metagRoot

F450050

General Info

Members	Datasets	Scaffolds	Average Seq Length
468	313	435	285

Family's Representative Sequence

Representative Sequence	3300026023\|Ga0207677_10040369\|Ga0207677_100403694
Length	320
Sequence	MPLPGSFRLVDGPSASATFGWGGSAKPPIARQCGMKTPPRLQSLVDEGLIDTVVRQLMSGKEAQAYVVRCTHDGASVTRCAKVYKEATQRSFRQATDYTENRKVKNSRQARAMAKGTKFGRQAQEAAWQSAEVDALYRLAAAGVRVPTPYNFHDGVLLMELVTDAEGDAAPRMNDVALTPESARAHHAMLLLQVVRMLCAGVVHGDLSEFNVLLGEEGPVIIDLPQAIDAAGNNHAHRVLLRDVANLRNFFGGFAPELLQTHFGPEIWDLYTRGLLTPETPLTGRFEQKAGAIDLAGVQREIDDARAEESARRVRMGVAG

Samples

	Sample ID	Description	Type	Environment
1	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
2	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
3	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
4	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
5	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
6	2818991450	Burkholderia sp. 604	Isolate	Unclassified
7	2831864461	Roseateles noduli HZ7	Isolate	Nodule
8	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
9	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
10	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
11	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
12	2847085930	Erwinia persicina B64	Isolate	Bulb
13	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
14	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
15	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
16	2876601092	Pantoea endophytica 596	Isolate	Unclassified
17	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
18	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
19	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
20	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
21	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
22	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
23	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
24	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
25	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
26	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
27	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
28	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
29	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
30	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
31	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
32	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
33	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
34	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
35	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
36	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
37	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
38	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
39	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
40	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
41	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
42	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
43	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
44	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
45	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
46	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
47	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
48	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
49	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
50	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
51	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
52	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
53	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
54	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
55	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
56	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
57	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
58	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
59	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
60	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
61	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
62	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
63	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
64	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
65	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
66	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
67	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
68	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
69	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
70	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
71	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
72	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
73	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
74	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
76	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
77	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
78	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
79	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
82	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
83	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
84	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
87	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
88	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
89	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
90	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
91	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
92	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
93	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
94	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
95	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
96	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
97	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
98	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
99	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
100	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
101	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
102	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
103	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
106	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
108	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
146	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
148	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
152	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
153	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
154	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
155	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
156	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
157	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
158	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
159	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
160	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
161	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
162	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
163	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
164	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
165	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
166	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
167	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
168	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
169	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
170	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
171	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
172	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
173	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
174	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
175	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
176	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
177	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
178	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
179	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
180	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
181	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
182	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
183	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
184	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
185	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
186	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
187	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
188	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
189	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
190	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
191	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
192	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
193	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
194	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
195	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
196	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
197	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
198	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
199	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
200	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
201	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
202	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
203	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
204	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
205	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
206	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
207	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
208	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
209	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
210	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
211	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
212	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
213	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
214	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
215	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
216	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
217	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
218	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
219	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
220	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
221	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
222	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
223	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
224	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
225	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
226	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
227	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
228	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
229	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
230	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
231	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
232	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
233	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
234	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
235	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
236	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
237	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
238	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
239	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
240	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
241	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
242	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
243	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
244	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
245	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
246	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
247	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
248	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
249	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
250	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
251	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
252	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
253	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
254	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
255	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
256	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
257	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
258	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
259	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
260	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
261	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
262	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
263	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
264	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
265	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
266	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
267	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
268	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
269	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
270	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
271	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
272	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
273	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
276	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
277	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
278	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
279	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
280	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
281	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
282	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
283	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
284	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
285	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
286	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
287	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
288	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
289	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
290	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
291	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
292	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
293	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
294	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
295	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
296	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
297	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
298	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
299	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
300	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
301	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
302	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
303	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
304	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
305	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
306	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
307	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
308	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
309	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
310	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
311	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
312	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
313	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.74
Metatranscriptomes	0.21
Isolates	7.05

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0.21
Endosphere	11.32
Nodule	1.5
Rhizoplane	5.98
Rhizosphere	67.74
Stem	0
Stem Tuber	0.43
Unclassified	12.82

