F450058

General Info

Members Datasets Scaffolds Average Seq Length
468 259 465 149

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000068|Ga0265327_1000006815
Length 153
Sequence MSTNTSMNTNTVTLHRVLRTTPEKLYRAFTTAAGMERWLPPCGFTGKVHQIDAKVGGTYKMSFTNFTTQHSHSFGGTYLELSNERIRYSSEFDDPNLPGAMETAVTLKKVSCGTEITVVQSGIPGIIPVEGCYLGWQESLNYLAMLVEPEIPG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
238 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
256 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.28
Nodule 0.21
Rhizoplane 1.71
Rhizosphere 68.16
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1724449 2162886007 Bacteria 1535
2 JGI25156J39149_1000082 3300002705 Bacteria 70773
3 JGI25154J39366_1000061 3300002738 Bacteria 105781
4 JGI25154J39366_1000111 3300002738 Bacteria 70668
5 JGI25157J39369_1000006 3300002741 Bacteria 226861
6 JGI25152J39213_1000221 3300002773 Bacteria 38603
7 JGI25150J39212_1000535 3300002774 Bacteria 15407
8 JGI25150J39212_1023199 3300002774 Bacteria 924
9 JGI25159J45721_1005326 3300002987 Bacteria 4059
10 JGI25151J46595_10000107 3300003187 Bacteria 113288
11 JGI25151J46595_10041788 3300003187 Bacteria 1660
12 JGI25151J46595_10080851 3300003187 Bacteria 942
13 JGI25153J46596_10000078 3300003215 Bacteria 113288
14 rootH1_10088272 3300003323 Bacteria 2888
15 JGI25160J50197_1000409 3300003354 Bacteria 27462
16 JGI25161J50226_1000030 3300003374 Bacteria 142870
17 Ga0055539_1001078 3300003752 Bacteria 5776
18 Ga0055533_1002783 3300003756 Bacteria 3814
19 Ga0055527_1000389 3300003760 Bacteria 19034
20 Ga0055535_1001515 3300003761 Bacteria 11491
21 Ga0055542_1000209 3300003762 Bacteria 71315
22 Ga0055529_1000229 3300003763 Bacteria 71315
23 Ga0055526_1010234 3300003771 Bacteria 4388
24 Ga0055526_1014692 3300003771 Bacteria 3199
25 Ga0055526_1038585 3300003771 Bacteria 1229
26 Ga0055537_1000437 3300003773 Bacteria 26761
27 Ga0055537_1008541 3300003773 Bacteria 2352
28 Ga0055524_1000006 3300003775 Bacteria 324702
29 Ga0055524_1016135 3300003775 Bacteria 2693
30 Ga0055536_1000976 3300003781 Bacteria 18191
31 Ga0055536_1002706 3300003781 Bacteria 9833
32 Ga0055536_1002756 3300003781 Bacteria 9728
33 Ga0055534_1001182 3300003784 Bacteria 10977
34 Ga0055534_1038084 3300003784 Bacteria 717
35 Ga0055528_1015217 3300003790 Bacteria 2792
36 Ga0055530_10000127 3300003791 Bacteria 66675
37 Ga0055530_10007166 3300003791 Bacteria 4769
38 Ga0055540_1000005 3300003792 Bacteria 378126
39 Ga0055531_10002136 3300003794 Bacteria 13536
40 Ga0055531_10007844 3300003794 Bacteria 5743
41 Ga0055531_10008766 3300003794 Bacteria 5277
42 Ga0055531_10064203 3300003794 Bacteria 879
43 Ga0058692_1000017 3300003856 Bacteria 274459
44 Ga0055543_1000195 3300004625 Bacteria 49751
45 Ga0065165_1003553 3300005262 Bacteria 10782
46 Ga0065165_1003785 3300005262 Bacteria 10124
47 Ga0065712_10068696 3300005290 Bacteria 9364
48 Ga0065707_10000773 3300005295 Bacteria 15229
49 Ga0070670_100432142 3300005331 Bacteria 1165
50 Ga0070670_101703498 3300005331 Bacteria 580
51 Ga0068869_100142991 3300005334 Bacteria 1849
52 Ga0070666_11056898 3300005335 Bacteria 603
53 Ga0070680_100176560 3300005336 Bacteria 1798
54 Ga0068868_100081908 3300005338 Bacteria 2588
55 Ga0070691_10884863 3300005341 Bacteria 550
56 Ga0070687_100386379 3300005343 Bacteria 914
57 Ga0070692_10428273 3300005345 Bacteria 842
58 Ga0070669_100009307 3300005353 Bacteria 6994
59 Ga0070669_101450569 3300005353 Bacteria 596
60 Ga0070688_100229337 3300005365 Bacteria 1313
61 Ga0070713_100173163 3300005436 Bacteria 1935
62 Ga0070700_101464734 3300005441 Bacteria 579
63 Ga0070694_101132947 3300005444 Bacteria 654
64 Ga0070708_100610988 3300005445 Bacteria 1028
65 Ga0070708_101290916 3300005445 Bacteria 682
66 Ga0070678_100475429 3300005456 Bacteria 1099
67 Ga0070681_10442975 3300005458 Bacteria 1211
68 Ga0070685_10005743 3300005466 Bacteria 6304
69 Ga0070707_100441619 3300005468 Bacteria 1262
70 Ga0070698_100785505 3300005471 Bacteria 896
71 Ga0070699_100867288 3300005518 Bacteria 826
72 Ga0070679_100971897 3300005530 Bacteria 793
73 Ga0070697_100128147 3300005536 Bacteria 2126
74 Ga0068853_101295680 3300005539 Bacteria 704
75 Ga0070686_100775867 3300005544 Bacteria 771
76 Ga0070695_100726652 3300005545 Bacteria 790
77 Ga0070695_101165508 3300005545 Bacteria 633
78 Ga0070696_100899798 3300005546 Bacteria 734
79 Ga0070665_100000213 3300005548 Bacteria 100019
80 Ga0070665_100807650 3300005548 Bacteria 951
81 Ga0070665_101115712 3300005548 Bacteria 800
82 Ga0070704_100452632 3300005549 Bacteria 1106
83 Ga0068855_100367272 3300005563 Bacteria 1582
84 Ga0068856_100082326 3300005614 Bacteria 3194
85 Ga0068856_100306818 3300005614 Bacteria 1605
86 Ga0068852_100735558 3300005616 Bacteria 998
87 Ga0068859_100101927 3300005617 Bacteria 2928
88 Ga0068859_101013578 3300005617 Bacteria 912
89 Ga0068870_10033595 3300005840 Bacteria 2619
90 Ga0068870_10046118 3300005840 Bacteria 2284
91 Ga0068863_100176885 3300005841 Bacteria 2048
92 Ga0068863_100310181 3300005841 Bacteria 1531
93 Ga0068858_100078317 3300005842 Bacteria 3072
94 Ga0068860_100221953 3300005843 Bacteria 1835
95 Ga0068860_100631447 3300005843 Bacteria 1078
96 Ga0068862_101044828 3300005844 Bacteria 810
97 Ga0068862_101356229 3300005844 Bacteria 714
98 Ga0081455_10121420 3300005937 Bacteria 2058
99 Ga0081538_10326875 3300005981 Bacteria 558
100 Ga0075365_10305371 3300006038 Bacteria 1120
101 Ga0075364_10237709 3300006051 Bacteria 1237
102 Ga0070715_10333835 3300006163 Bacteria 822
103 Ga0070716_100289939 3300006173 Bacteria 1133
104 Ga0097621_101793494 3300006237 Bacteria 585
105 Ga0075370_10217774 3300006353 Bacteria 1128
106 Ga0075370_10260359 3300006353 Bacteria 1029
107 Ga0068871_100424201 3300006358 Bacteria 1188
108 Ga0068871_101051456 3300006358 Bacteria 760
109 Ga0075428_100148206 3300006844 Bacteria 2550
110 Ga0075428_100355948 3300006844 Bacteria 1571
111 Ga0075428_100606832 3300006844 Bacteria 1169
112 Ga0075431_100065907 3300006847 Bacteria 3739
113 Ga0075433_10358810 3300006852 Bacteria 1288
114 Ga0075434_100420406 3300006871 Bacteria 1358
115 Ga0075429_100094773 3300006880 Bacteria 2603
116 Ga0068865_100243567 3300006881 Bacteria 1416
117 Ga0068865_100310404 3300006881 Bacteria 1265
118 Ga0097620_100101929 3300006931 Bacteria 2928
119 Ga0097620_101013679 3300006931 Bacteria 912
120 Ga0099826_10129078 3300006948 Bacteria 1477
121 Ga0111539_10022998 3300009094 Bacteria 7654
122 Ga0111539_10161271 3300009094 Unclassified 2622
123 Ga0111539_10320033 3300009094 Bacteria 1805
124 Ga0105247_10946259 3300009101 Bacteria 669
