F450065

General Info

Members Datasets Scaffolds Average Seq Length
468 253 936 238

Family's Representative Sequence

Representative Sequence 3300034957|Ga0373938_0006106|Ga0373938_0006106_1179_1973
Length 264
Sequence MGRRTDRRNHRQVTKIIREDIVAVERFDFQCGSVKAKHALVWNEKVSGKRPLLLLMPNWLGVTEPAIKRAQKMAGDKYIALVADMYGEGKTCEGPPTSQEWMMAVRADRVEGRKRANAAMACLVAEADKRGIGDSTKKAAVGFCFGGGNVLELARSGADVNAVVCLHGDLATTMPAKKGDIKAAVFVIHGSKDPVAPKADRDALEAELDGAGANWQTLDFGGRLHSFAEEETMMKGVAEYNAPAAHQTFRMLDDFIQDAFNKKL

Samples

Sample ID Description Type Environment
1 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
245 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
246 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
247 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
248 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
249 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
250 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
251 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
252 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
253 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 2.14
Rhizoplane 4.7
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 9.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373938_0006106 3300034957 Bacteria 2070
2 JGI25153J46596_10014971 3300003215 Bacteria 3187
3 JGI25404J52841_10000166 3300003659 Bacteria 7502
4 Ga0070670_100120934 3300005331 Bacteria 2259
5 Ga0070689_100025975 3300005340 Bacteria 4404
6 Ga0070689_100239903 3300005340 Bacteria 1493
7 Ga0070671_100018025 3300005355 Bacteria 5729
8 Ga0070671_100104421 3300005355 Bacteria 2378
9 Ga0070673_100231657 3300005364 Bacteria 1602
10 Ga0070688_100010264 3300005365 Bacteria 5157
11 Ga0070714_100088724 3300005435 Bacteria 2706
12 Ga0070713_100104353 3300005436 Bacteria 2461
13 Ga0070713_100151573 3300005436 Bacteria 2063
14 Ga0070713_100387696 3300005436 Bacteria 1303
15 Ga0070710_10016791 3300005437 Bacteria 3732
16 Ga0070710_10124907 3300005437 Bacteria 1562
17 Ga0070711_100023060 3300005439 Bacteria 4043
18 Ga0070711_100023567 3300005439 Bacteria 4005
19 Ga0070711_100024780 3300005439 Bacteria 3919
20 Ga0070681_10006073 3300005458 Bacteria 11714
21 Ga0070681_10154693 3300005458 Bacteria 2219
22 Ga0070681_10420276 3300005458 Bacteria 1249
23 Ga0070679_100002677 3300005530 Bacteria 16220
24 Ga0070684_100399746 3300005535 Bacteria 1266
25 Ga0070665_100765255 3300005548 Bacteria 979
26 Ga0068855_100838558 3300005563 Bacteria 975
27 Ga0068859_100037706 3300005617 Bacteria 4851
28 Ga0068864_100036151 3300005618 Bacteria 4208
29 Ga0068861_100066263 3300005719 Bacteria 2784
30 Ga0068863_100223134 3300005841 Unclassified 1816
31 Ga0068860_100001474 3300005843 Bacteria 25421
32 Ga0068860_100301295 3300005843 Bacteria 1570
33 Ga0081540_1000259 3300005983 Bacteria 55849
34 Ga0081540_1006326 3300005983 Bacteria 8651
35 Ga0081539_10041643 3300005985 Bacteria 2682
36 Ga0070717_10113306 3300006028 Bacteria 2315
37 Ga0070717_10140660 3300006028 Bacteria 2081
38 Ga0070717_10245991 3300006028 Unclassified 1579
39 Ga0075363_100001737 3300006048 Bacteria 8479
40 Ga0075364_10001140 3300006051 Bacteria 14195
41 Ga0070715_10054928 3300006163 Bacteria 1726
42 Ga0070715_10164133 3300006163 Unclassified 1100
43 Ga0070712_100070962 3300006175 Bacteria 2491
44 Ga0070712_100137581 3300006175 Bacteria 1859
45 Ga0075362_10002850 3300006177 Bacteria 5906
46 Ga0075367_10114315 3300006178 Unclassified 1659
47 Ga0075369_10044240 3300006186 Bacteria 1912
48 Ga0075366_10000583 3300006195 Bacteria 17127
49 Ga0075366_10163886 3300006195 Bacteria 1347
50 Ga0075430_100077662 3300006846 Bacteria 2783
51 Ga0075434_100016316 3300006871 Bacteria 7139
52 Ga0075434_100151934 3300006871 Bacteria 2336
53 Ga0075436_100000662 3300006914 Bacteria 22706
54 Ga0075436_100057625 3300006914 Bacteria 2683
55 Ga0097620_100037705 3300006931 Bacteria 4851
56 Ga0075435_100095189 3300007076 Bacteria 2462
57 Ga0099795_10022958 3300007788 Bacteria 2065
58 Ga0111539_10082507 3300009094 Bacteria 3781
59 Ga0105241_10002179 3300009174 Bacteria 14758
60 Ga0105248_10010945 3300009177 Bacteria 10011
61 Ga0105248_10659537 3300009177 Bacteria 1180
62 Ga0105249_10228828 3300009553 Unclassified 1833
63 Ga0099796_10058256 3300010159 Bacteria 1361
64 Ga0157378_10486556 3300013297 Bacteria 1230
65 Ga0157378_10624436 3300013297 Bacteria 1091
66 Ga0157378_11141208 3300013297 Unclassified 817