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10013118	3300002067	Bacteria	2610
2	JGI25156J39149_1002160	3300002705	Bacteria	7384
3	JGI25151J46595_10002294	3300003187	Bacteria	11705
4	Ga0055535_1000141	3300003761	Bacteria	75603
5	Ga0055529_1000216	3300003763	Bacteria	75603
6	Ga0055526_1003250	3300003771	Bacteria	10463
7	Ga0055537_1000031	3300003773	Bacteria	99208
8	Ga0055534_1000375	3300003784	Bacteria	27985
9	Ga0055528_1000592	3300003790	Bacteria	27293
10	Ga0055531_10000002	3300003794	Bacteria	421971
11	Ga0065715_10208044	3300005293	Bacteria	1328
12	Ga0070658_10214009	3300005327	Bacteria	1628
13	Ga0070676_10010384	3300005328	Bacteria	5052
14	Ga0070676_10248861	3300005328	Bacteria	1185
15	Ga0068869_100002161	3300005334	Bacteria	11821
16	Ga0070666_10087728	3300005335	Bacteria	2133
17	Ga0070680_100129405	3300005336	Bacteria	2111
18	Ga0070660_100198418	3300005339	Bacteria	1627
19	Ga0070669_100024090	3300005353	Bacteria	4363
20	Ga0070673_100043689	3300005364	Bacteria	3464
21	Ga0070667_100016288	3300005367	Bacteria	6148
22	Ga0070667_100444668	3300005367	Bacteria	1184
23	Ga0070678_100203194	3300005456	Bacteria	1637
24	Ga0070678_100490396	3300005456	Bacteria	1083
25	Ga0070662_100234623	3300005457	Bacteria	1469
26	Ga0070681_10015563	3300005458	Bacteria	7575
27	Ga0068867_100010326	3300005459	Bacteria	6588
28	Ga0070707_100085053	3300005468	Bacteria	3056
29	Ga0070679_100140392	3300005530	Bacteria	2396
30	Ga0068853_100185943	3300005539	Bacteria	1886
31	Ga0070672_100096067	3300005543	Bacteria	2397
32	Ga0070696_100414751	3300005546	Bacteria	1056
33	Ga0070665_100008651	3300005548	Bacteria	10304
34	Ga0070665_100099530	3300005548	Bacteria	2912
35	Ga0068855_100070801	3300005563	Bacteria	4056
36	Ga0068855_100206943	3300005563	Bacteria	2207
37	Ga0068857_100004696	3300005577	Bacteria	11578
38	Ga0068859_100072859	3300005617	Bacteria	3472
39	Ga0068864_100002973	3300005618	Bacteria	14013
40	Ga0068870_10015119	3300005840	Bacteria	3655
41	Ga0068870_10256467	3300005840	Bacteria	1086
42	Ga0068863_100028104	3300005841	Bacteria	5369
43	Ga0068858_100013173	3300005842	Bacteria	7794
44	Ga0068858_100280254	3300005842	Bacteria	1587
45	Ga0068860_100042540	3300005843	Bacteria	4337
46	Ga0068862_100017601	3300005844	Bacteria	5951
47	Ga0075365_10086352	3300006038	Bacteria	2132
48	Ga0075363_100019292	3300006048	Bacteria	3408
49	Ga0075364_10036926	3300006051	Bacteria	3161
50	Ga0075364_10337918	3300006051	Bacteria	1026
51	Ga0075364_10382203	3300006051	Bacteria	960
52	Ga0075367_10175128	3300006178	Bacteria	1337
53	Ga0075366_10001317	3300006195	Bacteria	12388
54	Ga0075366_10004061	3300006195	Bacteria	7823
55	Ga0097621_100199570	3300006237	Bacteria	1736
56	Ga0075370_10006221	3300006353	Bacteria	5989
57	Ga0068871_100031100	3300006358	Bacteria	4206
58	Ga0075433_10201610	3300006852	Bacteria	1769
59	Ga0075434_100153396	3300006871	Bacteria	2323
60	Ga0068865_100045252	3300006881	Bacteria	3017
61	Ga0097620_100072851	3300006931	Bacteria	3472
62	Ga0079104_1000389	3300006946	Bacteria	50889
63	Ga0105251_10002733	3300009011	Bacteria	13512
64	Ga0105251_10047497	3300009011	Bacteria	2063
65	Ga0105244_10000279	3300009036	Bacteria	51377
66	Ga0105244_10001228	3300009036	Bacteria	21024
67	Ga0105244_10046176	3300009036	Bacteria	2238
68	Ga0105250_10001707	3300009092	Bacteria	11611
69	Ga0105250_10011151	3300009092	Bacteria	3731
70	Ga0105247_10103412	3300009101	Bacteria	1824
71	Ga0105243_10214742	3300009148	Bacteria	1696
72	Ga0105241_10350490	3300009174	Bacteria	1282
73	Ga0105248_10040006	3300009177	Bacteria	5255
74	Ga0105237_10266995	3300009545	Bacteria	1714
75	Ga0105246_10000616	3300011119	Bacteria	19850
76	Ga0105246_10018705	3300011119	Bacteria	4417
77	Ga0157373_10003111	3300013100	Bacteria	12542
78	Ga0157371_10000700	3300013102	Bacteria	39419
79	Ga0157371_10006254	3300013102	Bacteria	9865
80	Ga0157369_10017975	3300013105	Bacteria	7935
81	Ga0157378_10114861	3300013297	Bacteria	2473
82	Ga0163162_10006213	3300013306	Bacteria	11573
83	Ga0163162_10039332	3300013306	Bacteria	4726
84	Ga0163162_10119983	3300013306	Bacteria	2733
85	Ga0163162_10393343	3300013306	Bacteria	1519
86	Ga0157372_10014510	3300013307	Bacteria	8432
87	Ga0157372_10232753	3300013307	Bacteria	2136
88	Ga0157372_10327351	3300013307	Bacteria	1784
89	Ga0163163_10109248	3300014325	Bacteria	2793
90	Ga0182008_10017582	3300014497	Bacteria	3708
91	Ga0182008_10033322	3300014497	Bacteria	2584
92	Ga0182008_10127967	3300014497	Bacteria	1265
93	Ga0157376_10110107	3300014969	Bacteria	2422
94	Ga0157376_10741174	3300014969	Bacteria	991
95	Ga0182006_1011126	3300015261	Bacteria	3974
96	Ga0182006_1029861	3300015261	Bacteria	2207
97	Ga0182007_10000472	3300015262	Bacteria	24301
98	Ga0182007_10003460	3300015262	Bacteria	7435
99	Ga0182007_10012542	3300015262	Bacteria	3256
100	Ga0163161_10008189	3300017792	Bacteria	7231
101	Ga0163161_10087533	3300017792	Bacteria	2301
102	Ga0163161_10145098	3300017792	Bacteria	1800
103	Ga0209563_106736	3300025230	Bacteria	1950
104	Ga0209437_100115	3300025233	Bacteria	209911
105	Ga0209759_1000130	3300025256	Bacteria	130638
106	Ga0209565_1000087	3300025263	Bacteria	152027
107	Ga0209673_1000145	3300025273	Bacteria	152027
108	Ga0209675_1000085	3300025291	Bacteria	152027
109	Ga0209025_1000183	3300025294	Bacteria	155799
110	Ga0209564_1000097	3300025295	Bacteria	231436
111	Ga0209564_1040245	3300025295	Bacteria	1272
112	Ga0209050_1005098	3300025298	Bacteria	8463
113	Ga0209257_1000049	3300025304	Bacteria	441224
114	Ga0207696_1000035	3300025711	Bacteria	339626
115	Ga0207696_1000520	3300025711	Bacteria	31938
116	Ga0207696_1010147	3300025711	Bacteria	3470
117	Ga0207696_1011480	3300025711	Bacteria	3186
118	Ga0207696_1018493	3300025711	Bacteria	2286
119	Ga0207655_1000690	3300025728	Bacteria	39291
120	Ga0207655_1002042	3300025728	Bacteria	17063
121	Ga0207713_1000001	3300025735	Bacteria	2295391
122	Ga0207682_10051345	3300025893	Bacteria	1708
123	Ga0207710_10079999	3300025900	Bacteria	1515
124	Ga0207680_10115490	3300025903	Bacteria	1748
125	Ga0207647_10178074	3300025904	Bacteria	1236
126	Ga0207645_10032200	3300025907	Bacteria	3370
127	Ga0207643_10043240	3300025908	Bacteria	2542
128	Ga0207705_10055416	3300025909	Bacteria	2858
129	Ga0207684_10511346	3300025910	Bacteria	1029
130	Ga0207707_10036075	3300025912	Bacteria	4324
131	Ga0207657_10099948	3300025919	Bacteria	2409
132	Ga0207652_10165707	3300025921	Bacteria	1981
133	Ga0207646_10049743	3300025922	Bacteria	3753
134	Ga0207681_10019783	3300025923	Bacteria	4260
135	Ga0207681_10072818	3300025923	Bacteria	2401
136	Ga0207650_10010674	3300025925	Bacteria	6309
137	Ga0207706_10020762	3300025933	Bacteria	5901
138	Ga0207691_10121009	3300025940	Bacteria	2320
139	Ga0207711_10030685	3300025941	Bacteria	4534
140	Ga0207711_10109738	3300025941	Bacteria	2452
141	Ga0207689_10004101	3300025942	Bacteria	13247
142	Ga0207661_10364849	3300025944	Bacteria	1305
143	Ga0207661_10479860	3300025944	Bacteria	1135
144	Ga0207668_10032354	3300025972	Bacteria	3455
145	Ga0207658_10010604	3300025986	Bacteria	6263
146	Ga0207658_10165941	3300025986	Bacteria	1814
147	Ga0207677_10040369	3300026023	Bacteria	3076
148	Ga0207703_10001955	3300026035	Bacteria	18206
149	Ga0207641_10321935	3300026088	Bacteria	1466
150	Ga0207648_10005828	3300026089	Bacteria	12337
151	Ga0207676_10018658	3300026095	Bacteria	5049
152	Ga0207674_10019135	3300026116	Bacteria	7423
153	Ga0207675_100003893	3300026118	Bacteria	14510
154	Ga0207683_10108843	3300026121	Bacteria	2480
155	Ga0207683_10148227	3300026121	Bacteria	2117
156	Ga0209281_1000056	3300027111	Bacteria	307619
157	Ga0209281_1000505	3300027111	Bacteria	51792
158	Ga0209371_1000084	3300027312	Bacteria	180842
159	Ga0209371_1001147	3300027312	Bacteria	19396
160	Ga0209282_1000473	3300027666	Bacteria	19597
161	Ga0268266_10266505	3300028379	Bacteria	1589
162	Ga0268265_10079604	3300028380	Bacteria	2581
163	Ga0268264_10019754	3300028381	Bacteria	5503
164	Ga0268264_10221236	3300028381	Bacteria	1743
165	Ga0265338_10000644	3300028800	Bacteria	60398
166	Ga0265324_10000120	3300029957	Bacteria	61840
167	Ga0268256_1000075	3300030500	Bacteria	180814
168	Ga0268256_1000980	3300030500	Bacteria	19396
169	Ga0307512_10086673	3300030522	Bacteria	2211
170	Ga0316182_1192396	3300030745	Bacteria	2270
171	Ga0265332_10112991	3300031238	Bacteria	1143
