 Ga0157375_101535632 226
453 3300014745 Ga0157377_10013275 Ga0157377_100132753 226
454 3300025901 Ga0207688_10216588 Ga0207688_102165881 226
455 3300025907 Ga0207645_10030009 Ga0207645_100300092 226
456 3300025933 Ga0207706_10115731 Ga0207706_101157312 226
457 3300025937 Ga0207669_10316069 Ga0207669_103160691 226
458 3300025940 Ga0207691_10027280 Ga0207691_100272802 226
459 3300025942 Ga0207689_10174047 Ga0207689_101740472 226
460 3300025944 Ga0207661_10779609 Ga0207661_107796092 226
461 3300025945 Ga0207679_10154796 Ga0207679_101547963 226
462 3300025945 Ga0207679_10165745 Ga0207679_101657453 226
463 3300026023 Ga0207677_10225022 Ga0207677_102250221 226
464 3300026035 Ga0207703_10117871 Ga0207703_101178712 226
465 3300026089 Ga0207648_10208497 Ga0207648_102084971 226
466 3300026095 Ga0207676_10208325 Ga0207676_102083252 226
467 3300026116 Ga0207674_11075166 Ga0207674_110751661 226
468 3300026121 Ga0207683_10057425 Ga0207683_100574253 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

27

226

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8di1-assembly1.cif.gz_A bfo2294: tannerella forsythia 2-keto-3-deoxy-6-phosphogluconate aldolase (kdpg) and 4-hydroxy-2-oxoglutarate aldolase (khg) 0.975 4 218
6p6f-assembly1.cif.gz_A bg505 sosip-i53-50np 0.9493 9 217
8di1-assembly1.cif.gz_A bfo2294: tannerella forsythia 2-keto-3-deoxy-6-phosphogluconate aldolase (kdpg) and 4-hydroxy-2-oxoglutarate aldolase (khg) 0.949 4 218
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9459 8 217
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.9447 9 217
ID Description Score Start End Superfamily
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9518 5 218 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9296 5 218 3.20.20.70
1vhcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9284 4 216 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9269 38 214 3.20.20.70
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9095 2 215 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4V2YZJ4-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase 0.9932 1 220 GO:0016829
AF-A0A0A2M4N2-F1-model_v4 Ketohydroxyglutarate aldolase 0.9927 1 218 GO:0016829
AF-A0A4V2ARW6-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase 0.9916 1 147 GO:0016829
AF-A0A3G6N6P3-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase 0.9911 1 218 GO:0016829
AF-A0A2X2L126-F1-model_v4 KHG/KDPG aldolase 0.9911 1 187 GO:0016829

Feature Viewer

pLDDT pTM Quality
96.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map