67 Ga0163162_10697387 3300013306 Bacteria 1137
68 Ga0163162_10794392 3300013306 Bacteria 1064
69 Ga0163163_10306596 3300014325 Bacteria 1640
70 Ga0157379_10991728 3300014968 Bacteria 800
71 Ga0157376_10418852 3300014969 Bacteria 1299
72 Ga0213876_10080910 3300021384 Bacteria 1718
73 Ga0213875_10000708 3300021388 Bacteria 25616
74 Ga0209233_1016781 3300025261 Bacteria 2010
75 Ga0209758_1000802 3300025297 Bacteria 44561
76 Ga0207426_1041810 3300025302 Bacteria 1418
77 Ga0207692_10099780 3300025898 Bacteria 1591
78 Ga0207710_10256827 3300025900 Bacteria 875
79 Ga0207688_10158335 3300025901 Bacteria 1341
80 Ga0207685_10118862 3300025905 Bacteria 1157
81 Ga0207699_10077126 3300025906 Bacteria 2055
82 Ga0207699_10081675 3300025906 Bacteria 2006
83 Ga0207699_10092823 3300025906 Bacteria 1898
84 Ga0207654_10078572 3300025911 Bacteria 1980
85 Ga0207707_10051225 3300025912 Bacteria 3595
86 Ga0207693_10027134 3300025915 Bacteria 4528
87 Ga0207693_10056452 3300025915 Bacteria 3078
88 Ga0207693_10133201 3300025915 Bacteria 1953
89 Ga0207663_10045291 3300025916 Bacteria 2705
90 Ga0207660_10099147 3300025917 Bacteria 2173
91 Ga0207662_10078964 3300025918 Bacteria 2004
92 Ga0207700_10037407 3300025928 Bacteria 3515
93 Ga0207700_10083208 3300025928 Bacteria 2505
94 Ga0207700_10219939 3300025928 Bacteria 1609
95 Ga0207700_10599318 3300025928 Bacteria 980
96 Ga0207664_10011878 3300025929 Bacteria 6212
97 Ga0207664_10076658 3300025929 Bacteria 2707
98 Ga0207644_10199494 3300025931 Unclassified 1578
99 Ga0207706_10510736 3300025933 Bacteria 1037
100 Ga0207686_10300317 3300025934 Bacteria 1192
101 Ga0207670_10001207 3300025936 Bacteria 13650
102 Ga0207669_10008988 3300025937 Bacteria 4726
103 Ga0207704_10093500 3300025938 Bacteria 1982
104 Ga0207665_10062786 3300025939 Unclassified 2521
105 Ga0207665_10104374 3300025939 Bacteria 1983
106 Ga0207691_10208570 3300025940 Bacteria 1698
107 Ga0207711_10006255 3300025941 Bacteria 10044
108 Ga0207711_10518184 3300025941 Bacteria 1112
109 Ga0207667_10668650 3300025949 Bacteria 1043
110 Ga0207640_10624015 3300025981 Bacteria 915
111 Ga0207658_10801399 3300025986 Unclassified 855
112 Ga0207678_10249360 3300026067 Bacteria 1520
113 Ga0207648_10654886 3300026089 Bacteria 971
114 Ga0207676_10043691 3300026095 Bacteria 3452
115 Ga0207675_100384709 3300026118 Bacteria 1380
116 Ga0207683_10062486 3300026121 Bacteria 3279
117 Ga0207698_10395223 3300026142 Bacteria 1320
118 Ga0209179_1008740 3300027512 Bacteria 1717
119 Ga0210002_1000713 3300027617 Bacteria 4488
120 Ga0209813_10032937 3300027866 Bacteria 1538
121 Ga0207428_10123498 3300027907 Bacteria 1984
122 Ga0268266_10064096 3300028379 Unclassified 3174
123 Ga0268266_10862840 3300028379 Unclassified 875
124 Ga0268264_10000119 3300028381 Bacteria 192507
125 Ga0268264_10580985 3300028381 Bacteria 1102
126 Ga0265338_10012118 3300028800 Bacteria 9850
127 Ga0265338_10074649 3300028800 Bacteria 2882
128 Ga0265338_10092472 3300028800 Bacteria 2494
129 Ga0265325_10000290 3300031241 Bacteria 35188
130 Ga0265325_10000703 3300031241 Bacteria 24247
131 Ga0265325_10017216 3300031241 Bacteria 4019
132 Ga0265325_10063012 3300031241 Bacteria 1877
133 Ga0265325_10107163 3300031241 Bacteria 1362
134 Ga0265340_10018485 3300031247 Bacteria 3594
135 Ga0265340_10108267 3300031247 Bacteria 1286
136 Ga0265339_10059349 3300031249 Bacteria 2063
137 Ga0265339_10117556 3300031249 Bacteria 1369
138 Ga0265316_10013332 3300031344 Bacteria 7307
139 Ga0265313_10007247 3300031595 Bacteria 7628
140 Ga0265313_10073692 3300031595 Bacteria 1567
141 Ga0265314_10006219 3300031711 Bacteria 10601
142 Ga0265314_10007314 3300031711 Bacteria 9589
143 Ga0265314_10081469 3300031711 Bacteria 2132
144 Ga0265342_10033953 3300031712 Bacteria 3133
145 Ga0307407_10415599 3300031903 Bacteria 968
146 Ga0373959_0021380 3300034820 Bacteria 1242
147 Ga0373926_0095301 3300035083 Bacteria 1109
148 Ga0373934_0015282 3300035086 Unclassified 2912
149 Ga0373944_0015875 3300035089 Bacteria 2117
150 Ga0373923_0001201 3300035111 Bacteria 7249
151 Ga0373923_0297012 3300035111 Bacteria 764
152 Ga0373936_0000313 3300035113 Bacteria 16365
153 Ga0373939_0026792 3300035114 Bacteria 1628
154 Ga0373945_0044786 3300035116 Bacteria 1610
155 Ga0373953_0059444 3300035117 Unclassified 1560
156 Ga0373954_0003371 3300035118 Bacteria 6762
157 Ga0373954_0055200 3300035118 Bacteria 1869
158 Ga0373956_0016620 3300035119 Unclassified 3092
159 Ga0373956_0018727 3300035119 Bacteria 2934
