F450077

General Info

Members Datasets Scaffolds Average Seq Length
468 209 468 290

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1190248|Ga0436364_1190248_1807_2814
Length 335
Sequence MDRVSTGGVGPSGPPPGFRPAPTKHPSPSQRSPLRNLAEFLLVFFVLKSLEWSPLPLAHRLARGYFRLLDLLLPRLRNIAARNLAVALPELSPEKREAIIAGVFRSIARLAVTMAKFPSIQRENIVRWIRFEGYEHFEAALRAGRGVLFATAHLGNWELSAYAHALCAEPMNVVVRPLDNPLLDSLIARRRQLCGNRVISKRDPIRPILKALAANEAVGILIDQNVSSDAVFVDFFGIPAAAASGFARLAAHSGAAVIPGFALWSEPERRYVLRFYPPVPITGDAVRDTQTIQTVLEGVIRAYPDQWLWIHRRWKTRPPGALPVYEVAPVRSNTV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.07
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10023937 3300005327 Bacteria 4899
2 Ga0070658_10039050 3300005327 Bacteria 3829
3 Ga0070683_100004185 3300005329 Bacteria 11830
4 Ga0070683_100151603 3300005329 Bacteria 2198
5 Ga0070683_100181982 3300005329 Bacteria 1995
6 Ga0070683_100341953 3300005329 Unclassified 1425
7 Ga0068869_100366776 3300005334 Unclassified 1177
8 Ga0070666_10001216 3300005335 Bacteria 15542
9 Ga0070680_100133221 3300005336 Bacteria 2080
10 Ga0068868_100014924 3300005338 Bacteria 5735
11 Ga0070660_100016895 3300005339 Bacteria 5309
12 Ga0070689_100035832 3300005340 Bacteria 3792
13 Ga0070661_100004454 3300005344 Bacteria 9657
14 Ga0070671_100062168 3300005355 Bacteria 3110
15 Ga0070673_100103610 3300005364 Bacteria 2348
16 Ga0070673_100162879 3300005364 Bacteria 1898
17 Ga0070688_100060103 3300005365 Bacteria 2399
18 Ga0070659_100020609 3300005366 Bacteria 5011
19 Ga0070667_100014117 3300005367 Bacteria 6600
20 Ga0070714_100000466 3300005435 Bacteria 29384
21 Ga0070714_100236375 3300005435 Bacteria 1685
22 Ga0070713_100050114 3300005436 Bacteria 3447
23 Ga0070713_100069971 3300005436 Bacteria 2961
24 Ga0070711_100035437 3300005439 Bacteria 3337
25 Ga0070711_100079581 3300005439 Unclassified 2331
26 Ga0070663_100031635 3300005455 Bacteria 3638
27 Ga0070678_100058141 3300005456 Unclassified 2837
28 Ga0070678_100190465 3300005456 Bacteria 1686
29 Ga0070678_100208066 3300005456 Bacteria 1619
30 Ga0070681_10003750 3300005458 Bacteria 14266
31 Ga0070681_10057910 3300005458 Bacteria 3855
32 Ga0070681_10076188 3300005458 Bacteria 3313
33 Ga0070681_10167108 3300005458 Bacteria 2122
34 Ga0070681_10168655 3300005458 Bacteria 2111
35 Ga0070681_10181872 3300005458 Bacteria 2024
36 Ga0068867_100155932 3300005459 Bacteria 1797
37 Ga0070706_100153361 3300005467 Bacteria 2151
38 Ga0070706_100493618 3300005467 Bacteria 1139
39 Ga0070699_100177925 3300005518 Unclassified 1887
40 Ga0070679_100009067 3300005530 Bacteria 9386
41 Ga0070679_100045021 3300005530 Bacteria 4397
42 Ga0070684_100003472 3300005535 Bacteria 11830
43 Ga0070684_100025397 3300005535 Bacteria 4980
44 Ga0070684_100053642 3300005535 Bacteria 3511
45 Ga0070684_100173122 3300005535 Bacteria 1961
46 Ga0070697_100057484 3300005536 Bacteria 3165
47 Ga0070697_100270580 3300005536 Bacteria 1456
48 Ga0068853_100089196 3300005539 Unclassified 2708
49 Ga0068853_100285655 3300005539 Bacteria 1522
50 Ga0070686_100181348 3300005544 Bacteria 1496
51 Ga0070696_100002960 3300005546 Bacteria 11288
52 Ga0070665_100379222 3300005548 Unclassified 1421