172	Ga0265328_10038396	3300031239	Bacteria	1767
173	Ga0265328_10041761	3300031239	Bacteria	1688
174	Ga0265325_10005590	3300031241	Bacteria	7752
175	Ga0265331_10040758	3300031250	Bacteria	2258
176	Ga0265327_10000028	3300031251	Bacteria	361066
177	Ga0265327_10000674	3300031251	Bacteria	54882
178	Ga0307509_10000033	3300031507	Bacteria	194363
179	Ga0307509_10001286	3300031507	Bacteria	42598
180	Ga0307509_10135469	3300031507	Bacteria	2409
181	Ga0307508_10018231	3300031616	Bacteria	6380
182	Ga0307514_10100190	3300031649	Bacteria	2083
183	Ga0265314_10000371	3300031711	Bacteria	61424
184	Ga0307516_10003466	3300031730	Bacteria	20215
185	Ga0307516_10258201	3300031730	Bacteria	1434
186	Ga0307413_10225995	3300031824	Bacteria	1371
187	Ga0307411_10026004	3300032005	Bacteria	3516
188	Ga0307411_10100173	3300032005	Bacteria	2047
189	Ga0316593_10104831	3300032168	Bacteria	1006
190	Ga0307510_10001739	3300033180	Bacteria	24244
191	Ga0307510_10002924	3300033180	Bacteria	19645
192	Ga0307510_10022524	3300033180	Bacteria	7316
193	Ga0373926_0092745	3300035083	Bacteria	1124
194	Ga0373934_0012346	3300035086	Bacteria	3225
195	Ga0373923_0025834	3300035111	Bacteria	2331
196	Ga0373953_0017135	3300035117	Bacteria	2657
197	Ga0373956_0025993	3300035119	Bacteria	2533
198	Ga0373955_0004202	3300035172	Bacteria	6354
199	Ga0373935_0034833	3300035692	Bacteria	3140
200	Ga0373935_0067769	3300035692	Bacteria	2295
201	Ga0373935_0168266	3300035692	Bacteria	1498
202	Ga0373937_0317640	3300036401	Bacteria	1473
203	Ga0373925_0016119	3300037068	Bacteria	5412
204	Ga0373925_0212539	3300037068	Bacteria	1541
205	Ga0395900_0113810	3300037418	Bacteria	2777
206	Ga0439438_000002	3300041405	Bacteria	618223
207	Ga0439447_000998	3300041407	Bacteria	10345
208	Ga0439447_014020	3300041407	Bacteria	2258
209	Ga0439466_0000716	3300041411	Bacteria	12537
210	Ga0451791_1854024	3300041451	Bacteria	1219
211	Ga0451807_0686438	3300041486	Bacteria	1901
212	Ga0439432_058154	3300042006	Bacteria	1195
213	Ga0450905_005700	3300042142	Bacteria	1672
214	Ga0450907_000093	3300042146	Bacteria	34548
215	Ga0450918_000189	3300042531	Bacteria	13732
216	Ga0451577_0021645	3300042876	Bacteria	5880
217	Ga0451577_0048597	3300042876	Bacteria	3789
218	Ga0453684_0011402	3300044712	Bacteria	14916
219	Ga0453684_0167140	3300044712	Bacteria	2596
220	Ga0451576_0077620	3300045051	Bacteria	3456
221	Ga0451576_0370572	3300045051	Bacteria	1500
222	Ga0495591_000292	3300046458	Bacteria	46136
223	Ga0495591_071224	3300046458	Bacteria	902
224	Ga0495629_0000031	3300046459	Bacteria	124543
225	Ga0495638_0044441	3300046460	Bacteria	2798
226	Ga0495641_0032775	3300046461	Bacteria	2470
227	Ga0495651_0057435	3300046462	Bacteria	2987
228	Ga0495653_0000258	3300046463	Bacteria	42640
229	Ga0495653_0042755	3300046463	Bacteria	3526
230	Ga0495650_0009482	3300046471	Bacteria	5528
231	Ga0495580_0000021	3300046472	Bacteria	90091
232	Ga0495580_0093635	3300046472	Bacteria	2090
233	Ga0495582_0011722	3300046473	Bacteria	4831
234	Ga0495605_0001421	3300046474	Bacteria	15693
235	Ga0495639_0027850	3300046475	Bacteria	2502
236	Ga0495639_0059402	3300046475	Bacteria	1750
237	Ga0495664_0279698	3300046477	Bacteria	1008
238	Ga0495596_0001615	3300046500	Bacteria	12824
239	Ga0495596_0044022	3300046500	Bacteria	1758
240	Ga0495583_0000073	3300046506	Bacteria	178177
241	Ga0495583_0002257	3300046506	Bacteria	16936
242	Ga0495606_0001890	3300046507	Bacteria	26204
243	Ga0495618_0024501	3300046514	Bacteria	3738
244	Ga0495620_0027038	3300046515	Bacteria	2690
245	Ga0495628_0001230	3300046516	Bacteria	23436
246	Ga0495628_0095170	3300046516	Bacteria	2301
247	Ga0495628_0186645	3300046516	Bacteria	1567
248	Ga0495630_0000680	3300046517	Bacteria	24316
249	Ga0495630_0007120	3300046517	Bacteria	7970
250	Ga0495630_0018596	3300046517	Bacteria	5106
251	Ga0495630_0338256	3300046517	Bacteria	1151
252	Ga0495632_0111122	3300046519	Bacteria	1287
253	Ga0495648_0020879	3300046524	Bacteria	4554
254	Ga0495648_0043570	3300046524	Bacteria	2811
255	Ga0495652_0076266	3300046529	Bacteria	2781
256	Ga0495654_0000033	3300046530	Bacteria	201799
257	Ga0495640_0036055	3300046533	Bacteria	3496
258	Ga0495587_0006299	3300046536	Bacteria	7742
259	Ga0495597_0000925	3300046542	Bacteria	22776
260	Ga0495645_0034984	3300046543	Bacteria	3663
261	Ga0495667_0087268	3300046559	Bacteria	2023
262	Ga0495668_0050261	3300046616	Bacteria	2311
263	Ga0495625_0002940	3300046660	Bacteria	17768
264	Ga0495625_0048100	3300046660	Bacteria	3073
265	Ga0495625_0051573	3300046660	Bacteria	2949
266	Ga0495625_0066190	3300046660	Bacteria	2546
267	Ga0495625_0086863	3300046660	Bacteria	2169
268	Ga0495635_0158131	3300046663	Bacteria	1542
269	Ga0495588_0004578	3300046674	Bacteria	6114
270	Ga0495588_0004876	3300046674	Bacteria	5946
271	Ga0495657_0073718	3300046675	Bacteria	2222
272	Ga0495657_0126491	3300046675	Bacteria	1605
273	Ga0495599_0027243	3300046678	Bacteria	3582
274	Ga0495599_0052845	3300046678	Bacteria	2545
275	Ga0495623_0000487	3300046679	Bacteria	26261
276	Ga0495646_0004741	3300046680	Bacteria	8581
277	Ga0495646_0059688	3300046680	Bacteria	2277
278	Ga0495647_0042326	3300046681	Bacteria	1738
279	Ga0495658_0043304	3300046683	Bacteria	2517
280	Ga0495624_0003308	3300046690	Bacteria	12004
281	Ga0495624_0055435	3300046690	Bacteria	2496
282	Ga0495671_0047938	3300046692	Bacteria	2132
283	Ga0495649_0000063	3300046694	Bacteria	96509
284	Ga0495589_0004785	3300046794	Bacteria	7197
285	Ga0495660_0020725	3300046810	Bacteria	3768
286	Ga0495604_0000510	3300047317	Bacteria	34058
287	Ga0495604_0021071	3300047317	Bacteria	5201
288	Ga0495672_0000052	3300047320	Bacteria	236266
289	Ga0495672_0000145	3300047320	Bacteria	104177
290	Ga0495672_0039192	3300047320	Bacteria	2882
291	Ga0495676_0099861	3300047321	Bacteria	2150
292	Ga0495680_0008458	3300047322	Bacteria	9348
293	Ga0495680_0050913	3300047322	Bacteria	3236
294	Ga0495680_0405592	3300047322	Bacteria	940
295	Ga0495687_011876	3300047443	Bacteria	4650
296	Ga0495675_0001645	3300047444	Bacteria	13386
297	Ga0495675_0061673	3300047444	Bacteria	2375
298	Ga0495679_000006	3300047446	Bacteria	449956
299	Ga0495679_000090	3300047446	Bacteria	82693
300	Ga0495679_007765	3300047446	Bacteria	4432
301	Ga0495681_0043701	3300047470	Bacteria	2159
302	Ga0495684_0122052	3300047471	Bacteria	1961
303	Ga0495686_0011531	3300047472	Bacteria	6225
304	Ga0495593_0018502	3300047673	Bacteria	3913
305	Ga0495602_0039202	3300048088	Bacteria	4366
306	Ga0495614_0014885	3300048089	Bacteria	3398
307	Ga0496100_0006231	3300048903	Bacteria	6491
308	Ga0496101_0000179	3300048904	Bacteria	50944
309	Ga0496101_0004211	3300048904	Bacteria	9010
310	Ga0496102_0001598	3300048905	Bacteria	19981
311	Ga0496102_0003488	3300048905	Bacteria	13333
312	Ga0496102_0065657	3300048905	Bacteria	3327
313	Ga0496102_0389326	3300048905	Bacteria	1311
314	Ga0496103_0022206	3300048906	Bacteria	3820
315	Ga0496104_0003715	3300048907	Bacteria	13172
316	Ga0496104_0228401	3300048907	Bacteria	1773
317	Ga0496105_0001984	3300048908	Bacteria	14736
318	Ga0496105_0005314	3300048908	Bacteria	9764
319	Ga0496106_0092690	3300048909	Bacteria	2334
320	Ga0496106_0188449	3300048909	Bacteria	1639
321	Ga0496107_0064835	3300048910	Bacteria	2648
322	Ga0496108_0732482	3300048911	Bacteria	856
323	Ga0496109_0231656	3300048912	Bacteria	1738
324	Ga0496110_0005903	3300048913	Bacteria	9638
325	Ga0496110_0032183	3300048913	Bacteria	4528
326	Ga0496111_0007504	3300048914	Bacteria	7155
327	Ga0496111_0259163	3300048914	Bacteria	1290
328	Ga0496114_0011224	3300048917	Bacteria	7153
329	Ga0496114_0108893	3300048917	Bacteria	2372
330	Ga0496115_0376137	3300048918	Bacteria	1156
331	Ga0496117_0000073	3300048920	Bacteria	236223
332	Ga0496117_0000634	3300048920	Bacteria	56540
333	Ga0496117_0001777	3300048920	Bacteria	29533
334	Ga0496117_0015345	3300048920	Bacteria	6535
335	Ga0496117_0029893	3300048920	Bacteria	4191
336	Ga0496117_0076556	3300048920	Bacteria	2218
337	Ga0496118_0000094	3300048921	Bacteria	166019
338	Ga0496118_0000655	3300048921	Bacteria	56563
339	Ga0496118_0005177	3300048921	Bacteria	14937
340	Ga0496118_0184030	3300048921	Bacteria	1258
341	Ga0496119_0000073	3300048922	Bacteria	151806
342	Ga0496119_0000212	3300048922	Bacteria	83042
343	Ga0496119_0036310	3300048922	Bacteria	3218
344	Ga0496119_0103236	3300048922	Bacteria	1597
345	Ga0496120_0000088	3300048923	Bacteria	151806