160 Ga0373956_0038775 3300035119 Bacteria 2109
161 Ga0373957_0001478 3300035120 Bacteria 6365
162 Ga0373957_0014585 3300035120 Unclassified 2689
163 Ga0373957_0015624 3300035120 Bacteria 2616
164 Ga0373943_0004213 3300035170 Bacteria 6522
165 Ga0373943_0052925 3300035170 Bacteria 2003
166 Ga0373943_0073626 3300035170 Bacteria 1735
167 Ga0373946_0004995 3300035171 Bacteria 4776
168 Ga0373946_0035554 3300035171 Bacteria 2016
169 Ga0373946_0045265 3300035171 Bacteria 1820
170 Ga0373946_0247182 3300035171 Bacteria 869
171 Ga0373955_0001318 3300035172 Bacteria 10519
172 Ga0373955_0001995 3300035172 Bacteria 8810
173 Ga0373924_0029578 3300035410 Bacteria 2191
174 Ga0373924_0232914 3300035410 Bacteria 814
175 Ga0373924_0322003 3300035410 Bacteria 688
176 Ga0373931_0002207 3300035691 Bacteria 8601
177 Ga0373931_0004826 3300035691 Bacteria 6191
178 Ga0373935_0000125 3300035692 Bacteria 34551
179 Ga0373935_0214830 3300035692 Bacteria 1334
180 Ga0373927_0002095 3300035695 Bacteria 14722
181 Ga0373927_0018288 3300035695 Bacteria 4606
182 Ga0373927_0071774 3300035695 Bacteria 2241
183 Ga0373927_0079482 3300035695 Bacteria 2125
184 Ga0373933_0001665 3300035724 Bacteria 12922
185 Ga0373933_0009272 3300035724 Bacteria 5374
186 Ga0373933_0012698 3300035724 Bacteria 4655
187 Ga0373933_0201978 3300035724 Unclassified 1272
188 Ga0373947_0001216 3300035725 Bacteria 15849
189 Ga0373947_0001307 3300035725 Bacteria 15330
190 Ga0373947_0025075 3300035725 Bacteria 3477
191 Ga0373947_0068181 3300035725 Bacteria 2175
192 Ga0373947_0247300 3300035725 Bacteria 1178
193 Ga0373937_0000325 3300036401 Bacteria 45263
194 Ga0373937_0012688 3300036401 Bacteria 7414
195 Ga0373937_0243325 3300036401 Bacteria 1695
196 Ga0373937_0626833 3300036401 Bacteria 1020
197 Ga0373937_0917104 3300036401 Bacteria 825
198 Ga0373925_0000019 3300037068 Bacteria 170628
199 Ga0373925_0024551 3300037068 Bacteria 4401
200 Ga0373925_0124369 3300037068 Bacteria 2005
201 Ga0373925_0473219 3300037068 Unclassified 1027
202 Ga0436364_0304270 3300037853 Bacteria 2140
203 Ga0436364_1119186 3300037853 Bacteria 34885
204 Ga0436365_1169663 3300039437 Bacteria 2803
205 Ga0436365_1533257 3300039437 Bacteria 745
206 Ga0436360_1047866 3300039438 Bacteria 961
207 Ga0439453_0046253 3300041408 Bacteria 868
208 Ga0466966_0025663 3300044684 Bacteria 3849
209 Ga0466963_0009418 3300044694 Bacteria 5882
210 Ga0466963_0027304 3300044694 Bacteria 3654
211 Ga0466963_0106335 3300044694 Bacteria 1924
212 Ga0466957_0165428 3300044842 Bacteria 1438
213 Ga0466959_0065480 3300045049 Bacteria 2637
214 Ga0466958_0225731 3300045836 Bacteria 1195
215 Ga0466967_0005150 3300045976 Bacteria 8993
216 Ga0466967_0160945 3300045976 Bacteria 2107
217 Ga0466967_0188342 3300045976 Bacteria 1949
218 Ga0495592_0000005 3300046454 Bacteria 194493
219 Ga0495592_0025711 3300046454 Bacteria 4468
220 Ga0495592_0067108 3300046454 Unclassified 2623
221 Ga0495592_0270411 3300046454 Bacteria 1115
222 Ga0495603_0140941 3300046455 Unclassified 1402
223 Ga0495629_0003620 3300046459 Bacteria 11679
224 Ga0495629_0005426 3300046459 Bacteria 9506
225 Ga0495629_0179161 3300046459 Bacteria 1469
226 Ga0495629_0362158 3300046459 Unclassified 988
227 Ga0495638_0006029 3300046460 Bacteria 8872
228 Ga0495638_0150357 3300046460 Bacteria 1351
229 Ga0495651_0002953 3300046462 Bacteria 13140
230 Ga0495651_0029406 3300046462 Bacteria 4284
231 Ga0495651_0072024 3300046462 Unclassified 2626
232 Ga0495651_0078182 3300046462 Bacteria 2503
233 Ga0495651_0262987 3300046462 Bacteria 1173
234 Ga0495651_0333295 3300046462 Bacteria 1008
235 Ga0495653_0000017 3300046463 Bacteria 190660
236 Ga0495653_0122058 3300046463 Unclassified 1855
237 Ga0495582_0068552 3300046473 Unclassified 1960
238 Ga0495639_0088707 3300046475 Unclassified 1449
239 Ga0495662_0001372 3300046476 Bacteria 12048
240 Ga0495662_0002323 3300046476 Bacteria 9591
241 Ga0495664_0000014 3300046477 Bacteria 193962
242 Ga0495664_0061107 3300046477 Bacteria 2244
243 Ga0495608_0000034 3300046511 Bacteria 136686
244 Ga0495608_0091802 3300046511 Bacteria 1963
245 Ga0495618_0000011 3300046514 Bacteria 179208
246 Ga0495618_0001061 3300046514 Bacteria 18746
247 Ga0495618_0023763 3300046514 Bacteria 3793
248 Ga0495618_0162742 3300046514 Unclassified 1422
249 Ga0495628_0000017 3300046516 Bacteria 169983
250 Ga0495628_0016821 3300046516 Bacteria 6094
251 Ga0495630_0000691 3300046517 Bacteria 24194