125 Ga0105243_10032013 3300009148 Bacteria 4059
126 Ga0105248_12170477 3300009177 Bacteria 632
127 Ga0105249_10090956 3300009553 Bacteria 2854
128 Ga0105249_10339954 3300009553 Bacteria 1517
129 Ga0105239_10155823 3300010375 Bacteria 2551
130 Ga0157375_11019639 3300013308 Bacteria 967
131 Ga0157375_11379154 3300013308 Bacteria 830
132 Ga0157375_11602300 3300013308 Bacteria 770
133 Ga0163163_10827787 3300014325 Bacteria 989
134 Ga0157380_10002627 3300014326 Bacteria 12159
135 Ga0157380_11092854 3300014326 Bacteria 836
136 Ga0163161_11939052 3300017792 Bacteria 524
137 Ga0209435_100001 3300025206 Bacteria 1424171
138 Ga0209674_100104 3300025226 Bacteria 154080
139 Ga0209674_100733 3300025226 Bacteria 11197
140 Ga0209672_100009 3300025228 Bacteria 883623
141 Ga0209258_100011 3300025242 Bacteria 867542
142 Ga0207425_1000028 3300025245 Bacteria 286333
143 Ga0209646_1000001 3300025246 Bacteria 3092932
144 Ga0209026_1000003 3300025250 Bacteria 1060571
145 Ga0209677_101852 3300025253 Bacteria 8596
146 Ga0209148_1000013 3300025254 Bacteria 956684
147 Ga0209759_1000001 3300025256 Bacteria 2799452
148 Ga0209129_1000011 3300025258 Bacteria 568657
149 Ga0209565_1000004 3300025263 Bacteria 983150
150 Ga0209565_1000300 3300025263 Bacteria 46801
151 Ga0209455_1000012 3300025272 Bacteria 867234
152 Ga0209673_1000045 3300025273 Bacteria 290531
153 Ga0209673_1004226 3300025273 Bacteria 7818
154 Ga0209130_1000060 3300025284 Bacteria 201501
155 Ga0209130_1000544 3300025284 Bacteria 37720
156 Ga0209130_1011043 3300025284 Bacteria 2440
157 Ga0209675_1000096 3300025291 Bacteria 133284
158 Ga0209675_1001988 3300025291 Bacteria 10978
159 Ga0209675_1012627 3300025291 Bacteria 2705
160 Ga0209675_1023226 3300025291 Bacteria 1610
161 Ga0209675_1033439 3300025291 Bacteria 1192
162 Ga0209676_1000007 3300025292 Bacteria 1029371
163 Ga0209676_1000854 3300025292 Bacteria 39262
164 Ga0209676_1002647 3300025292 Bacteria 12189
165 Ga0209676_1003068 3300025292 Bacteria 10772
166 Ga0209676_1003073 3300025292 Bacteria 10761
167 Ga0209676_1008272 3300025292 Bacteria 4671
168 Ga0209676_1011203 3300025292 Bacteria 3642
169 Ga0209676_1046330 3300025292 Bacteria 1177
170 Ga0209025_1000002 3300025294 Bacteria 1393142
171 Ga0209025_1000562 3300025294 Bacteria 68180
172 Ga0209025_1008588 3300025294 Bacteria 7318
173 Ga0209025_1019584 3300025294 Bacteria 3755
174 Ga0209025_1021369 3300025294 Bacteria 3489
175 Ga0209025_1022240 3300025294 Bacteria 3373
176 Ga0209025_1034969 3300025294 Bacteria 2280
177 Ga0209025_1052287 3300025294 Bacteria 1614
178 Ga0209025_1092669 3300025294 Bacteria 982
179 Ga0209564_1001166 3300025295 Bacteria 30564
180 Ga0209564_1001940 3300025295 Bacteria 18361
181 Ga0209564_1004359 3300025295 Bacteria 8706
182 Ga0209564_1009229 3300025295 Bacteria 4728
183 Ga0209564_1045766 3300025295 Bacteria 1122
184 Ga0209758_1000003 3300025297 Bacteria 1398533
185 Ga0209758_1046506 3300025297 Bacteria 1564
186 Ga0209758_1063159 3300025297 Bacteria 1208
187 Ga0209050_1000003 3300025298 Bacteria 1609245
188 Ga0209050_1000932 3300025298 Bacteria 38288
189 Ga0209050_1002136 3300025298 Bacteria 17994
190 Ga0209256_1000001 3300025299 Bacteria 2166974
191 Ga0209256_1000457 3300025299 Bacteria 61666
192 Ga0209256_1003363 3300025299 Bacteria 11322
193 Ga0209256_1008355 3300025299 Bacteria 4822
194 Ga0209256_1089353 3300025299 Bacteria 658
195 Ga0207426_1000025 3300025302 Bacteria 532921
196 Ga0207426_1001283 3300025302 Bacteria 21782
197 Ga0209051_1000003 3300025303 Bacteria 1609245
198 Ga0209051_1013564 3300025303 Bacteria 3869
199 Ga0209051_1074815 3300025303 Bacteria 1002
200 Ga0209257_1000020 3300025304 Bacteria 773356
201 Ga0209257_1000065 3300025304 Bacteria 353604
202 Ga0209257_1000529 3300025304 Bacteria 66275
203 Ga0209257_1000867 3300025304 Bacteria 42999
204 Ga0209257_1002545 3300025304 Bacteria 17840
205 Ga0209257_1003596 3300025304 Bacteria 13100
206 Ga0209257_1005401 3300025304 Bacteria 8994
207 Ga0209257_1037231 3300025304 Bacteria 1485
208 Ga0207682_10021754 3300025893 Bacteria 2524
209 Ga0207682_10035809 3300025893 Bacteria 2006
210 Ga0207642_10163752 3300025899 Bacteria 1197
211 Ga0207643_10428240 3300025908 Bacteria 839
212 Ga0207660_10025684 3300025917 Bacteria 4002
213 Ga0207662_10171159 3300025918 Bacteria 1393
214 Ga0207652_11072088 3300025921 Bacteria 706
215 Ga0207650_10372968 3300025925 Bacteria 1177
216 Ga0207650_11075312 3300025925 Bacteria 685
217 Ga0207664_10777485 3300025929 Bacteria 861
218 Ga0207709_10025680 3300025935 Bacteria 3374
219 Ga0207704_10248104 3300025938 Bacteria 1334
220 Ga0207704_10514538 3300025938 Bacteria 967
221 Ga0207665_10076121 3300025939 Bacteria 2300
222 Ga0207711_10358944 3300025941 Bacteria 1350
223 Ga0207711_10838613 3300025941 Bacteria 856
224 Ga0207689_10138062 3300025942 Bacteria 2007
225 Ga0207667_10223190 3300025949 Bacteria 1930
226 Ga0207712_10248562 3300025961 Bacteria 1436
227 Ga0207712_10474565 3300025961 Bacteria 1065
228 Ga0207658_11099867 3300025986 Bacteria 726
229 Ga0207677_10035524 3300026023 Bacteria 3238
230 Ga0207708_10004515 3300026075 Bacteria 10239
231 Ga0207702_10000136 3300026078 Bacteria 88057
232 Ga0207702_10260314 3300026078 Bacteria 1633
233 Ga0207641_10398933 3300026088 Bacteria 1320
234 Ga0207641_10884331 3300026088 Unclassified 886
235 Ga0207676_11718888 3300026095 Bacteria 626
236 Ga0207674_10326165 3300026116 Bacteria 1485
237 Ga0207675_100005119 3300026118 Bacteria 12622
238 Ga0207683_10160501 3300026121 Bacteria 2032
239 Ga0209371_1000044 3300027312 Bacteria 327086
240 Ga0209371_1037316 3300027312 Bacteria 1010
241 Ga0209998_10034491 3300027717 Bacteria 1132
242 Ga0207428_10151220 3300027907 Bacteria 1767
243 Ga0268266_10000235 3300028379 Bacteria 94600
244 Ga0268266_10001649 3300028379 Bacteria 25861
245 Ga0268266_10076478 3300028379 Bacteria 2910
246 Ga0268265_10115287 3300028380 Bacteria 2202
247 Ga0268264_10250358 3300028381 Bacteria 1646
248 Ga0265322_10086841 3300028654 Bacteria 888
249 Ga0265338_10008392 3300028800 Bacteria 12550
250 Ga0265338_10145958 3300028800 Bacteria 1845
251 Ga0265324_10023544 3300029957 Bacteria 2193
252 Ga0268256_1000046 3300030500 Bacteria 327003
253 Ga0268256_1042470 3300030500 Bacteria 1010
254 Ga0265332_10002359 3300031238 Bacteria 9631
255 Ga0265332_10042677 3300031238 Bacteria 1960
256 Ga0265329_10003852 3300031242 Bacteria 6439
257 Ga0265340_10040808 3300031247 Unclassified 2284
258 Ga0265327_10000068 3300031251 Bacteria 219962
259 Ga0307513_10000895 3300031456 Bacteria 43051
260 Ga0307408_100053931 3300031548 Bacteria 2906