346	Ga0496120_0008481	3300048923	Bacteria	7455
347	Ga0496120_0015976	3300048923	Bacteria	4924
348	Ga0496121_0000386	3300048924	Bacteria	89849
349	Ga0496121_0001508	3300048924	Bacteria	39115
350	Ga0496121_0018385	3300048924	Bacteria	7050
351	Ga0496122_0001276	3300048925	Bacteria	41892
352	Ga0496122_0010193	3300048925	Bacteria	9738
353	Ga0496123_0000272	3300048926	Bacteria	102825
354	Ga0496123_0001696	3300048926	Bacteria	29467
355	Ga0496124_0002753	3300048927	Bacteria	22417
356	Ga0496124_0003215	3300048927	Bacteria	20181
357	Ga0496124_0003844	3300048927	Bacteria	17979
358	Ga0496124_0014996	3300048927	Bacteria	7460
359	Ga0496124_0143782	3300048927	Bacteria	1879
360	Ga0496125_0007919	3300048928	Bacteria	11218
361	Ga0496125_0099651	3300048928	Bacteria	2145
362	Ga0496125_0301333	3300048928	Bacteria	982
363	Ga0496126_0000102	3300048929	Bacteria	201540
364	Ga0496126_0049759	3300048929	Bacteria	3824
365	Ga0501031_0001637	3300049568	Bacteria	14037
366	Ga0501031_0059117	3300049568	Bacteria	2498
367	Ga0501032_0000428	3300049569	Bacteria	34835
368	Ga0501032_0009108	3300049569	Bacteria	7205
369	Ga0501032_0010546	3300049569	Bacteria	6662
370	Ga0501033_0000063	3300049570	Bacteria	101552
371	Ga0501033_0014997	3300049570	Bacteria	5881
372	Ga0501033_0019239	3300049570	Bacteria	5162
373	Ga0501034_0003115	3300049571	Bacteria	19099
374	Ga0501036_0001062	3300049572	Bacteria	20775
375	Ga0501036_0027595	3300049572	Bacteria	4798
376	Ga0501037_0011421	3300049573	Bacteria	6534
377	Ga0501037_0046521	3300049573	Bacteria	3182
378	Ga0501037_0083283	3300049573	Bacteria	2317
379	Ga0501037_0121433	3300049573	Bacteria	1878
380	Ga0501037_0288997	3300049573	Bacteria	1141
381	Ga0501038_0001382	3300049574	Bacteria	22174
382	Ga0501038_0006966	3300049574	Bacteria	10439
383	Ga0501038_0007008	3300049574	Bacteria	10410
384	Ga0501038_0013773	3300049574	Bacteria	7370
385	Ga0501039_0005747	3300049575	Bacteria	9390
386	Ga0501039_0067466	3300049575	Bacteria	2778
387	Ga0501039_0087742	3300049575	Bacteria	2423
388	Ga0501040_0002732	3300049576	Bacteria	11366
389	Ga0501042_0006805	3300049578	Bacteria	7454
390	Ga0501043_0013041	3300049579	Bacteria	6496
391	Ga0501043_0013118	3300049579	Bacteria	6478
392	Ga0501043_0013530	3300049579	Bacteria	6385
393	Ga0501043_0029199	3300049579	Bacteria	4330
394	Ga0501046_0014930	3300049580	Bacteria	6535
395	Ga0501046_0098550	3300049580	Bacteria	2244
396	Ga0501047_0073515	3300049581	Bacteria	3291
397	Ga0501047_0092267	3300049581	Bacteria	2907
398	Ga0501048_0013857	3300049582	Bacteria	5979
399	Ga0501068_0011376	3300049584	Bacteria	5023
400	Ga0501222_000098	3300049662	Bacteria	22783
401	Ga0501035_0000465	3300049822	Bacteria	45334
402	Ga0501035_0073150	3300049822	Bacteria	3032
403	Ga0501035_0086619	3300049822	Bacteria	2760
404	Ga0501044_0000093	3300049823	Bacteria	109832
405	Ga0501044_0006063	3300049823	Bacteria	13333
406	Ga0501044_0019872	3300049823	Bacteria	7175
407	Ga0501045_0000473	3300049824	Bacteria	24955
408	nmdc:mga03683_21053_c1	3300050489	Bacteria	2509
409	nmdc:mga03n38_116530_c1	3300050490	Bacteria	1308
410	nmdc:mga03n38_27254_c1	3300050490	Bacteria	2368
411	nmdc:mga00v17_15701_c1	3300050491	Bacteria	4254
412	nmdc:mga00v17_326699_c1	3300050491	Bacteria	997
413	nmdc:mga0k408_15944_c1	3300050493	Bacteria	4162
414	nmdc:mga0k408_35_c3	3300050493	Bacteria	5616
415	nmdc:mga06z11_115037_c1	3300050494	Bacteria	1494
416	nmdc:mga07m45_8410_c1	3300050496	Bacteria	2403
417	nmdc:mga0a205_567847_c1	3300050515	Bacteria	989
418	Ga0495619_0092511	3300053085	Bacteria	2048
419	Ga0500644_0002823	3300053088	Bacteria	4325
420	Ga0500651_0014700	3300053093	Bacteria	4793
421	Ga0500562_047097	3300053108	Bacteria	1150
422	Ga0500594_0004065	3300053118	Bacteria	3222
423	Ga0500594_0033739	3300053118	Bacteria	1363
424	Ga0500608_052564	3300053122	Bacteria	1956
425	Ga0500608_054140	3300053122	Bacteria	1925
426	Ga0500608_105276	3300053122	Bacteria	1301
427	Ga0500559_0000134	3300053136	Bacteria	56963
428	Ga0500559_0006876	3300053136	Bacteria	5094
429	Ga0500559_0132551	3300053136	Bacteria	1164
430	Ga0500568_0023102	3300053139	Bacteria	2648
431	Ga0500573_0017985	3300053140	Bacteria	4027
432	Ga0500622_0006815	3300053156	Bacteria	6570
433	Ga0500622_0058796	3300053156	Bacteria	1964
434	Ga0500636_0016097	3300053177	Bacteria	4407
435	Ga0500587_000870	3300053739	Bacteria	4002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048928	Ga0496125_0301333	Ga0496125_0301333_212_967	251
2	3300048911	Ga0496108_0732482	Ga0496108_0732482_33_809	258
3	3300049579	Ga0501043_0013530	Ga0501043_0013530_1742_2518	258
4	3300053156	Ga0500622_0058796	Ga0500622_0058796_1173_1949	258
5	3300031239	Ga0265328_10038396	Ga0265328_100383962	259
6	3300031251	Ga0265327_10000674	Ga0265327_1000067428	259
7	3300036401	Ga0373937_0317640	Ga0373937_0317640_674_1462	262
8	3300046663	Ga0495635_0158131	Ga0495635_0158131_744_1532	262
9	3300046675	Ga0495657_0073718	Ga0495657_0073718_970_1827	264
10	3300009545	Ga0105237_10266995	Ga0105237_102669952	268
11	3300042142	Ga0450905_005700	Ga0450905_005700_178_1023	269
12	3300035086	Ga0373934_0012346	Ga0373934_0012346_359_1174	271
13	3300037068	Ga0373925_0212539	Ga0373925_0212539_398_1219	273
14	3300046500	Ga0495596_0001615	Ga0495596_0001615_6410_7264	275
15	3300053140	Ga0500573_0017985	Ga0500573_0017985_1251_2078	275
16	iso_pu_bacteria	2831864461	2831866911	275
17	3300005840	Ga0068870_10256467	Ga0068870_102564671	276
18	3300006195	Ga0075366_10001317	Ga0075366_100013176	276
19	3300046660	Ga0495625_0066190	Ga0495625_0066190_986_1819	276
20	3300050493	nmdc:mga0k408_35_c3	nmdc:mga0k408_35_c3_4681_5511	276
21	iso_pu_bacteria	2842747753	2842752329	277
22	iso_pu_bacteria	2643221654	2644305827	278
23	iso_pu_bacteria	2939631187	2939633332	278
24	3300003771	Ga0055526_1003250	Ga0055526_10032502	279
25	3300025295	Ga0209564_1000097	Ga0209564_1000097181	279
26	3300025933	Ga0207706_10020762	Ga0207706_100207624	279
27	3300028381	Ga0268264_10221236	Ga0268264_102212362	279
28	3300044712	Ga0453684_0167140	Ga0453684_0167140_256_1095	279
29	3300045051	Ga0451576_0370572	Ga0451576_0370572_55_894	279
30	iso_pu_bacteria	2945945610	2945948476	279
31	3300005327	Ga0070658_10214009	Ga0070658_102140091	280
32	3300005339	Ga0070660_100198418	Ga0070660_1001984182	280
33	3300005468	Ga0070707_100085053	Ga0070707_1000850533	280
34	3300006871	Ga0075434_100153396	Ga0075434_1001533963	280
35	3300013307	Ga0157372_10232753	Ga0157372_102327533	280
36	3300025230	Ga0209563_106736	Ga0209563_1067362	280
37	3300025909	Ga0207705_10055416	Ga0207705_100554161	280
38	3300025910	Ga0207684_10511346	Ga0207684_105113461	280
39	3300025912	Ga0207707_10036075	Ga0207707_100360752	280
40	3300025919	Ga0207657_10099948	Ga0207657_100999482	280
41	3300025922	Ga0207646_10049743	Ga0207646_100497434	280
42	3300031507	Ga0307509_10000033	Ga0307509_10000033105	280
43	iso_pu_bacteria	2511231035	2511433411	280
44	iso_pu_bacteria	2537561728	2538425596	280
45	iso_pu_bacteria	2608642108	2608670314	280
46	iso_pu_bacteria	2844528606	2844529406	280
47	iso_pu_bacteria	2855195626	2855199971	280
48	iso_pu_bacteria	2865014394	2865017217	280
49	iso_pu_bacteria	2871282230	2871286003	280
50	iso_pu_bacteria	2876601092	2876603007	280
51	iso_pu_bacteria	2904541872	2904543835	280
52	iso_pu_bacteria	2919704043	2919705101	280
53	iso_pu_bacteria	2929160207	2929162607	280
54	iso_pu_bacteria	2945951305	2945951863	280
55	iso_pu_bacteria	2978975091	2978978396	280
56	3300003761	Ga0055535_1000141	Ga0055535_100014147	281
57	3300003763	Ga0055529_1000216	Ga0055529_100021628	281
58	3300003794	Ga0055531_10000002	Ga0055531_1000000265	281
59	3300005456	Ga0070678_100203194	Ga0070678_1002031941	281
60	3300005546	Ga0070696_100414751	Ga0070696_1004147512	281
61	3300006237	Ga0097621_100199570	Ga0097621_1001995703	281
62	3300013306	Ga0163162_10039332	Ga0163162_100393326	281
63	3300014497	Ga0182008_10017582	Ga0182008_100175825	281
64	3300014497	Ga0182008_10033322	Ga0182008_100333223	281
65	3300014969	Ga0157376_10741174	Ga0157376_107411741	281
66	3300015261	Ga0182006_1029861	Ga0182006_10298614	281
67	3300015262	Ga0182007_10000472	Ga0182007_100004728	281
68	3300017792	Ga0163161_10008189	Ga0163161_100081894	281
69	3300017792	Ga0163161_10145098	Ga0163161_101450982	281
70	3300025298	Ga0209050_1005098	Ga0209050_10050984	281