252 Ga0495630_0246043 3300046517 Bacteria 1366
253 Ga0495652_0000008 3300046529 Bacteria 343637
254 Ga0495652_0029907 3300046529 Bacteria 4780
255 Ga0495665_0026723 3300046531 Bacteria 3100
256 Ga0495640_0000033 3300046533 Bacteria 74992
257 Ga0495640_0001271 3300046533 Bacteria 19772
258 Ga0495640_0064854 3300046533 Bacteria 2468
259 Ga0495640_0088456 3300046533 Unclassified 2047
260 Ga0495586_0016045 3300046535 Unclassified 3986
261 Ga0495586_0266602 3300046535 Bacteria 979
262 Ga0495587_0000039 3300046536 Bacteria 114200
263 Ga0495587_0037336 3300046536 Bacteria 2917
264 Ga0495645_0000006 3300046543 Bacteria 382503
265 Ga0495645_0004596 3300046543 Bacteria 9424
266 Ga0495667_0000026 3300046559 Bacteria 154971
267 Ga0495667_0008435 3300046559 Bacteria 6995
268 Ga0495667_0064193 3300046559 Bacteria 2402
269 Ga0495667_0109224 3300046559 Bacteria 1787
270 Ga0495634_0000009 3300046642 Bacteria 162893
271 Ga0495634_0057051 3300046642 Bacteria 2607
272 Ga0495634_0065089 3300046642 Unclassified 2416
273 Ga0495634_0095246 3300046642 Bacteria 1928
274 Ga0495635_0000014 3300046663 Bacteria 218080
275 Ga0495635_0004098 3300046663 Bacteria 10117
276 Ga0495635_0096271 3300046663 Bacteria 2023
277 Ga0495635_0153643 3300046663 Unclassified 1567
278 Ga0495635_0209578 3300046663 Bacteria 1320
279 Ga0495588_0063778 3300046674 Unclassified 1911
280 Ga0495657_0000499 3300046675 Bacteria 36812
281 Ga0495657_0029711 3300046675 Bacteria 3832
282 Ga0495657_0037125 3300046675 Bacteria 3361
283 Ga0495599_0000010 3300046678 Bacteria 211658
284 Ga0495599_0021160 3300046678 Bacteria 4057
285 Ga0495599_0130655 3300046678 Bacteria 1560
286 Ga0495623_0000147 3300046679 Bacteria 43228
287 Ga0495623_0277479 3300046679 Bacteria 934
288 Ga0495646_0000008 3300046680 Bacteria 214486
289 Ga0495646_0140281 3300046680 Bacteria 1352
290 Ga0495646_0156994 3300046680 Bacteria 1262
291 Ga0495646_0217800 3300046680 Bacteria 1034
292 Ga0495658_0004417 3300046683 Bacteria 6924
293 Ga0495658_0076941 3300046683 Unclassified 1951
294 Ga0495613_0024586 3300046689 Bacteria 4488
295 Ga0495613_0213180 3300046689 Unclassified 1357
296 Ga0495613_0261058 3300046689 Bacteria 1207
297 Ga0495624_0002554 3300046690 Bacteria 13785
298 Ga0495624_0011021 3300046690 Bacteria 6223
299 Ga0495624_0227242 3300046690 Bacteria 1131
300 Ga0495600_0000096 3300046809 Bacteria 48341
301 Ga0495600_0002141 3300046809 Bacteria 11187
302 Ga0495600_0075411 3300046809 Bacteria 2203
303 Ga0495600_0143248 3300046809 Bacteria 1550
304 Ga0495581_0088430 3300047315 Bacteria 1796
305 Ga0495604_0000006 3300047317 Bacteria 420480
306 Ga0495604_0009373 3300047317 Bacteria 7744
307 Ga0495674_0000009 3300047319 Bacteria 310479
308 Ga0495674_0010456 3300047319 Bacteria 8786
309 Ga0495674_0011123 3300047319 Bacteria 8496
310 Ga0495676_0202634 3300047321 Bacteria 1378
311 Ga0495680_0000471 3300047322 Bacteria 45389
312 Ga0495680_0012338 3300047322 Bacteria 7524
313 Ga0495680_0038689 3300047322 Unclassified 3810
314 Ga0495680_0039229 3300047322 Bacteria 3779
315 Ga0495680_0050909 3300047322 Bacteria 3237
316 Ga0495675_0000210 3300047444 Bacteria 42392
317 Ga0495675_0035768 3300047444 Bacteria 3171
318 Ga0495675_0113165 3300047444 Unclassified 1693
319 Ga0495684_0000015 3300047471 Bacteria 169596
320 Ga0495684_0005078 3300047471 Bacteria 10265
321 Ga0495684_0041869 3300047471 Bacteria 3509
322 Ga0495684_0105548 3300047471 Bacteria 2128
323 Ga0495684_0250520 3300047471 Unclassified 1289
324 Ga0495593_0000958 3300047673 Bacteria 16882
325 Ga0495593_0113557 3300047673 Bacteria 1382
326 Ga0495602_0000006 3300048088 Bacteria 322593
327 Ga0495602_0028761 3300048088 Bacteria 5311
328 Ga0495602_0054261 3300048088 Bacteria 3540
329 Ga0495602_0073438 3300048088 Unclassified 2912
330 Ga0495602_0123817 3300048088 Bacteria 2075
331 Ga0496100_0018540 3300048903 Bacteria 4130
332 Ga0496101_0001810 3300048904 Bacteria 12876
333 Ga0496104_0000055 3300048907 Bacteria 124267
334 Ga0496104_0219000 3300048907 Unclassified 1816
335 Ga0496105_0004656 3300048908 Bacteria 10342
336 Ga0496105_0048558 3300048908 Bacteria 3503
337 Ga0496106_0031949 3300048909 Bacteria 3923
338 Ga0496107_0052644 3300048910 Bacteria 2936
339 Ga0496108_0161928 3300048911 Bacteria 1934
340 Ga0496110_0524485 3300048913 Bacteria 1077
341 Ga0496110_0633905 3300048913 Bacteria 968
342 Ga0496111_0026770 3300048914 Bacteria 4074
343 Ga0496111_0296893 3300048914 Bacteria 1198