261 Ga0307408_100108324 3300031548 Bacteria 2129
262 Ga0307408_100282911 3300031548 Bacteria 1382
263 Ga0307408_101627890 3300031548 Bacteria 614
264 Ga0265314_10001049 3300031711 Bacteria 32230
265 Ga0307516_10016756 3300031730 Bacteria 7652
266 Ga0307406_10048982 3300031901 Bacteria 2672
267 Ga0307406_10528948 3300031901 Bacteria 961
268 Ga0307406_10906196 3300031901 Bacteria 751
269 Ga0307407_10157691 3300031903 Bacteria 1482
270 Ga0307407_10476330 3300031903 Bacteria 911
271 Ga0307409_100633479 3300031995 Bacteria 1061
272 Ga0307409_100847177 3300031995 Bacteria 925
273 Ga0307416_100820467 3300032002 Bacteria 1027
274 Ga0307416_101276898 3300032002 Bacteria 840
275 Ga0307415_100537931 3300032126 Bacteria 1029
276 Ga0373956_0197087 3300035119 Bacteria 954
277 Ga0373931_0098655 3300035691 Bacteria 1640
278 Ga0373937_0035024 3300036401 Bacteria 4567
279 Ga0395899_0413254 3300037312 Bacteria 890
280 Ga0395899_0447269 3300037312 Bacteria 847
281 Ga0395900_0071007 3300037418 Bacteria 3579
282 Ga0395900_0621515 3300037418 Bacteria 1019
283 Ga0395898_0039639 3300037466 Bacteria 4661
284 Ga0395898_0296664 3300037466 Bacteria 1542
285 Ga0395898_1111193 3300037466 Bacteria 723
286 Ga0395905_0003421 3300037471 Bacteria 16979
287 Ga0395905_0017634 3300037471 Bacteria 6776
288 Ga0395905_0138327 3300037471 Bacteria 2291
289 Ga0395901_0002112 3300038443 Bacteria 20378
290 Ga0436365_1058014 3300039437 Bacteria 593
291 Ga0439465_0354302 3300041413 Bacteria 555
292 Ga0451791_1307196 3300041451 Bacteria 676
293 Ga0451798_0531006 3300041458 Bacteria 716
294 Ga0451800_0855242 3300041459 Bacteria 686
295 Ga0451802_0510565 3300041460 Bacteria 583
296 Ga0451802_2085615 3300041460 Bacteria 567
297 Ga0451804_0775093 3300041463 Bacteria 818
298 Ga0451804_1009426 3300041463 Bacteria 861
299 Ga0451807_2590115 3300041486 Bacteria 770
300 Ga0451839_0510055 3300041496 Bacteria 730
301 Ga0451847_0252384 3300041503 Bacteria 518
302 Ga0451843_1500063 3300041509 Bacteria 849
303 Ga0451853_1316513 3300041512 Bacteria 1225
304 Ga0439433_0086039 3300041999 Bacteria 769
305 Ga0439432_005457 3300042006 Bacteria 4577
306 Ga0439432_061937 3300042006 Bacteria 1152
307 Ga0439449_0001147 3300042007 Bacteria 10391
308 Ga0439449_0021113 3300042007 Bacteria 2438
309 Ga0439449_0072254 3300042007 Bacteria 1271
310 Ga0439452_046485 3300042010 Bacteria 1007
311 Ga0439444_0038017 3300042437 Bacteria 933
312 Ga0439444_0193516 3300042437 Bacteria 510
313 Ga0451577_0001644 3300042876 Bacteria 28947
314 Ga0451577_0006876 3300042876 Bacteria 11253
315 Ga0451577_1436292 3300042876 Bacteria 611
316 Ga0466972_0065038 3300044658 Bacteria 1745
317 Ga0466972_0150972 3300044658 Bacteria 1092
318 Ga0453683_0017633 3300044673 Bacteria 4596
319 Ga0453684_0000189 3300044712 Bacteria 269690
320 Ga0453684_0001090 3300044712 Bacteria 85790
321 Ga0453684_0001369 3300044712 Bacteria 70779
322 Ga0453684_0025585 3300044712 Bacteria 8564
323 Ga0453684_0042921 3300044712 Bacteria 6087
324 Ga0453684_0139364 3300044712 Bacteria 2899
325 Ga0453684_0659689 3300044712 Bacteria 1141
326 Ga0466960_0002806 3300044901 Bacteria 6600
327 Ga0451576_0000086 3300045051 Bacteria 235554
328 Ga0451576_0000245 3300045051 Bacteria 133069
329 Ga0451576_0045380 3300045051 Bacteria 4629
330 Ga0451576_0152548 3300045051 Bacteria 2409
331 Ga0451576_0608139 3300045051 Bacteria 1149
332 Ga0451576_0992233 3300045051 Bacteria 880
333 Ga0495672_0013843 3300047320 Bacteria 5547
334 Ga0495687_026004 3300047443 Bacteria 2759
335 Ga0495686_0041506 3300047472 Bacteria 2929
336 Ga0495686_0046612 3300047472 Bacteria 2739
337 Ga0496118_0056936 3300048921 Bacteria 2934
338 Ga0501031_0004736 3300049568 Bacteria 8829
339 Ga0501031_0103507 3300049568 Bacteria 1858
340 Ga0501031_0443563 3300049568 Bacteria 838
341 Ga0501031_0788292 3300049568 Bacteria 609
342 Ga0501032_0002635 3300049569 Bacteria 14006
343 Ga0501032_0065375 3300049569 Bacteria 2432
344 Ga0501033_0008867 3300049570 Bacteria 7768
345 Ga0501033_0016932 3300049570 Bacteria 5509
346 Ga0501033_0337301 3300049570 Bacteria 1057
347 Ga0501034_0031738 3300049571 Bacteria 5365
348 Ga0501034_0040269 3300049571 Bacteria 4729
349 Ga0501034_0051354 3300049571 Bacteria 4158
350 Ga0501034_0341257 3300049571 Bacteria 1428
351 Ga0501034_0706887 3300049571 Bacteria 906
352 Ga0501036_0004099 3300049572 Bacteria 11726
353 Ga0501036_0043442 3300049572 Bacteria 3806
354 Ga0501036_0154993 3300049572 Bacteria 1932
355 Ga0501036_0370563 3300049572 Bacteria 1195
356 Ga0501036_0489803 3300049572 Bacteria 1023
357 Ga0501037_0070749 3300049573 Bacteria 2538
358 Ga0501037_0079843 3300049573 Bacteria 2374
359 Ga0501037_0574020 3300049573 Bacteria 759
360 Ga0501037_0663337 3300049573 Bacteria 696
361 Ga0501038_0062121 3300049574 Bacteria 3192
362 Ga0501038_0112039 3300049574 Bacteria 2259
363 Ga0501038_0141032 3300049574 Bacteria 1971
364 Ga0501038_0144463 3300049574 Bacteria 1944
365 Ga0501038_0258823 3300049574 Bacteria 1376
366 Ga0501038_0396993 3300049574 Bacteria 1067
367 Ga0501038_0770439 3300049574 Bacteria 717
368 Ga0501039_0022548 3300049575 Bacteria 4833
369 Ga0501039_0032184 3300049575 Bacteria 4042
370 Ga0501039_0051590 3300049575 Bacteria 3183
371 Ga0501039_0736049 3300049575 Bacteria 770
372 Ga0501040_0036997 3300049576 Bacteria 3314
373 Ga0501041_0229514 3300049577 Bacteria 1166
374 Ga0501042_0137038 3300049578 Bacteria 1765
375 Ga0501042_0721675 3300049578 Bacteria 725
376 Ga0501042_1200947 3300049578 Bacteria 553
377 Ga0501043_0020860 3300049579 Bacteria 5139
378 Ga0501043_0039615 3300049579 Bacteria 3703
379 Ga0501043_0192981 3300049579 Bacteria 1583
380 Ga0501046_0018913 3300049580 Bacteria 5721
381 Ga0501046_0185152 3300049580 Bacteria 1555
382 Ga0501047_0002212 3300049581 Bacteria 18634
383 Ga0501047_0012290 3300049581 Bacteria 8103
384 Ga0501047_0032943 3300049581 Bacteria 5003
385 Ga0501047_0034150 3300049581 Bacteria 4911
386 Ga0501047_0087050 3300049581 Bacteria 3001
387 Ga0501047_0223950 3300049581 Bacteria 1736
388 Ga0501047_0366911 3300049581 Bacteria 1275
389 Ga0501048_0198171 3300049582 Bacteria 1423
390 Ga0501048_0351380 3300049582 Bacteria 1051
391 Ga0501067_0207771 3300049583 Bacteria 1090
392 Ga0501068_0000018 3300049584 Bacteria 59872
393 Ga0501069_0042686 3300049585 Bacteria 2509
394 Ga0501069_0217713 3300049585 Bacteria 1109
395 Ga0501069_0840381 3300049585 Bacteria 557
396 Ga0501070_0050237 3300049586 Bacteria 3462
397 Ga0501070_0213127 3300049586 Bacteria 1585
398 Ga0501070_0507765 3300049586 Bacteria 968
399 Ga0501070_1280686 3300049586 Bacteria 560
400 Ga0501072_0000083 3300049588 Bacteria 69925