71	3300025304	Ga0209257_1000049	Ga0209257_1000049102	281
72	3300025893	Ga0207682_10051345	Ga0207682_100513451	281
73	3300025923	Ga0207681_10019783	Ga0207681_100197835	281
74	3300025944	Ga0207661_10364849	Ga0207661_103648491	281
75	3300026121	Ga0207683_10148227	Ga0207683_101482272	281
76	3300028379	Ga0268266_10266505	Ga0268266_102665052	281
77	3300031239	Ga0265328_10041761	Ga0265328_100417612	281
78	3300031250	Ga0265331_10040758	Ga0265331_100407582	281
79	3300031251	Ga0265327_10000028	Ga0265327_1000002821	281
80	3300031730	Ga0307516_10258201	Ga0307516_102582012	281
81	3300032005	Ga0307411_10100173	Ga0307411_101001733	281
82	3300035692	Ga0373935_0168266	Ga0373935_0168266_617_1462	281
83	3300046475	Ga0495639_0059402	Ga0495639_0059402_718_1563	281
84	3300046506	Ga0495583_0000073	Ga0495583_0000073_46484_47329	281
85	3300046507	Ga0495606_0001890	Ga0495606_0001890_14313_15158	281
86	3300046516	Ga0495628_0186645	Ga0495628_0186645_170_1015	281
87	3300046660	Ga0495625_0048100	Ga0495625_0048100_988_1833	281
88	3300046674	Ga0495588_0004578	Ga0495588_0004578_3624_4469	281
89	3300046675	Ga0495657_0126491	Ga0495657_0126491_492_1337	281
90	3300046694	Ga0495649_0000063	Ga0495649_0000063_34362_35207	281
91	3300046794	Ga0495589_0004785	Ga0495589_0004785_3586_4431	281
92	3300048903	Ga0496100_0006231	Ga0496100_0006231_4970_5815	281
93	3300048904	Ga0496101_0004211	Ga0496101_0004211_1004_1849	281
94	3300048905	Ga0496102_0003488	Ga0496102_0003488_5254_6099	281
95	3300048906	Ga0496103_0022206	Ga0496103_0022206_57_902	281
96	3300048907	Ga0496104_0003715	Ga0496104_0003715_11547_12392	281
97	3300048908	Ga0496105_0001984	Ga0496105_0001984_7258_8103	281
98	3300048909	Ga0496106_0092690	Ga0496106_0092690_682_1527	281
99	3300048910	Ga0496107_0064835	Ga0496107_0064835_764_1609	281
100	3300048913	Ga0496110_0005903	Ga0496110_0005903_1620_2465	281
101	3300048913	Ga0496110_0032183	Ga0496110_0032183_2895_3740	281
102	3300048914	Ga0496111_0007504	Ga0496111_0007504_3413_4258	281
103	3300048914	Ga0496111_0259163	Ga0496111_0259163_261_1106	281
104	3300048917	Ga0496114_0011224	Ga0496114_0011224_1212_2057	281
105	3300048917	Ga0496114_0108893	Ga0496114_0108893_538_1383	281
106	3300048918	Ga0496115_0376137	Ga0496115_0376137_39_884	281
107	3300048925	Ga0496122_0001276	Ga0496122_0001276_26213_27094	281
108	3300048926	Ga0496123_0000272	Ga0496123_0000272_36492_37373	281
109	3300049568	Ga0501031_0001637	Ga0501031_0001637_10630_11475	281
110	3300049568	Ga0501031_0059117	Ga0501031_0059117_817_1761	281
111	3300049569	Ga0501032_0000428	Ga0501032_0000428_7783_8727	281
112	3300049569	Ga0501032_0009108	Ga0501032_0009108_2329_3174	281
113	3300049570	Ga0501033_0000063	Ga0501033_0000063_65590_66435	281
114	3300049570	Ga0501033_0014997	Ga0501033_0014997_4327_5271	281
115	3300049570	Ga0501033_0019239	Ga0501033_0019239_1657_2502	281
116	3300049571	Ga0501034_0003115	Ga0501034_0003115_5658_6602	281
117	3300049572	Ga0501036_0001062	Ga0501036_0001062_12298_13242	281
118	3300049572	Ga0501036_0027595	Ga0501036_0027595_1770_2615	281
119	3300049573	Ga0501037_0011421	Ga0501037_0011421_5072_6016	281
120	3300049573	Ga0501037_0046521	Ga0501037_0046521_1087_1932	281
121	3300049573	Ga0501037_0083283	Ga0501037_0083283_139_984	281
122	3300049573	Ga0501037_0121433	Ga0501037_0121433_792_1736	281
123	3300049574	Ga0501038_0001382	Ga0501038_0001382_8301_9245	281
124	3300049574	Ga0501038_0006966	Ga0501038_0006966_4818_5663	281
125	3300049574	Ga0501038_0007008	Ga0501038_0007008_2549_3394	281
126	3300049575	Ga0501039_0005747	Ga0501039_0005747_4591_5436	281
127	3300049575	Ga0501039_0067466	Ga0501039_0067466_989_1834	281
128	3300049576	Ga0501040_0002732	Ga0501040_0002732_4032_4976	281
129	3300049578	Ga0501042_0006805	Ga0501042_0006805_4234_5178	281
130	3300049579	Ga0501043_0013041	Ga0501043_0013041_4736_5680	281
131	3300049579	Ga0501043_0013118	Ga0501043_0013118_816_1760	281
132	3300049579	Ga0501043_0029199	Ga0501043_0029199_573_1418	281
133	3300049580	Ga0501046_0014930	Ga0501046_0014930_2225_3169	281
134	3300049580	Ga0501046_0098550	Ga0501046_0098550_145_990	281
135	3300049581	Ga0501047_0073515	Ga0501047_0073515_368_1312	281
136	3300049581	Ga0501047_0092267	Ga0501047_0092267_1208_2053	281
137	3300049582	Ga0501048_0013857	Ga0501048_0013857_3113_4057	281
138	3300049584	Ga0501068_0011376	Ga0501068_0011376_3488_4432	281
139	3300049822	Ga0501035_0000465	Ga0501035_0000465_12754_13599	281
140	3300049822	Ga0501035_0073150	Ga0501035_0073150_1923_2867	281
141	3300049823	Ga0501044_0000093	Ga0501044_0000093_10313_11158	281
142	3300049823	Ga0501044_0006063	Ga0501044_0006063_12224_13168	281
143	3300049823	Ga0501044_0019872	Ga0501044_0019872_5185_6030	281
144	3300049824	Ga0501045_0000473	Ga0501045_0000473_12802_13746	281
145	3300050489	nmdc:mga03683_21053_c1	nmdc:mga03683_21053_c1_1194_2039	281
146	3300050490	nmdc:mga03n38_27254_c1	nmdc:mga03n38_27254_c1_893_1738	281
147	3300050496	nmdc:mga07m45_8410_c1	nmdc:mga07m45_8410_c1_899_1744	281
148	3300053118	Ga0500594_0033739	Ga0500594_0033739_336_1181	281
149	3300053122	Ga0500608_052564	Ga0500608_052564_681_1526	281
150	3300053122	Ga0500608_105276	Ga0500608_105276_208_1053	281
151	3300053136	Ga0500559_0006876	Ga0500559_0006876_2278_3123	281
152	3300053136	Ga0500559_0132551	Ga0500559_0132551_150_995	281
153	3300053177	Ga0500636_0016097	Ga0500636_0016097_710_1555	281
154	iso_pu_bacteria	2818991450	2819620507	281
155	iso_pu_bacteria	2842348783	2842357007	281
156	iso_pu_bacteria	2842454564	2842460785	281
157	iso_pu_bacteria	2847085930	2847086170	281
158	iso_pu_bacteria	2891670763	2891673524	281
159	iso_pu_bacteria	2900634093	2900640417	281
160	iso_pu_bacteria	2928108538	2928108891	281
161	iso_pu_bacteria	2928135762	2928136115	281
162	iso_pu_bacteria	2928503688	2928504104	281
163	iso_pu_bacteria	642555113	642616945	281
164	iso_pu_bacteria	8054849141	8054851276	281
165	3300005293	Ga0065715_10208044	Ga0065715_102080441	282
166	3300005328	Ga0070676_10010384	Ga0070676_100103844	282
167	3300005328	Ga0070676_10248861	Ga0070676_102488611	282
168	3300005334	Ga0068869_100002161	Ga0068869_1000021619	282
169	3300005335	Ga0070666_10087728	Ga0070666_100877282	282
170	3300005336	Ga0070680_100129405	Ga0070680_1001294052	282
171	3300005353	Ga0070669_100024090	Ga0070669_1000240902	282
172	3300005364	Ga0070673_100043689	Ga0070673_1000436892	282
173	3300005367	Ga0070667_100016288	Ga0070667_1000162882	282
174	3300005367	Ga0070667_100444668	Ga0070667_1004446681	282
175	3300005456	Ga0070678_100490396	Ga0070678_1004903961	282
176	3300005457	Ga0070662_100234623	Ga0070662_1002346232	282
177	3300005458	Ga0070681_10015563	Ga0070681_100155633	282
178	3300005459	Ga0068867_100010326	Ga0068867_1000103264	282
179	3300005530	Ga0070679_100140392	Ga0070679_1001403922	282
180	3300005539	Ga0068853_100185943	Ga0068853_1001859432	282
181	3300005543	Ga0070672_100096067	Ga0070672_1000960672	282
182	3300005548	Ga0070665_100008651	Ga0070665_1000086514	282
183	3300005548	Ga0070665_100099530	Ga0070665_1000995304	282
184	3300005563	Ga0068855_100070801	Ga0068855_1000708012	282
185	3300005563	Ga0068855_100206943	Ga0068855_1002069433	282
186	3300005577	Ga0068857_100004696	Ga0068857_1000046965	282
187	3300005617	Ga0068859_100072859	Ga0068859_1000728592	282
188	3300005618	Ga0068864_100002973	Ga0068864_10000297312	282
189	3300005840	Ga0068870_10015119	Ga0068870_100151192	282
190	3300005841	Ga0068863_100028104	Ga0068863_1000281045	282
191	3300005842	Ga0068858_100013173	Ga0068858_1000131737	282
192	3300005843	Ga0068860_100042540	Ga0068860_1000425403	282
193	3300005844	Ga0068862_100017601	Ga0068862_1000176012	282
194	3300006048	Ga0075363_100019292	Ga0075363_1000192922	282
195	3300006178	Ga0075367_10175128	Ga0075367_101751282	282
196	3300006195	Ga0075366_10004061	Ga0075366_100040612	282
197	3300006353	Ga0075370_10006221	Ga0075370_100062214	282
198	3300006358	Ga0068871_100031100	Ga0068871_1000311003	282
199	3300006852	Ga0075433_10201610	Ga0075433_102016102	282
200	3300006881	Ga0068865_100045252	Ga0068865_1000452522	282
201	3300006931	Ga0097620_100072851	Ga0097620_1000728512	282
202	3300009101	Ga0105247_10103412	Ga0105247_101034122	282
203	3300009148	Ga0105243_10214742	Ga0105243_102147422	282
204	3300009174	Ga0105241_10350490	Ga0105241_103504902	282