344 Ga0496112_0592960 3300048915 Bacteria 1040
345 Ga0496113_0104474 3300048916 Bacteria 2198
346 Ga0496114_0016032 3300048917 Bacteria 6029
347 Ga0496114_0050124 3300048917 Bacteria 3475
348 Ga0496114_0448790 3300048917 Bacteria 1142
349 Ga0496115_0043164 3300048918 Bacteria 3595
350 Ga0496115_0044225 3300048918 Bacteria 3551
351 Ga0496115_0052060 3300048918 Bacteria 3284
352 Ga0496115_0420397 3300048918 Unclassified 1083
353 Ga0496119_0251371 3300048922 Bacteria 891
354 Ga0496121_0001142 3300048924 Bacteria 46580
355 Ga0496126_0277945 3300048929 Bacteria 1388
356 Ga0501031_0059390 3300049568 Bacteria 2492
357 Ga0501031_0092367 3300049568 Bacteria 1975
358 Ga0501032_0028378 3300049569 Bacteria 3845
359 Ga0501033_0082038 3300049570 Bacteria 2365
360 Ga0501033_0302995 3300049570 Bacteria 1124
361 Ga0501034_0009010 3300049571 Bacteria 10481
362 Ga0501034_0026668 3300049571 Bacteria 5880
363 Ga0501034_0163557 3300049571 Bacteria 2195
364 Ga0501034_0229296 3300049571 Bacteria 1807
365 Ga0501034_0266863 3300049571 Bacteria 1653
366 Ga0501036_0030950 3300049572 Bacteria 4522
367 Ga0501038_0012012 3300049574 Bacteria 7909
368 Ga0501038_0248394 3300049574 Bacteria 1410
369 Ga0501039_0016379 3300049575 Bacteria 5680
370 Ga0501043_0006297 3300049579 Bacteria 9530
371 Ga0501043_0483097 3300049579 Bacteria 927
372 Ga0501046_0078826 3300049580 Bacteria 2547
373 Ga0501047_0036451 3300049581 Bacteria 4753
374 Ga0501047_0191236 3300049581 Bacteria 1910
375 Ga0501047_0215518 3300049581 Bacteria 1777
376 Ga0501048_0031280 3300049582 Bacteria 3850
377 Ga0501068_0006518 3300049584 Bacteria 6441
378 Ga0501069_0001041 3300049585 Bacteria 13260
379 Ga0501069_0081860 3300049585 Bacteria 1819
380 Ga0501070_0167490 3300049586 Bacteria 1810
381 Ga0501071_0058478 3300049587 Bacteria 2788
382 Ga0501073_0018041 3300049589 Bacteria 5103
383 Ga0501073_0494012 3300049589 Bacteria 846
384 Ga0501074_0013637 3300049590 Bacteria 5907
385 Ga0501077_0494983 3300049593 Bacteria 784
386 Ga0501079_0110039 3300049741 Bacteria 2140
387 Ga0501080_0020465 3300049742 Bacteria 6126
388 Ga0501080_0091251 3300049742 Bacteria 2830
389 Ga0501083_0042197 3300049744 Bacteria 3093
390 Ga0501083_0066098 3300049744 Bacteria 2408
391 Ga0501083_0190517 3300049744 Bacteria 1338
392 Ga0501035_0027579 3300049822 Bacteria 5190
393 Ga0501044_0000708 3300049823 Bacteria 40261
394 Ga0501044_0202938 3300049823 Bacteria 1940
395 Ga0501044_0560668 3300049823 Bacteria 1038
396 Ga0501045_0129175 3300049824 Bacteria 1878
397 Ga0501045_0255597 3300049824 Bacteria 1304
398 nmdc:mga03n38_8914_c1 3300050490 Unclassified 3622
399 nmdc:mga00v17_43523_c1 3300050491 Unclassified 2704
400 nmdc:mga0yw44_116007_c1 3300050492 Bacteria 1721
401 nmdc:mga0k408_1931_c1 3300050493 Bacteria 11100
402 nmdc:mga0k408_448215_c1 3300050493 Bacteria 766
403 nmdc:mga0k408_53633_c1 3300050493 Bacteria 2337
404 nmdc:mga06z11_162111_c1 3300050494 Bacteria 1279
405 nmdc:mga06z11_40054_c1 3300050494 Unclassified 2336
406 nmdc:mga04h51_63876_c1 3300050495 Bacteria 1269
407 nmdc:mga07m45_151157_c1 3300050496 Bacteria 1346
408 nmdc:mga07m45_244792_c1 3300050496 Bacteria 1043
409 nmdc:mga07m45_32309_c1 3300050496 Bacteria 2903
410 nmdc:mga09592_565087_c1 3300050508 Bacteria 976
411 nmdc:mga0qj67_86094_c1 3300050509 Bacteria 2521
412 nmdc:mga08y16_721980_c1 3300050511 Bacteria 994
413 nmdc:mga08y16_76862_c1 3300050511 Bacteria 3480
414 nmdc:mga0n895_146496_c1 3300050512 Bacteria 2391
415 nmdc:mga0n895_21286_c1 3300050512 Bacteria 6059
416 nmdc:mga08x19_1998_c1 3300050514 Bacteria 12485
417 nmdc:mga08x19_217485_c1 3300050514 Bacteria 1312
418 nmdc:mga08x19_260670_c1 3300050514 Unclassified 1198
419 nmdc:mga0sz30_72303_c1 3300050516 Bacteria 1486
420 Ga0495601_0000007 3300053077 Bacteria 365972
421 Ga0495601_0000813 3300053077 Bacteria 16898
422 Ga0495601_0027022 3300053077 Bacteria 3546
423 Ga0495601_0029940 3300053077 Unclassified 3380
424 Ga0495612_0000015 3300053078 Bacteria 167816
425 Ga0495612_0003012 3300053078 Bacteria 6995
426 Ga0495595_0000079 3300053084 Bacteria 46734
427 Ga0495595_0002208 3300053084 Bacteria 7565
428 Ga0495595_0005367 3300053084 Bacteria 5190
429 Ga0495595_0016865 3300053084 Bacteria 3133
430 Ga0495595_0076930 3300053084 Bacteria 1584
431 Ga0495619_0000017 3300053085 Bacteria 219276
432 Ga0495619_0000635 3300053085 Bacteria 23185
433 Ga0495619_0000882 3300053085 Bacteria 19725
434 Ga0495619_0001258 3300053085 Bacteria 16610