401 Ga0501072_0008921 3300049588 Bacteria 7622
402 Ga0501072_0941306 3300049588 Bacteria 674
403 Ga0501073_0044822 3300049589 Bacteria 3117
404 Ga0501073_0108981 3300049589 Bacteria 1921
405 Ga0501073_0113992 3300049589 Bacteria 1874
406 Ga0501073_0256157 3300049589 Bacteria 1208
407 Ga0501074_0051656 3300049590 Bacteria 2967
408 Ga0501075_0028588 3300049591 Bacteria 4115
409 Ga0501076_0002755 3300049592 Bacteria 12168
410 Ga0501076_0025315 3300049592 Bacteria 4591
411 Ga0501077_0001433 3300049593 Bacteria 14333
412 Ga0501217_109525 3300049661 Bacteria 793
413 Ga0501225_0193718 3300049705 Bacteria 641
414 Ga0501079_0024038 3300049741 Bacteria 4674
415 Ga0501079_0051185 3300049741 Bacteria 3188
416 Ga0501080_0000562 3300049742 Bacteria 29341
417 Ga0501080_0089415 3300049742 Bacteria 2861
418 Ga0501080_0207500 3300049742 Bacteria 1796
419 Ga0501080_0290067 3300049742 Bacteria 1486
420 Ga0501080_0927810 3300049742 Bacteria 758
421 Ga0501081_0010526 3300049743 Bacteria 6035
422 Ga0501083_0038149 3300049744 Bacteria 3267
423 Ga0501083_0080487 3300049744 Bacteria 2160
424 Ga0501266_030115 3300049763 Bacteria 772
425 Ga0501269_016839 3300049766 Bacteria 902
426 Ga0501035_0096048 3300049822 Bacteria 2604
427 Ga0501035_0163731 3300049822 Bacteria 1924
428 Ga0501044_0010017 3300049823 Bacteria 10297
429 Ga0501044_0013283 3300049823 Bacteria 8915
430 Ga0501044_0033881 3300049823 Bacteria 5362
431 Ga0501044_0038814 3300049823 Bacteria 4972
432 Ga0501044_0043103 3300049823 Bacteria 4689
433 Ga0501044_0173334 3300049823 Bacteria 2127
434 Ga0501044_0175192 3300049823 Bacteria 2114
435 Ga0501044_0271127 3300049823 Bacteria 1633
436 Ga0501044_0313581 3300049823 Bacteria 1494
437 Ga0501044_0334199 3300049823 Unclassified 1437
438 Ga0501044_0415048 3300049823 Bacteria 1257
439 nmdc:mga00v17_168647_c1 3300050491 Bacteria 1411
440 nmdc:mga0yw44_214468_c1 3300050492 Bacteria 1274
441 nmdc:mga0yw44_78144_c1 3300050492 Bacteria 2069
442 nmdc:mga0k408_805187_c1 3300050493 Bacteria 547
443 nmdc:mga06z11_195283_c1 3300050494 Bacteria 1173
444 nmdc:mga07m45_611858_c1 3300050496 Bacteria 629
445 nmdc:mga07m45_99556_c1 3300050496 Bacteria 1669
446 nmdc:mga09592_1491579_c1 3300050508 Bacteria 550
447 nmdc:mga09592_89270_c1 3300050508 Bacteria 2632
448 nmdc:mga08y16_14842_c1 3300050511 Bacteria 4723
449 nmdc:mga08y16_211171_c1 3300050511 Unclassified 2010
450 nmdc:mga0n895_59991_c1 3300050512 Bacteria 3753
451 nmdc:mga0a205_1008953_c1 3300050515 Bacteria 679
452 nmdc:mga0a205_55425_c1 3300050515 Bacteria 3829
453 Ga0500641_0092798 3300053096 Bacteria 1290
454 Ga0500658_0104843 3300053134 Bacteria 1238
455 Ga0500564_081044 3300053138 Unclassified 1454
456 Ga0500645_000094 3300053730 Bacteria 69611
457 Ga0500645_017942 3300053730 Bacteria 2215
458 Ga0501084_0000047 3300054114 Bacteria 96024
459 Ga0501084_0026459 3300054114 Bacteria 4841
460 Ga0500661_008503 3300055283 Bacteria 1889
461 Ga0590074_038108 3300059423 Bacteria 861
462 Ga0501082_0000328 3300060353 Bacteria 42146
463 Ga0501082_0006682 3300060353 Bacteria 9980
464 Ga0501082_0326072 3300060353 Bacteria 1338
465 Ga0530510_0026719 3300061734 Bacteria 4133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100785505 Ga0070698_1007855052 141
2 iso_pu_bacteria 2551306352 2552747209 144
3 3300028380 Ga0268265_10115287 Ga0268265_101152874 145
4 3300025929 Ga0207664_10777485 Ga0207664_107774852 146
5 3300049568 Ga0501031_0103507 Ga0501031_0103507_527_970 146
6 3300049568 Ga0501031_0443563 Ga0501031_0443563_381_824 146
7 3300049568 Ga0501031_0788292 Ga0501031_0788292_18_461 146
8 3300049569 Ga0501032_0065375 Ga0501032_0065375_641_1084 146
9 3300049570 Ga0501033_0008867 Ga0501033_0008867_730_1173 146
10 3300049570 Ga0501033_0337301 Ga0501033_0337301_588_1031 146
11 3300049571 Ga0501034_0051354 Ga0501034_0051354_298_741 146
12 3300049572 Ga0501036_0004099 Ga0501036_0004099_531_974 146
13 3300049572 Ga0501036_0154993 Ga0501036_0154993_998_1438 146
14 3300049573 Ga0501037_0079843 Ga0501037_0079843_1914_2357 146
15 3300049573 Ga0501037_0574020 Ga0501037_0574020_278_721 146
16 3300049573 Ga0501037_0663337 Ga0501037_0663337_157_600 146
17 3300049574 Ga0501038_0258823 Ga0501038_0258823_227_670 146
18 3300049574 Ga0501038_0396993 Ga0501038_0396993_39_482 146
19 3300049575 Ga0501039_0051590 Ga0501039_0051590_971_1411 146
20 3300049575 Ga0501039_0736049 Ga0501039_0736049_262_705 146
21 3300049576 Ga0501040_0036997 Ga0501040_0036997_2003_2443 146
22 3300049577 Ga0501041_0229514 Ga0501041_0229514_17_457 146
23 3300049578 Ga0501042_1200947 Ga0501042_1200947_86_529 146
24 3300049579 Ga0501043_0020860 Ga0501043_0020860_928_1371 146
25 3300049579 Ga0501043_0039615 Ga0501043_0039615_1964_2407 146
26 3300049580 Ga0501046_0018913 Ga0501046_0018913_1297_1740 146
27 3300049580 Ga0501046_0185152 Ga0501046_0185152_342_785 146
28 3300049581 Ga0501047_0012290 Ga0501047_0012290_1491_1934 146
29 3300049581 Ga0501047_0032943 Ga0501047_0032943_3637_4080 146
30 3300049581 Ga0501047_0087050 Ga0501047_0087050_2084_2527 146
31 3300049582 Ga0501048_0198171 Ga0501048_0198171_735_1175 146
32 3300049582 Ga0501048_0351380 Ga0501048_0351380_428_871 146
33 3300049585 Ga0501069_0217713 Ga0501069_0217713_358_798 146
34 3300049586 Ga0501070_0213127 Ga0501070_0213127_1119_1562 146
35 3300049588 Ga0501072_0008921 Ga0501072_0008921_4349_4789 146
36 3300049589 Ga0501073_0256157 Ga0501073_0256157_712_1155 146
37 3300049591 Ga0501075_0028588 Ga0501075_0028588_2154_2594 146
38 3300049592 Ga0501076_0025315 Ga0501076_0025315_1901_2341 146
39 3300049741 Ga0501079_0024038 Ga0501079_0024038_2933_3373 146
40 3300049742 Ga0501080_0089415 Ga0501080_0089415_2313_2753 146
41 3300049742 Ga0501080_0290067 Ga0501080_0290067_640_1083 146
42 3300049743 Ga0501081_0010526 Ga0501081_0010526_2917_3357 146
43 3300049822 Ga0501035_0096048 Ga0501035_0096048_1695_2138 146
44 3300049823 Ga0501044_0010017 Ga0501044_0010017_1632_2075 146
45 3300049823 Ga0501044_0038814 Ga0501044_0038814_921_1364 146
46 3300049823 Ga0501044_0175192 Ga0501044_0175192_1652_2095 146
47 3300049823 Ga0501044_0271127 Ga0501044_0271127_1162_1602 146
48 3300049823 Ga0501044_0313581 Ga0501044_0313581_539_982 146
49 3300054114 Ga0501084_0026459 Ga0501084_0026459_390_830 146
50 3300060353 Ga0501082_0006682 Ga0501082_0006682_8919_9359 146
51 3300061734 Ga0530510_0026719 Ga0530510_0026719_1379_1819 146
52 3300003187 JGI25151J46595_10041788 JGI25151J46595_100417882 147
53 3300003771 Ga0055526_1038585 Ga0055526_10385851 147
54 3300003775 Ga0055524_1016135 Ga0055524_10161352 147