205	3300009177	Ga0105248_10040006	Ga0105248_100400064	282
206	3300013297	Ga0157378_10114861	Ga0157378_101148612	282
207	3300013306	Ga0163162_10393343	Ga0163162_103933432	282
208	3300014325	Ga0163163_10109248	Ga0163163_101092483	282
209	3300014969	Ga0157376_10110107	Ga0157376_101101073	282
210	3300025900	Ga0207710_10079999	Ga0207710_100799992	282
211	3300025903	Ga0207680_10115490	Ga0207680_101154902	282
212	3300025907	Ga0207645_10032200	Ga0207645_100322002	282
213	3300025908	Ga0207643_10043240	Ga0207643_100432402	282
214	3300025921	Ga0207652_10165707	Ga0207652_101657072	282
215	3300025923	Ga0207681_10072818	Ga0207681_100728182	282
216	3300025925	Ga0207650_10010674	Ga0207650_100106747	282
217	3300025940	Ga0207691_10121009	Ga0207691_101210092	282
218	3300025941	Ga0207711_10030685	Ga0207711_100306854	282
219	3300025941	Ga0207711_10109738	Ga0207711_101097382	282
220	3300025942	Ga0207689_10004101	Ga0207689_100041015	282
221	3300025944	Ga0207661_10479860	Ga0207661_104798602	282
222	3300025972	Ga0207668_10032354	Ga0207668_100323545	282
223	3300025986	Ga0207658_10010604	Ga0207658_100106042	282
224	3300025986	Ga0207658_10165941	Ga0207658_101659412	282
225	3300026023	Ga0207677_10040369	Ga0207677_100403694	282
226	3300026035	Ga0207703_10001955	Ga0207703_100019557	282
227	3300026088	Ga0207641_10321935	Ga0207641_103219351	282
228	3300026089	Ga0207648_10005828	Ga0207648_100058284	282
229	3300026095	Ga0207676_10018658	Ga0207676_100186583	282
230	3300026116	Ga0207674_10019135	Ga0207674_100191355	282
231	3300026118	Ga0207675_100003893	Ga0207675_10000389312	282
232	3300026121	Ga0207683_10108843	Ga0207683_101088431	282
233	3300028380	Ga0268265_10079604	Ga0268265_100796043	282
234	3300028381	Ga0268264_10019754	Ga0268264_100197545	282
235	3300030522	Ga0307512_10086673	Ga0307512_100866733	282
236	3300031507	Ga0307509_10001286	Ga0307509_1000128617	282
237	3300031507	Ga0307509_10135469	Ga0307509_101354692	282
238	3300031616	Ga0307508_10018231	Ga0307508_100182314	282
239	3300031649	Ga0307514_10100190	Ga0307514_101001902	282
240	3300031730	Ga0307516_10003466	Ga0307516_100034666	282
241	3300033180	Ga0307510_10001739	Ga0307510_100017399	282
242	3300033180	Ga0307510_10002924	Ga0307510_1000292417	282
243	3300033180	Ga0307510_10022524	Ga0307510_100225248	282
244	3300041451	Ga0451791_1854024	Ga0451791_1854024_310_1170	282
245	3300042876	Ga0451577_0021645	Ga0451577_0021645_3008_3856	282
246	3300046519	Ga0495632_0111122	Ga0495632_0111122_161_1009	282
247	3300046660	Ga0495625_0086863	Ga0495625_0086863_596_1444	282
248	3300048905	Ga0496102_0065657	Ga0496102_0065657_1188_2036	282
249	3300048909	Ga0496106_0188449	Ga0496106_0188449_181_1029	282
250	3300049662	Ga0501222_000098	Ga0501222_000098_20164_21012	282
251	3300050490	nmdc:mga03n38_116530_c1	nmdc:mga03n38_116530_c1_62_910	282
252	3300050493	nmdc:mga0k408_15944_c1	nmdc:mga0k408_15944_c1_1552_2400	282
253	3300050494	nmdc:mga06z11_115037_c1	nmdc:mga06z11_115037_c1_359_1207	282
254	3300050515	nmdc:mga0a205_567847_c1	nmdc:mga0a205_567847_c1_126_974	282
255	3300053088	Ga0500644_0002823	Ga0500644_0002823_1410_2258	282
256	3300053093	Ga0500651_0014700	Ga0500651_0014700_2817_3665	282
257	3300053108	Ga0500562_047097	Ga0500562_047097_210_1058	282
258	3300053118	Ga0500594_0004065	Ga0500594_0004065_1848_2696	282
259	3300053136	Ga0500559_0000134	Ga0500559_0000134_28272_29120	282
260	3300053156	Ga0500622_0006815	Ga0500622_0006815_1301_2149	282
261	3300053739	Ga0500587_000870	Ga0500587_000870_2309_3157	282
262	3300003773	Ga0055537_1000031	Ga0055537_10000316	283
263	3300003784	Ga0055534_1000375	Ga0055534_100037518	283
264	3300003790	Ga0055528_1000592	Ga0055528_100059217	283
265	3300006038	Ga0075365_10086352	Ga0075365_100863522	283
266	3300017792	Ga0163161_10087533	Ga0163161_100875332	283
267	3300025263	Ga0209565_1000087	Ga0209565_100008754	283
268	3300025273	Ga0209673_1000145	Ga0209673_100014554	283
269	3300025291	Ga0209675_1000085	Ga0209675_100008554	283
270	3300025295	Ga0209564_1040245	Ga0209564_10402451	283
271	3300027666	Ga0209282_1000473	Ga0209282_100047310	283
272	3300030745	Ga0316182_1192396	Ga0316182_11923963	283
273	3300032005	Ga0307411_10026004	Ga0307411_100260043	283
274	3300032168	Ga0316593_10104831	Ga0316593_101048311	283
275	3300035692	Ga0373935_0034833	Ga0373935_0034833_1653_2504	283
276	3300037068	Ga0373925_0016119	Ga0373925_0016119_817_1668	283
277	3300048928	Ga0496125_0007919	Ga0496125_0007919_9847_10698	283
278	3300053122	Ga0500608_054140	Ga0500608_054140_29_880	283
279	3300053139	Ga0500568_0023102	Ga0500568_0023102_1213_2088	283
280	3300003187	JGI25151J46595_10002294	JGI25151J46595_100022941	284
281	3300005842	Ga0068858_100280254	Ga0068858_1002802543	284
282	3300006051	Ga0075364_10036926	Ga0075364_100369263	284
283	3300006051	Ga0075364_10382203	Ga0075364_103822031	284
284	3300006946	Ga0079104_1000389	Ga0079104_100038929	284
285	3300009011	Ga0105251_10002733	Ga0105251_1000273314	284
286	3300009011	Ga0105251_10047497	Ga0105251_100474971	284
287	3300009036	Ga0105244_10000279	Ga0105244_1000027937	284
288	3300009036	Ga0105244_10046176	Ga0105244_100461762	284
289	3300009092	Ga0105250_10011151	Ga0105250_100111512	284
290	3300011119	Ga0105246_10000616	Ga0105246_1000061621	284
291	3300011119	Ga0105246_10018705	Ga0105246_100187055	284
292	3300013100	Ga0157373_10003111	Ga0157373_1000311117	284
293	3300013102	Ga0157371_10000700	Ga0157371_1000070031	284
294	3300013102	Ga0157371_10006254	Ga0157371_100062545	284
295	3300013105	Ga0157369_10017975	Ga0157369_100179756	284
296	3300013306	Ga0163162_10006213	Ga0163162_100062134	284
297	3300013306	Ga0163162_10119983	Ga0163162_101199833	284
298	3300013307	Ga0157372_10014510	Ga0157372_100145102	284
299	3300013307	Ga0157372_10327351	Ga0157372_103273513	284
300	3300014497	Ga0182008_10127967	Ga0182008_101279671	284
301	3300015261	Ga0182006_1011126	Ga0182006_10111262	284
302	3300015262	Ga0182007_10012542	Ga0182007_100125423	284
303	3300025233	Ga0209437_100115	Ga0209437_10011533	284
304	3300025294	Ga0209025_1000183	Ga0209025_100018352	284
305	3300025711	Ga0207696_1000035	Ga0207696_1000035305	284
306	3300025711	Ga0207696_1010147	Ga0207696_10101472	284
307	3300025711	Ga0207696_1011480	Ga0207696_10114803	284
308	3300025711	Ga0207696_1018493	Ga0207696_10184933	284
309	3300025728	Ga0207655_1000690	Ga0207655_100069011	284
310	3300025735	Ga0207713_1000001	Ga0207713_10000012199	284
311	3300027111	Ga0209281_1000056	Ga0209281_1000056259	284
312	3300027111	Ga0209281_1000505	Ga0209281_10005052	284
313	3300027312	Ga0209371_1000084	Ga0209371_100008431	284
314	3300027312	Ga0209371_1001147	Ga0209371_10011477	284
315	3300030500	Ga0268256_1000075	Ga0268256_1000075134	284
316	3300030500	Ga0268256_1000980	Ga0268256_100098016	284
317	3300041405	Ga0439438_000002	Ga0439438_000002_581541_582395	284
318	3300041407	Ga0439447_000998	Ga0439447_000998_2037_2891	284
319	3300041407	Ga0439447_014020	Ga0439447_014020_731_1585	284
320	3300041411	Ga0439466_0000716	Ga0439466_0000716_10687_11541	284
321	3300042006	Ga0439432_058154	Ga0439432_058154_300_1154	284
322	3300042146	Ga0450907_000093	Ga0450907_000093_718_1572	284
323	3300042531	Ga0450918_000189	Ga0450918_000189_6584_7438	284
324	3300046458	Ga0495591_000292	Ga0495591_000292_38321_39229	284
325	3300046517	Ga0495630_0338256	Ga0495630_0338256_249_1103	284
326	3300046524	Ga0495648_0043570	Ga0495648_0043570_889_1743	284
327	3300046529	Ga0495652_0076266	Ga0495652_0076266_1008_1862	284
328	3300046530	Ga0495654_0000033	Ga0495654_0000033_162651_163559	284
329	3300046543	Ga0495645_0034984	Ga0495645_0034984_2492_3346	284
330	3300046559	Ga0495667_0087268	Ga0495667_0087268_658_1512	284
331	3300046616	Ga0495668_0050261	Ga0495668_0050261_92_1000	284
332	3300046810	Ga0495660_0020725	Ga0495660_0020725_715_1569	284
333	3300047320	Ga0495672_0000052	Ga0495672_0000052_34880_35734	284
334	3300047446	Ga0495679_007765	Ga0495679_007765_2792_3646	284
335	3300048904	Ga0496101_0000179	Ga0496101_0000179_21136_22044	284
336	3300048905	Ga0496102_0001598	Ga0496102_0001598_6166_7020	284
337	3300048905	Ga0496102_0389326	Ga0496102_0389326_85_939	284
338	3300048907	Ga0496104_0228401	Ga0496104_0228401_455_1309	284
339	3300048908	Ga0496105_0005314	Ga0496105_0005314_4056_4910	284
340	3300048920	Ga0496117_0000073	Ga0496117_0000073_200479_201333	284