435 Ga0495619_0013700 3300053085 Bacteria 5111
436 Ga0495619_0017848 3300053085 Bacteria 4497
437 Ga0495619_0145311 3300053085 Bacteria 1635
438 Ga0495619_0229398 3300053085 Bacteria 1286
439 Ga0495619_0251553 3300053085 Bacteria 1224
440 Ga0500643_014970 3300053087 Bacteria 2675
441 Ga0500646_0009787 3300053090 Bacteria 2453
442 Ga0500651_0024760 3300053093 Bacteria 3764
443 Ga0500641_0002701 3300053096 Bacteria 6265
444 Ga0500562_016275 3300053108 Bacteria 1912
445 Ga0500595_000024 3300053119 Bacteria 144160
446 Ga0500595_006361 3300053119 Bacteria 5018
447 Ga0500658_0084678 3300053134 Bacteria 1362
448 Ga0500577_0009463 3300053142 Bacteria 2830
449 Ga0500616_0000001 3300053153 Bacteria 1986011
450 Ga0500616_0004553 3300053153 Bacteria 9816
451 Ga0500616_0055677 3300053153 Bacteria 2067
452 Ga0500616_0082468 3300053153 Bacteria 1613
453 Ga0500638_113179 3300053162 Unclassified 1251
454 Ga0500645_000874 3300053730 Bacteria 17538
455 Ga0501082_0078253 3300060353 Bacteria 2852
456 Ga0501082_0084982 3300060353 Bacteria 2729
457 Ga0501082_0110168 3300060353 Bacteria 2383
458 Ga0501082_0273986 3300060353 Bacteria 1469
459 2935684011 2935675223 Bacteria 9928132
460 2935693796 2935684952 Bacteria 9590419
461 2935722493 2935713505 Bacteria 9608509
462 2935731802 2935722832 Bacteria 9608746
463 2935741011 2935732158 Bacteria 9706831
464 2935750286 2935741537 Bacteria 9707219
465 2935759981 2935750917 Bacteria 9590372
466 2935769550 2935760218 Bacteria 9817913
467 2940565886 2940556831 Bacteria 9590747
468 8054559778 8054558443 Bacteria 5204801
469 Ga0373938_0006106
470 JGI25153J46596_10014971
471 JGI25404J52841_10000166
472 Ga0070670_100120934
473 Ga0070689_100025975
474 Ga0070689_100239903
475 Ga0070671_100018025
476 Ga0070671_100104421
477 Ga0070673_100231657
478 Ga0070688_100010264
479 Ga0070714_100088724
480 Ga0070713_100104353
481 Ga0070713_100151573
482 Ga0070713_100387696
483 Ga0070710_10016791
484 Ga0070710_10124907
485 Ga0070711_100023060
486 Ga0070711_100023567
487 Ga0070711_100024780
488 Ga0070681_10006073
489 Ga0070681_10154693
490 Ga0070681_10420276
491 Ga0070679_100002677
492 Ga0070684_100399746
493 Ga0070665_100765255
494 Ga0068855_100838558
495 Ga0068859_100037706
496 Ga0068864_100036151
497 Ga0068861_100066263
498 Ga0068863_100223134
499 Ga0068860_100001474
500 Ga0068860_100301295
501 Ga0081540_1000259
502 Ga0081540_1006326
503 Ga0081539_10041643
504 Ga0070717_10113306
505 Ga0070717_10140660
506 Ga0070717_10245991
507 Ga0075363_100001737
508 Ga0075364_10001140
509 Ga0070715_10054928
510 Ga0070715_10164133
511 Ga0070712_100070962
512 Ga0070712_100137581
513 Ga0075362_10002850
514 Ga0075367_10114315
515 Ga0075369_10044240
516 Ga0075366_10000583
517 Ga0075366_10163886
518 Ga0075430_100077662
519 Ga0075434_100016316
520 Ga0075434_100151934
521 Ga0075436_100000662
522 Ga0075436_100057625
523 Ga0097620_100037705
524 Ga0075435_100095189
525 Ga0099795_10022958
526 Ga0111539_10082507
527 Ga0105241_10002179
528 Ga0105248_10010945
529 Ga0105248_10659537
530 Ga0105249_10228828
531 Ga0099796_10058256
532 Ga0157378_10486556
533 Ga0157378_10624436
534 Ga0157378_11141208
535 Ga0163162_10697387
536 Ga0163162_10794392
537 Ga0163163_10306596
538 Ga0157379_10991728
539 Ga0157376_10418852
540 Ga0213876_10080910
541 Ga0213875_10000708
542 Ga0209233_1016781
543 Ga0209758_1000802
544 Ga0207426_1041810
545 Ga0207692_10099780
546 Ga0207710_10256827
547 Ga0207688_10158335
548 Ga0207685_10118862
549 Ga0207699_10077126
550 Ga0207699_10081675
551 Ga0207699_10092823
552 Ga0207654_10078572
553 Ga0207707_10051225
554 Ga0207693_10027134
555 Ga0207693_10056452
556 Ga0207693_10133201
557 Ga0207663_10045291
558 Ga0207660_10099147
559 Ga0207662_10078964
560 Ga0207700_10037407
561 Ga0207700_10083208
562 Ga0207700_10219939
563 Ga0207700_10599318
564 Ga0207664_10011878
565 Ga0207664_10076658
566 Ga0207644_10199494
567 Ga0207706_10510736
568 Ga0207686_10300317
569 Ga0207670_10001207
570 Ga0207669_10008988
571 Ga0207704_10093500
572 Ga0207665_10062786
573 Ga0207665_10104374
574 Ga0207691_10208570
575 Ga0207711_10006255
576 Ga0207711_10518184
577 Ga0207667_10668650
578 Ga0207640_10624015
579 Ga0207658_10801399
580 Ga0207678_10249360
581 Ga0207648_10654886
582 Ga0207676_10043691
583 Ga0207675_100384709
584 Ga0207683_10062486
585 Ga0207698_10395223
586 Ga0209179_1008740
587 Ga0210002_1000713
588 Ga0209813_10032937
589 Ga0207428_10123498
590 Ga0268266_10064096