55 3300003781 Ga0055536_1000976 Ga0055536_100097617 147
56 3300003784 Ga0055534_1038084 Ga0055534_10380841 147
57 3300003791 Ga0055530_10007166 Ga0055530_100071662 147
58 3300003794 Ga0055531_10007844 Ga0055531_100078442 147
59 3300003794 Ga0055531_10008766 Ga0055531_100087665 147
60 3300003794 Ga0055531_10064203 Ga0055531_100642031 147
61 3300005290 Ga0065712_10068696 Ga0065712_1006869610 147
62 3300005331 Ga0070670_100432142 Ga0070670_1004321422 147
63 3300005334 Ga0068869_100142991 Ga0068869_1001429913 147
64 3300005335 Ga0070666_11056898 Ga0070666_110568981 147
65 3300005336 Ga0070680_100176560 Ga0070680_1001765602 147
66 3300005341 Ga0070691_10884863 Ga0070691_108848631 147
67 3300005343 Ga0070687_100386379 Ga0070687_1003863792 147
68 3300005345 Ga0070692_10428273 Ga0070692_104282731 147
69 3300005353 Ga0070669_101450569 Ga0070669_1014505691 147
70 3300005444 Ga0070694_101132947 Ga0070694_1011329471 147
71 3300005530 Ga0070679_100971897 Ga0070679_1009718971 147
72 3300005544 Ga0070686_100775867 Ga0070686_1007758672 147
73 3300005545 Ga0070695_101165508 Ga0070695_1011655081 147
74 3300005616 Ga0068852_100735558 Ga0068852_1007355583 147
75 3300005617 Ga0068859_100101927 Ga0068859_1001019273 147
76 3300005841 Ga0068863_100310181 Ga0068863_1003101812 147
77 3300005844 Ga0068862_101356229 Ga0068862_1013562292 147
78 3300006844 Ga0075428_100606832 Ga0075428_1006068322 147
79 3300006881 Ga0068865_100310404 Ga0068865_1003104042 147
80 3300006931 Ga0097620_100101929 Ga0097620_1001019292 147
81 3300009094 Ga0111539_10022998 Ga0111539_100229987 147
82 3300009094 Ga0111539_10161271 Ga0111539_101612713 147
83 3300009148 Ga0105243_10032013 Ga0105243_100320132 147
84 3300013308 Ga0157375_11602300 Ga0157375_116023001 147
85 3300025273 Ga0209673_1004226 Ga0209673_10042262 147
86 3300025284 Ga0209130_1011043 Ga0209130_10110432 147
87 3300025291 Ga0209675_1012627 Ga0209675_10126272 147
88 3300025291 Ga0209675_1033439 Ga0209675_10334392 147
89 3300025292 Ga0209676_1000854 Ga0209676_100085437 147
90 3300025292 Ga0209676_1003068 Ga0209676_10030689 147
91 3300025292 Ga0209676_1008272 Ga0209676_10082722 147
92 3300025292 Ga0209676_1011203 Ga0209676_10112032 147
93 3300025292 Ga0209676_1046330 Ga0209676_10463302 147
94 3300025294 Ga0209025_1000562 Ga0209025_10005624 147
95 3300025294 Ga0209025_1021369 Ga0209025_10213692 147
96 3300025294 Ga0209025_1034969 Ga0209025_10349692 147
97 3300025294 Ga0209025_1092669 Ga0209025_10926692 147
98 3300025295 Ga0209564_1009229 Ga0209564_10092295 147
99 3300025295 Ga0209564_1045766 Ga0209564_10457662 147
100 3300025297 Ga0209758_1046506 Ga0209758_10465062 147
101 3300025297 Ga0209758_1063159 Ga0209758_10631592 147
102 3300025298 Ga0209050_1000932 Ga0209050_100093237 147
103 3300025299 Ga0209256_1000457 Ga0209256_100045753 147
104 3300025299 Ga0209256_1003363 Ga0209256_10033635 147
105 3300025299 Ga0209256_1008355 Ga0209256_10083552 147
106 3300025303 Ga0209051_1013564 Ga0209051_10135642 147
107 3300025303 Ga0209051_1074815 Ga0209051_10748152 147
108 3300025304 Ga0209257_1000065 Ga0209257_1000065325 147
109 3300025304 Ga0209257_1000529 Ga0209257_100052953 147
110 3300025304 Ga0209257_1000867 Ga0209257_10008677 147
111 3300025304 Ga0209257_1003596 Ga0209257_10035967 147
112 3300025304 Ga0209257_1037231 Ga0209257_10372312 147
113 3300025899 Ga0207642_10163752 Ga0207642_101637522 147
114 3300025917 Ga0207660_10025684 Ga0207660_100256842 147
115 3300025918 Ga0207662_10171159 Ga0207662_101711592 147
116 3300025921 Ga0207652_11072088 Ga0207652_110720881 147
117 3300025925 Ga0207650_10372968 Ga0207650_103729683 147
118 3300025935 Ga0207709_10025680 Ga0207709_100256804 147
119 3300025938 Ga0207704_10514538 Ga0207704_105145381 147
120 3300025941 Ga0207711_10358944 Ga0207711_103589442 147
121 3300025941 Ga0207711_10838613 Ga0207711_108386132 147
122 3300025942 Ga0207689_10138062 Ga0207689_101380622 147
123 3300026075 Ga0207708_10004515 Ga0207708_100045153 147
124 3300026088 Ga0207641_10398933 Ga0207641_103989332 147
125 3300026118 Ga0207675_100005119 Ga0207675_1000051193 147
126 3300027717 Ga0209998_10034491 Ga0209998_100344912 147
127 3300027907 Ga0207428_10151220 Ga0207428_101512202 147
128 3300028800 Ga0265338_10008392 Ga0265338_100083922 147
129 3300028800 Ga0265338_10145958 Ga0265338_101459582 147
130 3300031247 Ga0265340_10040808 Ga0265340_100408081 147
131 3300031251 Ga0265327_10000068 Ga0265327_1000006815 147
132 3300031548 Ga0307408_100053931 Ga0307408_1000539314 147
133 3300031901 Ga0307406_10528948 Ga0307406_105289482 147
134 3300031901 Ga0307406_10906196 Ga0307406_109061961 147
135 3300031995 Ga0307409_100847177 Ga0307409_1008471771 147
136 3300032002 Ga0307416_100820467 Ga0307416_1008204672 147
137 3300037471 Ga0395905_0003421 Ga0395905_0003421_2687_3136 147
138 3300041463 Ga0451804_1009426 Ga0451804_1009426_39_488 147
139 3300041503 Ga0451847_0252384 Ga0451847_0252384_56_499 147
140 3300041509 Ga0451843_1500063 Ga0451843_1500063_295_738 147
141 3300042006 Ga0439432_061937 Ga0439432_061937_601_1047 147
142 3300042007 Ga0439449_0001147 Ga0439449_0001147_252_701 147
143 3300042007 Ga0439449_0072254 Ga0439449_0072254_446_895 147
144 3300042010 Ga0439452_046485 Ga0439452_046485_256_705 147
145 3300049568 Ga0501031_0004736 Ga0501031_0004736_4808_5251 147
146 3300049569 Ga0501032_0002635 Ga0501032_0002635_912_1355 147
147 3300049570 Ga0501033_0016932 Ga0501033_0016932_1929_2372 147
148 3300049571 Ga0501034_0031738 Ga0501034_0031738_3409_3852 147
149 3300049571 Ga0501034_0040269 Ga0501034_0040269_4241_4684 147
150 3300049572 Ga0501036_0043442 Ga0501036_0043442_512_955 147
151 3300049572 Ga0501036_0370563 Ga0501036_0370563_234_677 147
152 3300049572 Ga0501036_0489803 Ga0501036_0489803_59_502 147
153 3300049573 Ga0501037_0070749 Ga0501037_0070749_92_535 147
154 3300049574 Ga0501038_0112039 Ga0501038_0112039_1250_1693 147
155 3300049574 Ga0501038_0141032 Ga0501038_0141032_790_1233 147
156 3300049574 Ga0501038_0144463 Ga0501038_0144463_1223_1666 147
157 3300049575 Ga0501039_0022548 Ga0501039_0022548_4269_4712 147
158 3300049575 Ga0501039_0032184 Ga0501039_0032184_3114_3557 147
159 3300049578 Ga0501042_0137038 Ga0501042_0137038_146_589 147
160 3300049578 Ga0501042_0721675 Ga0501042_0721675_201_644 147
161 3300049579 Ga0501043_0192981 Ga0501043_0192981_313_762 147
162 3300049581 Ga0501047_0034150 Ga0501047_0034150_4310_4753 147
163 3300049581 Ga0501047_0223950 Ga0501047_0223950_455_898 147
164 3300049581 Ga0501047_0366911 Ga0501047_0366911_68_511 147
165 3300049586 Ga0501070_0050237 Ga0501070_0050237_1840_2283 147