341	3300048920	Ga0496117_0000634	Ga0496117_0000634_20801_21655	284
342	3300048920	Ga0496117_0001777	Ga0496117_0001777_514_1368	284
343	3300048920	Ga0496117_0015345	Ga0496117_0015345_1523_2377	284
344	3300048920	Ga0496117_0029893	Ga0496117_0029893_1376_2284	284
345	3300048921	Ga0496118_0000094	Ga0496118_0000094_130275_131129	284
346	3300048921	Ga0496118_0000655	Ga0496118_0000655_20801_21655	284
347	3300048922	Ga0496119_0000073	Ga0496119_0000073_31201_32055	284
348	3300048922	Ga0496119_0000212	Ga0496119_0000212_53305_54159	284
349	3300048922	Ga0496119_0036310	Ga0496119_0036310_1965_2873	284
350	3300048922	Ga0496119_0103236	Ga0496119_0103236_729_1583	284
351	3300048923	Ga0496120_0000088	Ga0496120_0000088_119752_120606	284
352	3300048923	Ga0496120_0008481	Ga0496120_0008481_5677_6531	284
353	3300048923	Ga0496120_0015976	Ga0496120_0015976_1317_2225	284
354	3300048924	Ga0496121_0000386	Ga0496121_0000386_72701_73555	284
355	3300048924	Ga0496121_0001508	Ga0496121_0001508_37658_38512	284
356	3300048925	Ga0496122_0010193	Ga0496122_0010193_7004_7858	284
357	3300048926	Ga0496123_0001696	Ga0496123_0001696_22711_23565	284
358	3300048927	Ga0496124_0002753	Ga0496124_0002753_16166_17020	284
359	3300048927	Ga0496124_0003215	Ga0496124_0003215_1501_2373	284
360	3300048927	Ga0496124_0003844	Ga0496124_0003844_5620_6474	284
361	3300048927	Ga0496124_0014996	Ga0496124_0014996_6387_7241	284
362	3300048927	Ga0496124_0143782	Ga0496124_0143782_817_1671	284
363	3300048928	Ga0496125_0099651	Ga0496125_0099651_1034_1888	284
364	3300048929	Ga0496126_0049759	Ga0496126_0049759_2747_3601	284
365	3300049569	Ga0501032_0010546	Ga0501032_0010546_5526_6410	284
366	3300049573	Ga0501037_0288997	Ga0501037_0288997_174_1073	284
367	3300049574	Ga0501038_0013773	Ga0501038_0013773_3160_4020	284
368	3300050491	nmdc:mga00v17_15701_c1	nmdc:mga00v17_15701_c1_2052_2906	284
369	3300050491	nmdc:mga00v17_326699_c1	nmdc:mga00v17_326699_c1_54_962	284
370	iso_pu_bacteria	2511231025	2511378255	284
371	iso_pu_bacteria	2939607340	2939609981	284
372	iso_pu_bacteria	8016733728	8016734790	284
373	iso_pu_bacteria	8019499862	8019501733	284
374	3300002067	JGI24735J21928_10013118	JGI24735J21928_100131183	285
375	3300002705	JGI25156J39149_1002160	JGI25156J39149_10021603	285
376	3300006051	Ga0075364_10337918	Ga0075364_103379181	285
377	3300009036	Ga0105244_10001228	Ga0105244_100012284	285
378	3300009092	Ga0105250_10001707	Ga0105250_100017077	285
379	3300015262	Ga0182007_10003460	Ga0182007_100034604	285
380	3300025256	Ga0209759_1000130	Ga0209759_10001303	285
381	3300025711	Ga0207696_1000520	Ga0207696_100052019	285
382	3300025728	Ga0207655_1002042	Ga0207655_10020421	285
383	3300025904	Ga0207647_10178074	Ga0207647_101780742	285
384	3300028800	Ga0265338_10000644	Ga0265338_1000064427	285
385	3300029957	Ga0265324_10000120	Ga0265324_1000012025	285
386	3300031238	Ga0265332_10112991	Ga0265332_101129912	285
387	3300031241	Ga0265325_10005590	Ga0265325_100055903	285
388	3300031711	Ga0265314_10000371	Ga0265314_1000037137	285
389	3300031824	Ga0307413_10225995	Ga0307413_102259952	285
390	3300035083	Ga0373926_0092745	Ga0373926_0092745_61_918	285
391	3300035111	Ga0373923_0025834	Ga0373923_0025834_928_1785	285
392	3300035117	Ga0373953_0017135	Ga0373953_0017135_1120_1977	285
393	3300035119	Ga0373956_0025993	Ga0373956_0025993_1144_2001	285
394	3300035172	Ga0373955_0004202	Ga0373955_0004202_1311_2168	285
395	3300035692	Ga0373935_0067769	Ga0373935_0067769_499_1356	285
396	3300037418	Ga0395900_0113810	Ga0395900_0113810_1677_2543	285
397	3300041486	Ga0451807_0686438	Ga0451807_0686438_684_1541	285
398	3300042876	Ga0451577_0048597	Ga0451577_0048597_2428_3315	285
399	3300044712	Ga0453684_0011402	Ga0453684_0011402_4725_5612	285
400	3300045051	Ga0451576_0077620	Ga0451576_0077620_117_1004	285
401	3300046458	Ga0495591_071224	Ga0495591_071224_35_892	285
402	3300046459	Ga0495629_0000031	Ga0495629_0000031_82174_83031	285
403	3300046460	Ga0495638_0044441	Ga0495638_0044441_43_900	285
404	3300046461	Ga0495641_0032775	Ga0495641_0032775_1065_1922	285
405	3300046462	Ga0495651_0057435	Ga0495651_0057435_1297_2154	285
406	3300046463	Ga0495653_0000258	Ga0495653_0000258_23312_24169	285
407	3300046463	Ga0495653_0042755	Ga0495653_0042755_1289_2146	285
408	3300046471	Ga0495650_0009482	Ga0495650_0009482_1796_2653	285
409	3300046472	Ga0495580_0000021	Ga0495580_0000021_11376_12233	285
410	3300046472	Ga0495580_0093635	Ga0495580_0093635_540_1397	285
411	3300046473	Ga0495582_0011722	Ga0495582_0011722_1539_2396	285
412	3300046474	Ga0495605_0001421	Ga0495605_0001421_14075_14932	285
413	3300046475	Ga0495639_0027850	Ga0495639_0027850_580_1437	285
414	3300046477	Ga0495664_0279698	Ga0495664_0279698_14_871	285
415	3300046500	Ga0495596_0044022	Ga0495596_0044022_869_1726	285
416	3300046506	Ga0495583_0002257	Ga0495583_0002257_363_1220	285
417	3300046514	Ga0495618_0024501	Ga0495618_0024501_478_1335	285
418	3300046515	Ga0495620_0027038	Ga0495620_0027038_650_1507	285
419	3300046516	Ga0495628_0001230	Ga0495628_0001230_8943_9800	285
420	3300046516	Ga0495628_0095170	Ga0495628_0095170_735_1592	285
421	3300046517	Ga0495630_0000680	Ga0495630_0000680_9320_10177	285
422	3300046517	Ga0495630_0007120	Ga0495630_0007120_715_1572	285
423	3300046517	Ga0495630_0018596	Ga0495630_0018596_2508_3365	285
424	3300046524	Ga0495648_0020879	Ga0495648_0020879_1402_2259	285
425	3300046533	Ga0495640_0036055	Ga0495640_0036055_733_1590	285
426	3300046536	Ga0495587_0006299	Ga0495587_0006299_1020_1877	285
427	3300046542	Ga0495597_0000925	Ga0495597_0000925_11193_12053	285
428	3300046660	Ga0495625_0002940	Ga0495625_0002940_8722_9582	285
429	3300046660	Ga0495625_0051573	Ga0495625_0051573_537_1394	285
430	3300046674	Ga0495588_0004876	Ga0495588_0004876_3008_3868	285
431	3300046678	Ga0495599_0027243	Ga0495599_0027243_1759_2616	285
432	3300046678	Ga0495599_0052845	Ga0495599_0052845_1659_2516	285
433	3300046679	Ga0495623_0000487	Ga0495623_0000487_5396_6253	285
434	3300046680	Ga0495646_0004741	Ga0495646_0004741_534_1391	285
435	3300046680	Ga0495646_0059688	Ga0495646_0059688_1121_1978	285
436	3300046681	Ga0495647_0042326	Ga0495647_0042326_82_993	285
437	3300046683	Ga0495658_0043304	Ga0495658_0043304_779_1636	285
438	3300046690	Ga0495624_0003308	Ga0495624_0003308_4595_5452	285
439	3300046690	Ga0495624_0055435	Ga0495624_0055435_952_1809	285
440	3300046692	Ga0495671_0047938	Ga0495671_0047938_38_895	285
441	3300047317	Ga0495604_0000510	Ga0495604_0000510_21106_21963	285
442	3300047317	Ga0495604_0021071	Ga0495604_0021071_1880_2737	285
443	3300047320	Ga0495672_0000145	Ga0495672_0000145_62414_63274	285
444	3300047320	Ga0495672_0039192	Ga0495672_0039192_811_1668	285
445	3300047321	Ga0495676_0099861	Ga0495676_0099861_601_1458	285
446	3300047322	Ga0495680_0008458	Ga0495680_0008458_3962_4819	285
447	3300047322	Ga0495680_0050913	Ga0495680_0050913_1327_2184	285
448	3300047322	Ga0495680_0405592	Ga0495680_0405592_29_886	285
449	3300047443	Ga0495687_011876	Ga0495687_011876_2219_3076	285
450	3300047444	Ga0495675_0001645	Ga0495675_0001645_7139_7996	285
451	3300047444	Ga0495675_0061673	Ga0495675_0061673_1198_2055	285
452	3300047446	Ga0495679_000006	Ga0495679_000006_140893_141750	285
453	3300047446	Ga0495679_000090	Ga0495679_000090_32466_33326	285
454	3300047470	Ga0495681_0043701	Ga0495681_0043701_1107_1967	285
455	3300047471	Ga0495684_0122052	Ga0495684_0122052_432_1289	285
456	3300047472	Ga0495686_0011531	Ga0495686_0011531_950_1807	285
457	3300047673	Ga0495593_0018502	Ga0495593_0018502_2357_3214	285
458	3300048088	Ga0495602_0039202	Ga0495602_0039202_705_1562	285
459	3300048089	Ga0495614_0014885	Ga0495614_0014885_432_1289	285
460	3300048912	Ga0496109_0231656	Ga0496109_0231656_665_1531	285
461	3300048920	Ga0496117_0076556	Ga0496117_0076556_466_1323	285
462	3300048921	Ga0496118_0005177	Ga0496118_0005177_11483_12340	285
463	3300048921	Ga0496118_0184030	Ga0496118_0184030_369_1226	285
464	3300048924	Ga0496121_0018385	Ga0496121_0018385_1928_2785	285
465	3300048929	Ga0496126_0000102	Ga0496126_0000102_79702_80559	285
466	3300049575	Ga0501039_0087742	Ga0501039_0087742_1124_1993	285
467	3300049822	Ga0501035_0086619	Ga0501035_0086619_376_1245	285
468	3300053085	Ga0495619_0092511	Ga0495619_0092511_293_1150	285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01163