591 Ga0268266_10862840
592 Ga0268264_10000119
593 Ga0268264_10580985
594 Ga0265338_10012118
595 Ga0265338_10074649
596 Ga0265338_10092472
597 Ga0265325_10000290
598 Ga0265325_10000703
599 Ga0265325_10017216
600 Ga0265325_10063012
601 Ga0265325_10107163
602 Ga0265340_10018485
603 Ga0265340_10108267
604 Ga0265339_10059349
605 Ga0265339_10117556
606 Ga0265316_10013332
607 Ga0265313_10007247
608 Ga0265313_10073692
609 Ga0265314_10006219
610 Ga0265314_10007314
611 Ga0265314_10081469
612 Ga0265342_10033953
613 Ga0307407_10415599
614 Ga0373959_0021380
615 Ga0373926_0095301
616 Ga0373934_0015282
617 Ga0373944_0015875
618 Ga0373923_0001201
619 Ga0373923_0297012
620 Ga0373936_0000313
621 Ga0373939_0026792
622 Ga0373945_0044786
623 Ga0373953_0059444
624 Ga0373954_0003371
625 Ga0373954_0055200
626 Ga0373956_0016620
627 Ga0373956_0018727
628 Ga0373956_0038775
629 Ga0373957_0001478
630 Ga0373957_0014585
631 Ga0373957_0015624
632 Ga0373943_0004213
633 Ga0373943_0052925
634 Ga0373943_0073626
635 Ga0373946_0004995
636 Ga0373946_0035554
637 Ga0373946_0045265
638 Ga0373946_0247182
639 Ga0373955_0001318
640 Ga0373955_0001995
641 Ga0373924_0029578
642 Ga0373924_0232914
643 Ga0373924_0322003
644 Ga0373931_0002207
645 Ga0373931_0004826
646 Ga0373935_0000125
647 Ga0373935_0214830
648 Ga0373927_0002095
649 Ga0373927_0018288
650 Ga0373927_0071774
651 Ga0373927_0079482
652 Ga0373933_0001665
653 Ga0373933_0009272
654 Ga0373933_0012698
655 Ga0373933_0201978
656 Ga0373947_0001216
657 Ga0373947_0001307
658 Ga0373947_0025075
659 Ga0373947_0068181
660 Ga0373947_0247300
661 Ga0373937_0000325
662 Ga0373937_0012688
663 Ga0373937_0243325
664 Ga0373937_0626833
665 Ga0373937_0917104
666 Ga0373925_0000019
667 Ga0373925_0024551
668 Ga0373925_0124369
669 Ga0373925_0473219
670 Ga0436364_0304270
671 Ga0436364_1119186
672 Ga0436365_1169663
673 Ga0436365_1533257
674 Ga0436360_1047866
675 Ga0439453_0046253
676 Ga0466966_0025663
677 Ga0466963_0009418
678 Ga0466963_0027304
679 Ga0466963_0106335
680 Ga0466957_0165428
681 Ga0466959_0065480
682 Ga0466958_0225731
683 Ga0466967_0005150
684 Ga0466967_0160945
685 Ga0466967_0188342
686 Ga0495592_0000005
687 Ga0495592_0025711
688 Ga0495592_0067108
689 Ga0495592_0270411
690 Ga0495603_0140941
691 Ga0495629_0003620
692 Ga0495629_0005426
693 Ga0495629_0179161
694 Ga0495629_0362158
695 Ga0495638_0006029
696 Ga0495638_0150357
697 Ga0495651_0002953
698 Ga0495651_0029406
699 Ga0495651_0072024
700 Ga0495651_0078182
701 Ga0495651_0262987
702 Ga0495651_0333295
703 Ga0495653_0000017
704 Ga0495653_0122058
705 Ga0495582_0068552
706 Ga0495639_0088707
707 Ga0495662_0001372
708 Ga0495662_0002323
709 Ga0495664_0000014
710 Ga0495664_0061107
711 Ga0495608_0000034
712 Ga0495608_0091802
713 Ga0495618_0000011
714 Ga0495618_0001061
715 Ga0495618_0023763
716 Ga0495618_0162742
717 Ga0495628_0000017
718 Ga0495628_0016821
719 Ga0495630_0000691
720 Ga0495630_0246043
721 Ga0495652_0000008
722 Ga0495652_0029907
723 Ga0495665_0026723
724 Ga0495640_0000033
725 Ga0495640_0001271
726 Ga0495640_0064854
727 Ga0495640_0088456
728 Ga0495586_0016045
729 Ga0495586_0266602
730 Ga0495587_0000039
731 Ga0495587_0037336
732 Ga0495645_0000006
733 Ga0495645_0004596
734 Ga0495667_0000026
735 Ga0495667_0008435
736 Ga0495667_0064193
737 Ga0495667_0109224
738 Ga0495634_0000009
739 Ga0495634_0057051
740 Ga0495634_0065089
741 Ga0495634_0095246
742 Ga0495635_0000014
743 Ga0495635_0004098
744 Ga0495635_0096271
745 Ga0495635_0153643
746 Ga0495635_0209578
747 Ga0495588_0063778
748 Ga0495657_0000499
749 Ga0495657_0029711
750 Ga0495657_0037125
751 Ga0495599_0000010
752 Ga0495599_0021160
753 Ga0495599_0130655
754 Ga0495623_0000147
755 Ga0495623_0277479
756 Ga0495646_0000008
757 Ga0495646_0140281
758 Ga0495646_0156994
759 Ga0495646_0217800
760 Ga0495658_0004417
761 Ga0495658_0076941
762 Ga0495613_0024586
763 Ga0495613_0213180
764 Ga0495613_0261058
765 Ga0495624_0002554
766 Ga0495624_0011021
767 Ga0495624_0227242
768 Ga0495600_0000096
769 Ga0495600_0002141
770 Ga0495600_0075411
771 Ga0495600_0143248
772 Ga0495581_0088430
773 Ga0495604_0000006
774 Ga0495604_0009373
775 Ga0495674_0000009
776 Ga0495674_0010456
777 Ga0495674_0011123
778 Ga0495676_0202634
779 Ga0495680_0000471
780 Ga0495680_0012338
781 Ga0495680_0038689
782 Ga0495680_0039229
783 Ga0495680_0050909
784 Ga0495675_0000210
785 Ga0495675_0035768
786 Ga0495675_0113165
787 Ga0495684_0000015
788 Ga0495684_0005078
789 Ga0495684_0041869
790 Ga0495684_0105548