166 3300049586 Ga0501070_0507765 Ga0501070_0507765_174_626 147
167 3300049588 Ga0501072_0941306 Ga0501072_0941306_188_631 147
168 3300049589 Ga0501073_0044822 Ga0501073_0044822_460_903 147
169 3300049589 Ga0501073_0113992 Ga0501073_0113992_124_567 147
170 3300049705 Ga0501225_0193718 Ga0501225_0193718_68_517 147
171 3300049742 Ga0501080_0207500 Ga0501080_0207500_1239_1682 147
172 3300049742 Ga0501080_0927810 Ga0501080_0927810_39_482 147
173 3300049744 Ga0501083_0038149 Ga0501083_0038149_1665_2108 147
174 3300049766 Ga0501269_016839 Ga0501269_016839_253_696 147
175 3300049822 Ga0501035_0163731 Ga0501035_0163731_1368_1811 147
176 3300049823 Ga0501044_0033881 Ga0501044_0033881_1564_2007 147
177 3300049823 Ga0501044_0043103 Ga0501044_0043103_2253_2696 147
178 3300049823 Ga0501044_0173334 Ga0501044_0173334_1095_1538 147
179 3300049823 Ga0501044_0415048 Ga0501044_0415048_753_1196 147
180 3300050508 nmdc:mga09592_1491579_c1 nmdc:mga09592_1491579_c1_77_529 147
181 3300050511 nmdc:mga08y16_14842_c1 nmdc:mga08y16_14842_c1_2052_2504 147
182 3300050511 nmdc:mga08y16_211171_c1 nmdc:mga08y16_211171_c1_420_866 147
183 3300050515 nmdc:mga0a205_1008953_c1 nmdc:mga0a205_1008953_c1_98_541 147
184 3300053134 Ga0500658_0104843 Ga0500658_0104843_732_1181 147
185 3300059423 Ga0590074_038108 Ga0590074_038108_222_665 147
186 3300060353 Ga0501082_0326072 Ga0501082_0326072_197_640 147
187 iso_pu_bacteria 2511231002 2511246764 147
188 3300002705 JGI25156J39149_1000082 JGI25156J39149_100008241 148
189 3300002738 JGI25154J39366_1000061 JGI25154J39366_100006112 148
190 3300002738 JGI25154J39366_1000111 JGI25154J39366_100011141 148
191 3300002741 JGI25157J39369_1000006 JGI25157J39369_100000641 148
192 3300002773 JGI25152J39213_1000221 JGI25152J39213_100022130 148
193 3300002774 JGI25150J39212_1000535 JGI25150J39212_10005356 148
194 3300002774 JGI25150J39212_1023199 JGI25150J39212_10231991 148
195 3300002987 JGI25159J45721_1005326 JGI25159J45721_10053264 148
196 3300003187 JGI25151J46595_10000107 JGI25151J46595_1000010776 148
197 3300003187 JGI25151J46595_10080851 JGI25151J46595_100808511 148
198 3300003215 JGI25153J46596_10000078 JGI25153J46596_1000007876 148
199 3300003323 rootH1_10088272 rootH1_100882724 148
200 3300003354 JGI25160J50197_1000409 JGI25160J50197_100040928 148
201 3300003374 JGI25161J50226_1000030 JGI25161J50226_100003022 148
202 3300003752 Ga0055539_1001078 Ga0055539_10010786 148
203 3300003756 Ga0055533_1002783 Ga0055533_10027835 148
204 3300003760 Ga0055527_1000389 Ga0055527_100038911 148
205 3300003761 Ga0055535_1001515 Ga0055535_10015153 148
206 3300003762 Ga0055542_1000209 Ga0055542_100020911 148
207 3300003763 Ga0055529_1000229 Ga0055529_100022911 148
208 3300003771 Ga0055526_1010234 Ga0055526_10102345 148
209 3300003771 Ga0055526_1014692 Ga0055526_10146923 148
210 3300003773 Ga0055537_1000437 Ga0055537_10004372 148
211 3300003773 Ga0055537_1008541 Ga0055537_10085414 148
212 3300003775 Ga0055524_1000006 Ga0055524_1000006266 148
213 3300003781 Ga0055536_1002706 Ga0055536_100270610 148
214 3300003781 Ga0055536_1002756 Ga0055536_10027568 148
215 3300003784 Ga0055534_1001182 Ga0055534_100118212 148
216 3300003790 Ga0055528_1015217 Ga0055528_10152173 148
217 3300003791 Ga0055530_10000127 Ga0055530_1000012747 148
218 3300003792 Ga0055540_1000005 Ga0055540_100000547 148
219 3300003794 Ga0055531_10002136 Ga0055531_1000213612 148
220 3300003856 Ga0058692_1000017 Ga0058692_100001739 148
221 3300004625 Ga0055543_1000195 Ga0055543_100019513 148
222 3300005262 Ga0065165_1003553 Ga0065165_100355310 148
223 3300005262 Ga0065165_1003785 Ga0065165_10037852 148
224 3300005295 Ga0065707_10000773 Ga0065707_100007738 148
225 3300005331 Ga0070670_101703498 Ga0070670_1017034981 148
226 3300005338 Ga0068868_100081908 Ga0068868_1000819082 148
227 3300005353 Ga0070669_100009307 Ga0070669_1000093072 148
228 3300005365 Ga0070688_100229337 Ga0070688_1002293372 148
229 3300005436 Ga0070713_100173163 Ga0070713_1001731633 148
230 3300005441 Ga0070700_101464734 Ga0070700_1014647341 148
231 3300005445 Ga0070708_100610988 Ga0070708_1006109881 148
232 3300005445 Ga0070708_101290916 Ga0070708_1012909161 148
233 3300005456 Ga0070678_100475429 Ga0070678_1004754292 148
234 3300005458 Ga0070681_10442975 Ga0070681_104429752 148
235 3300005468 Ga0070707_100441619 Ga0070707_1004416192 148
236 3300005518 Ga0070699_100867288 Ga0070699_1008672881 148
237 3300005536 Ga0070697_100128147 Ga0070697_1001281472 148
238 3300005539 Ga0068853_101295680 Ga0068853_1012956801 148
239 3300005545 Ga0070695_100726652 Ga0070695_1007266522 148
240 3300005546 Ga0070696_100899798 Ga0070696_1008997981 148
241 3300005548 Ga0070665_100000213 Ga0070665_10000021367 148
242 3300005548 Ga0070665_100807650 Ga0070665_1008076502 148
243 3300005548 Ga0070665_101115712 Ga0070665_1011157122 148
244 3300005549 Ga0070704_100452632 Ga0070704_1004526321 148
245 3300005563 Ga0068855_100367272 Ga0068855_1003672721 148
246 3300005614 Ga0068856_100082326 Ga0068856_1000823262 148
247 3300005614 Ga0068856_100306818 Ga0068856_1003068182 148
248 3300005617 Ga0068859_101013578 Ga0068859_1010135782 148
249 3300005840 Ga0068870_10033595 Ga0068870_100335953 148
250 3300005840 Ga0068870_10046118 Ga0068870_100461182 148
251 3300005841 Ga0068863_100176885 Ga0068863_1001768852 148
252 3300005842 Ga0068858_100078317 Ga0068858_1000783172 148
253 3300005843 Ga0068860_100221953 Ga0068860_1002219532 148
254 3300005843 Ga0068860_100631447 Ga0068860_1006314471 148
255 3300005844 Ga0068862_101044828 Ga0068862_1010448282 148
256 3300005937 Ga0081455_10121420 Ga0081455_101214202 148
257 3300005981 Ga0081538_10326875 Ga0081538_103268751 148
258 3300006038 Ga0075365_10305371 Ga0075365_103053711 148
259 3300006051 Ga0075364_10237709 Ga0075364_102377092 148
260 3300006163 Ga0070715_10333835 Ga0070715_103338352 148
261 3300006173 Ga0070716_100289939 Ga0070716_1002899392 148
262 3300006353 Ga0075370_10217774 Ga0075370_102177742 148
263 3300006353 Ga0075370_10260359 Ga0075370_102603592 148
264 3300006358 Ga0068871_100424201 Ga0068871_1004242011 148
265 3300006358 Ga0068871_101051456 Ga0068871_1010514561 148
266 3300006844 Ga0075428_100148206 Ga0075428_1001482062 148
267 3300006844 Ga0075428_100355948 Ga0075428_1003559482 148
268 3300006847 Ga0075431_100065907 Ga0075431_1000659074 148
269 3300006852 Ga0075433_10358810 Ga0075433_103588102 148
270 3300006871 Ga0075434_100420406 Ga0075434_1004204062 148
271 3300006880 Ga0075429_100094773 Ga0075429_1000947732 148
272 3300006881 Ga0068865_100243567 Ga0068865_1002435672 148
273 3300006931 Ga0097620_101013679 Ga0097620_1010136792 148