RIO1

RIO1 family

65

262

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6hk6-assembly5.cif.gz_H	human riok2 bound to inhibitor	0.858	6	218
6hk6-assembly4.cif.gz_G	human riok2 bound to inhibitor	0.8565	7	218
6hk6-assembly2.cif.gz_F	human riok2 bound to inhibitor	0.8516	7	218
6fdn-assembly1.cif.gz_A	rio2 structure	0.8498	6	215
6hk6-assembly4.cif.gz_J	human riok2 bound to inhibitor	0.8476	7	218

ID	Description	Score	Start	End	Superfamily
af_Q9SI22_93_306_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.928	139	191	1.10.510.10
af_Q24171_758_944_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.9216	140	185	1.10.510.10
af_A0A0G2KEU5_217_398_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.9151	140	191	1.10.510.10
af_Q8K1Y2_655_855_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.9138	140	189	1.10.510.10
af_Q55DU7_1340_1422_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.913	18	48	3.30.200.20

ID	Description	Score	Start	End	GO Terms
AF-A0A2V2L136-F1-model_v4	deleted	0.9863	140	225
AF-A0A5S3YMU7-F1-model_v4	Serine protein kinase RIO	0.9852	150	238	GO:0004672 GO:0005829 GO:0030490 GO:0030688 GO:0046872
AF-A0A3T1DV74-F1-model_v4	deleted	0.9789	107	232
AF-A0A2V2L136-F1-model_v4	deleted	0.9751	140	225
AF-T1C4G9-F1-model_v4	RIO1/ZK632.3/MJ0444 family protein	0.975	121	218	GO:0004674 GO:0005524 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
83.37	0.75	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450050

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01163

RIO1

RIO1 family

65

262

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map