791 Ga0495684_0250520
792 Ga0495593_0000958
793 Ga0495593_0113557
794 Ga0495602_0000006
795 Ga0495602_0028761
796 Ga0495602_0054261
797 Ga0495602_0073438
798 Ga0495602_0123817
799 Ga0496100_0018540
800 Ga0496101_0001810
801 Ga0496104_0000055
802 Ga0496104_0219000
803 Ga0496105_0004656
804 Ga0496105_0048558
805 Ga0496106_0031949
806 Ga0496107_0052644
807 Ga0496108_0161928
808 Ga0496110_0524485
809 Ga0496110_0633905
810 Ga0496111_0026770
811 Ga0496111_0296893
812 Ga0496112_0592960
813 Ga0496113_0104474
814 Ga0496114_0016032
815 Ga0496114_0050124
816 Ga0496114_0448790
817 Ga0496115_0043164
818 Ga0496115_0044225
819 Ga0496115_0052060
820 Ga0496115_0420397
821 Ga0496119_0251371
822 Ga0496121_0001142
823 Ga0496126_0277945
824 Ga0501031_0059390
825 Ga0501031_0092367
826 Ga0501032_0028378
827 Ga0501033_0082038
828 Ga0501033_0302995
829 Ga0501034_0009010
830 Ga0501034_0026668
831 Ga0501034_0163557
832 Ga0501034_0229296
833 Ga0501034_0266863
834 Ga0501036_0030950
835 Ga0501038_0012012
836 Ga0501038_0248394
837 Ga0501039_0016379
838 Ga0501043_0006297
839 Ga0501043_0483097
840 Ga0501046_0078826
841 Ga0501047_0036451
842 Ga0501047_0191236
843 Ga0501047_0215518
844 Ga0501048_0031280
845 Ga0501068_0006518
846 Ga0501069_0001041
847 Ga0501069_0081860
848 Ga0501070_0167490
849 Ga0501071_0058478
850 Ga0501073_0018041
851 Ga0501073_0494012
852 Ga0501074_0013637
853 Ga0501077_0494983
854 Ga0501079_0110039
855 Ga0501080_0020465
856 Ga0501080_0091251
857 Ga0501083_0042197
858 Ga0501083_0066098
859 Ga0501083_0190517
860 Ga0501035_0027579
861 Ga0501044_0000708
862 Ga0501044_0202938
863 Ga0501044_0560668
864 Ga0501045_0129175
865 Ga0501045_0255597
866 nmdc:mga03n38_8914_c1
867 nmdc:mga00v17_43523_c1
868 nmdc:mga0yw44_116007_c1
869 nmdc:mga0k408_1931_c1
870 nmdc:mga0k408_448215_c1
871 nmdc:mga0k408_53633_c1
872 nmdc:mga06z11_162111_c1
873 nmdc:mga06z11_40054_c1
874 nmdc:mga04h51_63876_c1
875 nmdc:mga07m45_151157_c1
876 nmdc:mga07m45_244792_c1
877 nmdc:mga07m45_32309_c1
878 nmdc:mga09592_565087_c1
879 nmdc:mga0qj67_86094_c1
880 nmdc:mga08y16_721980_c1
881 nmdc:mga08y16_76862_c1
882 nmdc:mga0n895_146496_c1
883 nmdc:mga0n895_21286_c1
884 nmdc:mga08x19_1998_c1
885 nmdc:mga08x19_217485_c1
886 nmdc:mga08x19_260670_c1
887 nmdc:mga0sz30_72303_c1
888 Ga0495601_0000007
889 Ga0495601_0000813
890 Ga0495601_0027022
891 Ga0495601_0029940
892 Ga0495612_0000015
893 Ga0495612_0003012
894 Ga0495595_0000079
895 Ga0495595_0002208
896 Ga0495595_0005367
897 Ga0495595_0016865
898 Ga0495595_0076930
899 Ga0495619_0000017
900 Ga0495619_0000635
901 Ga0495619_0000882
902 Ga0495619_0001258
903 Ga0495619_0013700
904 Ga0495619_0017848
905 Ga0495619_0145311
906 Ga0495619_0229398
907 Ga0495619_0251553
908 Ga0500643_014970
909 Ga0500646_0009787
910 Ga0500651_0024760
911 Ga0500641_0002701
912 Ga0500562_016275
913 Ga0500595_000024
914 Ga0500595_006361
915 Ga0500658_0084678
916 Ga0500577_0009463
917 Ga0500616_0000001
918 Ga0500616_0004553
919 Ga0500616_0055677
920 Ga0500616_0082468
921 Ga0500638_113179
922 Ga0500645_000874
923 Ga0501082_0078253
924 Ga0501082_0084982
925 Ga0501082_0110168
926 Ga0501082_0273986
927 2935684011
928 2935693796
929 2935722493
930 2935731802
931 2935741011
932 2935750286
933 2935759981
934 2935769550
935 2940565886
936 8054559778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

38

260

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9195 2 239
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9132 2 239
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9012 2 239
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8987 2 239
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.8933 2 238
ID Description Score Start End Superfamily
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9025 1 239 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8936 2 238 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8871 1 238 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8849 1 239 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.872 2 238 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A346A334-F1-model_v4 Dienelactone hydrolase family protein 0.9937 1 243 GO:0016787
AF-A0A2N8GRG3-F1-model_v4 deleted 0.9855 133 204
AF-A0A7H8NT69-F1-model_v4 Dienelactone hydrolase family protein 0.9673 2 239 GO:0016787
AF-W4SH93-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9629 1 239 GO:0008806
AF-H8FID6-F1-model_v4 deleted 0.9629 19 240

Map