274 3300006948 Ga0099826_10129078 Ga0099826_101290782 148
275 3300009094 Ga0111539_10320033 Ga0111539_103200332 148
276 3300009101 Ga0105247_10946259 Ga0105247_109462592 148
277 3300009177 Ga0105248_12170477 Ga0105248_121704771 148
278 3300009553 Ga0105249_10090956 Ga0105249_100909562 148
279 3300009553 Ga0105249_10339954 Ga0105249_103399541 148
280 3300010375 Ga0105239_10155823 Ga0105239_101558232 148
281 3300013308 Ga0157375_11019639 Ga0157375_110196392 148
282 3300013308 Ga0157375_11379154 Ga0157375_113791542 148
283 3300014325 Ga0163163_10827787 Ga0163163_108277872 148
284 3300014326 Ga0157380_10002627 Ga0157380_100026275 148
285 3300017792 Ga0163161_11939052 Ga0163161_119390521 148
286 3300025206 Ga0209435_100001 Ga0209435_100001207 148
287 3300025226 Ga0209674_100104 Ga0209674_10010467 148
288 3300025226 Ga0209674_100733 Ga0209674_1007339 148
289 3300025228 Ga0209672_100009 Ga0209672_100009468 148
290 3300025242 Ga0209258_100011 Ga0209258_100011176 148
291 3300025245 Ga0207425_1000028 Ga0207425_100002835 148
292 3300025246 Ga0209646_1000001 Ga0209646_1000001576 148
293 3300025250 Ga0209026_1000003 Ga0209026_1000003207 148
294 3300025253 Ga0209677_101852 Ga0209677_1018523 148
295 3300025254 Ga0209148_1000013 Ga0209148_1000013176 148
296 3300025256 Ga0209759_1000001 Ga0209759_1000001207 148
297 3300025258 Ga0209129_1000011 Ga0209129_1000011561 148
298 3300025263 Ga0209565_1000004 Ga0209565_1000004104 148
299 3300025263 Ga0209565_1000300 Ga0209565_100030028 148
300 3300025272 Ga0209455_1000012 Ga0209455_1000012176 148
301 3300025273 Ga0209673_1000045 Ga0209673_1000045268 148
302 3300025284 Ga0209130_1000060 Ga0209130_1000060162 148
303 3300025284 Ga0209130_1000544 Ga0209130_100054418 148
304 3300025291 Ga0209675_1000096 Ga0209675_100009647 148
305 3300025291 Ga0209675_1001988 Ga0209675_10019888 148
306 3300025291 Ga0209675_1023226 Ga0209675_10232263 148
307 3300025292 Ga0209676_1000007 Ga0209676_1000007650 148
308 3300025292 Ga0209676_1002647 Ga0209676_10026475 148
309 3300025292 Ga0209676_1003073 Ga0209676_10030736 148
310 3300025294 Ga0209025_1000002 Ga0209025_1000002237 148
311 3300025294 Ga0209025_1008588 Ga0209025_10085882 148
312 3300025294 Ga0209025_1019584 Ga0209025_10195844 148
313 3300025294 Ga0209025_1022240 Ga0209025_10222404 148
314 3300025294 Ga0209025_1052287 Ga0209025_10522872 148
315 3300025295 Ga0209564_1001166 Ga0209564_100116630 148
316 3300025295 Ga0209564_1001940 Ga0209564_10019406 148
317 3300025295 Ga0209564_1004359 Ga0209564_10043591 148
318 3300025297 Ga0209758_1000003 Ga0209758_1000003244 148
319 3300025298 Ga0209050_1000003 Ga0209050_1000003858 148
320 3300025298 Ga0209050_1002136 Ga0209050_100213616 148
321 3300025299 Ga0209256_1000001 Ga0209256_1000001864 148
322 3300025299 Ga0209256_1089353 Ga0209256_10893531 148
323 3300025302 Ga0207426_1000025 Ga0207426_100002583 148
324 3300025302 Ga0207426_1001283 Ga0207426_100128312 148
325 3300025303 Ga0209051_1000003 Ga0209051_1000003858 148
326 3300025304 Ga0209257_1000020 Ga0209257_1000020650 148
327 3300025304 Ga0209257_1002545 Ga0209257_10025452 148
328 3300025304 Ga0209257_1005401 Ga0209257_10054014 148
329 3300025893 Ga0207682_10021754 Ga0207682_100217543 148
330 3300025893 Ga0207682_10035809 Ga0207682_100358092 148
331 3300025908 Ga0207643_10428240 Ga0207643_104282401 148
332 3300025925 Ga0207650_11075312 Ga0207650_110753122 148
333 3300025938 Ga0207704_10248104 Ga0207704_102481041 148
334 3300025939 Ga0207665_10076121 Ga0207665_100761213 148
335 3300025949 Ga0207667_10223190 Ga0207667_102231902 148
336 3300025961 Ga0207712_10248562 Ga0207712_102485623 148
337 3300025961 Ga0207712_10474565 Ga0207712_104745651 148
338 3300025986 Ga0207658_11099867 Ga0207658_110998672 148
339 3300026023 Ga0207677_10035524 Ga0207677_100355245 148
340 3300026078 Ga0207702_10000136 Ga0207702_1000013645 148
341 3300026078 Ga0207702_10260314 Ga0207702_102603141 148
342 3300026088 Ga0207641_10884331 Ga0207641_108843311 148
343 3300026095 Ga0207676_11718888 Ga0207676_117188881 148
344 3300026116 Ga0207674_10326165 Ga0207674_103261652 148
345 3300026121 Ga0207683_10160501 Ga0207683_101605012 148
346 3300027312 Ga0209371_1000044 Ga0209371_100004498 148
347 3300027312 Ga0209371_1037316 Ga0209371_10373161 148
348 3300028379 Ga0268266_10000235 Ga0268266_1000023570 148
349 3300028379 Ga0268266_10001649 Ga0268266_1000164916 148
350 3300028379 Ga0268266_10076478 Ga0268266_100764783 148
351 3300028381 Ga0268264_10250358 Ga0268264_102503582 148
352 3300028654 Ga0265322_10086841 Ga0265322_100868412 148
353 3300029957 Ga0265324_10023544 Ga0265324_100235442 148
354 3300030500 Ga0268256_1000046 Ga0268256_100004698 148
355 3300030500 Ga0268256_1042470 Ga0268256_10424702 148
356 3300031238 Ga0265332_10002359 Ga0265332_100023596 148
357 3300031238 Ga0265332_10042677 Ga0265332_100426772 148
358 3300031242 Ga0265329_10003852 Ga0265329_100038522 148
359 3300031456 Ga0307513_10000895 Ga0307513_1000089520 148
360 3300031548 Ga0307408_100108324 Ga0307408_1001083242 148
361 3300031548 Ga0307408_100282911 Ga0307408_1002829113 148
362 3300031548 Ga0307408_101627890 Ga0307408_1016278901 148
363 3300031711 Ga0265314_10001049 Ga0265314_1000104922 148
364 3300031730 Ga0307516_10016756 Ga0307516_100167562 148
365 3300031901 Ga0307406_10048982 Ga0307406_100489821 148
366 3300031903 Ga0307407_10157691 Ga0307407_101576912 148
367 3300031903 Ga0307407_10476330 Ga0307407_104763301 148
368 3300031995 Ga0307409_100633479 Ga0307409_1006334792 148
369 3300032002 Ga0307416_101276898 Ga0307416_1012768982 148
370 3300032126 Ga0307415_100537931 Ga0307415_1005379311 148
371 3300035119 Ga0373956_0197087 Ga0373956_0197087_409_909 148
372 3300035691 Ga0373931_0098655 Ga0373931_0098655_313_759 148
373 3300036401 Ga0373937_0035024 Ga0373937_0035024_2719_3165 148
374 3300037312 Ga0395899_0413254 Ga0395899_0413254_297_743 148
375 3300037312 Ga0395899_0447269 Ga0395899_0447269_118_564 148
376 3300037418 Ga0395900_0071007 Ga0395900_0071007_49_495 148
377 3300037418 Ga0395900_0621515 Ga0395900_0621515_508_966 148
378 3300037466 Ga0395898_0039639 Ga0395898_0039639_4077_4523 148
379 3300037466 Ga0395898_0296664 Ga0395898_0296664_51_497 148
380 3300037466 Ga0395898_1111193 Ga0395898_1111193_144_590 148
381 3300037471 Ga0395905_0017634 Ga0395905_0017634_1225_1671 148
382 3300037471 Ga0395905_0138327 Ga0395905_0138327_370_912 148
383 3300038443 Ga0395901_0002112 Ga0395901_0002112_212_658 148
384 3300039437 Ga0436365_1058014 Ga0436365_1058014_19_468 148
385 3300041413 Ga0439465_0354302 Ga0439465_0354302_72_527 148
386 3300041451 Ga0451791_1307196 Ga0451791_1307196_86_532 148
387 3300041458 Ga0451798_0531006 Ga0451798_0531006_18_464 148
388 3300041459 Ga0451800_0855242 Ga0451800_0855242_99_545 148
389 3300041460 Ga0451802_0510565 Ga0451802_0510565_24_470 148
390 3300041460 Ga0451802_2085615 Ga0451802_2085615_18_464 148
391 3300041463 Ga0451804_0775093 Ga0451804_0775093_284_730 148
392 3300041486 Ga0451807_2590115 Ga0451807_2590115_138_584 148
393 3300041496 Ga0451839_0510055 Ga0451839_0510055_76_528 148
394 3300041512 Ga0451853_1316513 Ga0451853_1316513_345_791 148
395 3300041999 Ga0439433_0086039 Ga0439433_0086039_202_663 148
396 3300042006 Ga0439432_005457 Ga0439432_005457_82_543 148
397 3300042007 Ga0439449_0021113 Ga0439449_0021113_1449_1910 148
398 3300042437 Ga0439444_0038017 Ga0439444_0038017_457_903 148
399 3300042437 Ga0439444_0193516 Ga0439444_0193516_34_492 148
400 3300042876 Ga0451577_0001644 Ga0451577_0001644_24969_25421 148
401 3300042876 Ga0451577_0006876 Ga0451577_0006876_4856_5302 148
402 3300042876 Ga0451577_1436292 Ga0451577_1436292_55_501 148
403 3300044658 Ga0466972_0150972 Ga0466972_0150972_599_1045 148
404 3300044673 Ga0453683_0017633 Ga0453683_0017633_869_1315 148
405 3300044712 Ga0453684_0000189 Ga0453684_0000189_99767_100213 148
406 3300044712 Ga0453684_0001090 Ga0453684_0001090_16486_16938 148
407 3300044712 Ga0453684_0001369 Ga0453684_0001369_16472_16918 148
408 3300044712 Ga0453684_0025585 Ga0453684_0025585_7117_7563 148
409 3300044712 Ga0453684_0042921 Ga0453684_0042921_4811_5263 148
410 3300044712 Ga0453684_0139364 Ga0453684_0139364_550_996 148
411 3300044712 Ga0453684_0659689 Ga0453684_0659689_261_713 148
412 3300045051 Ga0451576_0000086 Ga0451576_0000086_106824_107276 148
413 3300045051 Ga0451576_0000245 Ga0451576_0000245_7802_8248 148
414 3300045051 Ga0451576_0045380 Ga0451576_0045380_56_502 148
415 3300045051 Ga0451576_0152548 Ga0451576_0152548_908_1375 148
416 3300045051 Ga0451576_0608139 Ga0451576_0608139_517_969 148
417 3300045051 Ga0451576_0992233 Ga0451576_0992233_61_507 148
418 3300047443 Ga0495687_026004 Ga0495687_026004_598_1053 148
419 3300047472 Ga0495686_0046612 Ga0495686_0046612_207_653 148
420 3300048921 Ga0496118_0056936 Ga0496118_0056936_1772_2227 148
421 3300049571 Ga0501034_0341257 Ga0501034_0341257_239_709 148
422 3300049571 Ga0501034_0706887 Ga0501034_0706887_124_582 148
423 3300049574 Ga0501038_0062121 Ga0501038_0062121_513_959 148
424 3300049574 Ga0501038_0770439 Ga0501038_0770439_197_655 148
425 3300049581 Ga0501047_0002212 Ga0501047_0002212_13261_13707 148
426 3300049583 Ga0501067_0207771 Ga0501067_0207771_249_695 148
427 3300049584 Ga0501068_0000018 Ga0501068_0000018_13600_14046 148
428 3300049585 Ga0501069_0042686 Ga0501069_0042686_318_764 148
429 3300049585 Ga0501069_0840381 Ga0501069_0840381_85_543 148
430 3300049586 Ga0501070_1280686 Ga0501070_1280686_39_485 148
431 3300049588 Ga0501072_0000083 Ga0501072_0000083_49726_50172 148
432 3300049589 Ga0501073_0108981 Ga0501073_0108981_803_1249 148
433 3300049590 Ga0501074_0051656 Ga0501074_0051656_112_558 148
434 3300049592 Ga0501076_0002755 Ga0501076_0002755_3463_3909 148
435 3300049593 Ga0501077_0001433 Ga0501077_0001433_8336_8782 148
436 3300049661 Ga0501217_109525 Ga0501217_109525_133_594 148
437 3300049741 Ga0501079_0051185 Ga0501079_0051185_1212_1658 148
438 3300049742 Ga0501080_0000562 Ga0501080_0000562_8334_8780 148
439 3300049744 Ga0501083_0080487 Ga0501083_0080487_503_949 148
440 3300049763 Ga0501266_030115 Ga0501266_030115_131_592 148
441 3300049823 Ga0501044_0013283 Ga0501044_0013283_8032_8478 148
442 3300049823 Ga0501044_0334199 Ga0501044_0334199_394_852 148
443 3300050491 nmdc:mga00v17_168647_c1 nmdc:mga00v17_168647_c1_585_1031 148
444 3300050492 nmdc:mga0yw44_214468_c1 nmdc:mga0yw44_214468_c1_513_959 148
445 3300050492 nmdc:mga0yw44_78144_c1 nmdc:mga0yw44_78144_c1_16_468 148
446 3300050493 nmdc:mga0k408_805187_c1 nmdc:mga0k408_805187_c1_20_466 148
447 3300050494 nmdc:mga06z11_195283_c1 nmdc:mga06z11_195283_c1_32_490 148
448 3300050496 nmdc:mga07m45_611858_c1 nmdc:mga07m45_611858_c1_40_486 148
449 3300050496 nmdc:mga07m45_99556_c1 nmdc:mga07m45_99556_c1_664_1122 148
450 3300050508 nmdc:mga09592_89270_c1 nmdc:mga09592_89270_c1_1535_1996 148
451 3300050512 nmdc:mga0n895_59991_c1 nmdc:mga0n895_59991_c1_750_1196 148
452 3300050515 nmdc:mga0a205_55425_c1 nmdc:mga0a205_55425_c1_1176_1622 148
453 3300053096 Ga0500641_0092798 Ga0500641_0092798_535_981 148
454 3300053138 Ga0500564_081044 Ga0500564_081044_511_957 148
455 3300053730 Ga0500645_000094 Ga0500645_000094_45299_45745 148
456 3300053730 Ga0500645_017942 Ga0500645_017942_1432_1878 148
457 3300054114 Ga0501084_0000047 Ga0501084_0000047_45853_46299 148
458 3300055283 Ga0500661_008503 Ga0500661_008503_800_1246 148
459 3300060353 Ga0501082_0000328 Ga0501082_0000328_13214_13660 148
460 iso_pu_bacteria 8021648035 8021650166 148
461 2162886007 SwRhRL2b_contig_1724449 SwRhRL2b_0370.00002290 149
462 3300005466 Ga0070685_10005743 Ga0070685_100057432 149
463 3300006237 Ga0097621_101793494 Ga0097621_1017934941 149
464 3300014326 Ga0157380_11092854 Ga0157380_110928541 149
465 3300044658 Ga0466972_0065038 Ga0466972_0065038_307_756 149
466 3300044901 Ga0466960_0002806 Ga0466960_0002806_1783_2232 149
467 3300047320 Ga0495672_0013843 Ga0495672_0013843_4979_5428 149
468 3300047472 Ga0495686_0041506 Ga0495686_0041506_1659_2108 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

19

148

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9929 5 146
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9926 5 146
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9905 5 146
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9787 5 146
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9765 5 146
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9927 5 146 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9783 5 146 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8506 5 145 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.845 5 145 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8447 4 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0H3U7B5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9994 4 149 GO:0016747
AF-A0A013SRK5-F1-model_v4 deleted 0.9994 16 149
AF-A0A1C6NIL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9981 3 146
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 0.9976 5 149
AF-A0A530H529-F1-model_v4 Toxin 0.9973 4 137

Feature Viewer

pLDDT pTM Quality
95.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map