53 Ga0068855_100006182 3300005563 Bacteria 14597
54 Ga0068855_100007115 3300005563 Bacteria 13572
55 Ga0068855_100011731 3300005563 Bacteria 10593
56 Ga0068855_100012079 3300005563 Bacteria 10436
57 Ga0068855_100068165 3300005563 Bacteria 4142
58 Ga0068855_100075132 3300005563 Bacteria 3924
59 Ga0068855_100258263 3300005563 Bacteria 1942
60 Ga0068855_100311963 3300005563 Bacteria 1740
61 Ga0068855_100422270 3300005563 Unclassified 1458
62 Ga0070664_100287734 3300005564 Bacteria 1483
63 Ga0068857_100042008 3300005577 Bacteria 4054
64 Ga0068857_100044035 3300005577 Bacteria 3958
65 Ga0068856_100007745 3300005614 Bacteria 10491
66 Ga0068856_100017457 3300005614 Bacteria 6954
67 Ga0068856_100078134 3300005614 Bacteria 3281
68 Ga0068856_100113021 3300005614 Unclassified 2714
69 Ga0068852_100236810 3300005616 Bacteria 1743
70 Ga0068859_100287841 3300005617 Bacteria 1736
71 Ga0068859_100555121 3300005617 Bacteria 1243
72 Ga0068866_10117744 3300005718 Bacteria 1492
73 Ga0068863_100022659 3300005841 Bacteria 5999
74 Ga0068863_100029155 3300005841 Bacteria 5269
75 Ga0068858_100007077 3300005842 Bacteria 10888
76 Ga0068858_100100663 3300005842 Bacteria 2695
77 Ga0068860_100017361 3300005843 Bacteria 7011
78 Ga0068862_100314713 3300005844 Unclassified 1443
79 Ga0081455_10021567 3300005937 Bacteria 6038
80 Ga0070717_10020123 3300006028 Bacteria 5245
81 Ga0070717_10191700 3300006028 Unclassified 1786
82 Ga0097621_100005171 3300006237 Bacteria 9169
83 Ga0097621_100007782 3300006237 Bacteria 7688
84 Ga0097621_100037857 3300006237 Bacteria 3869
85 Ga0097621_100176696 3300006237 Unclassified 1843
86 Ga0068871_100012234 3300006358 Bacteria 6318
87 Ga0068871_100022119 3300006358 Bacteria 4900
88 Ga0068871_100453483 3300006358 Unclassified 1150
89 Ga0075430_100031547 3300006846 Bacteria 4498
90 Ga0075431_100002093 3300006847 Bacteria 19065
91 Ga0075431_100020038 3300006847 Bacteria 6829
92 Ga0075434_100412272 3300006871 Bacteria 1372
93 Ga0075434_100519730 3300006871 Bacteria 1211
94 Ga0068865_100006713 3300006881 Bacteria 7039
95 Ga0068865_100303868 3300006881 Bacteria 1278
96 Ga0075436_100001102 3300006914 Bacteria 18242
97 Ga0075436_100148030 3300006914 Bacteria 1651
98 Ga0075436_100245419 3300006914 Bacteria 1274
99 Ga0097620_100035984 3300006931 Bacteria 4968
100 Ga0097620_100287843 3300006931 Bacteria 1736
101 Ga0097620_100555198 3300006931 Bacteria 1243
102 Ga0105240_10000438 3300009093 Bacteria 76903
103 Ga0105240_10001298 3300009093 Bacteria 43175
104 Ga0105240_10002380 3300009093 Bacteria 30325
105 Ga0105240_10006036 3300009093 Bacteria 17911
106 Ga0105240_10134068 3300009093 Bacteria 2967
107 Ga0105240_10136637 3300009093 Bacteria 2935
108 Ga0105240_10349729 3300009093 Unclassified 1677
109 Ga0105240_10600270 3300009093 Unclassified 1212
110 Ga0105245_10004645 3300009098 Bacteria 12134
111 Ga0105245_10011492 3300009098 Bacteria 7711
112 Ga0105245_10139230 3300009098 Bacteria 2284
113 Ga0105245_10170665 3300009098 Bacteria 2071
114 Ga0105245_10559140 3300009098 Bacteria 1167
115 Ga0114129_10190332 3300009147 Bacteria 2787
116 Ga0114129_10207124 3300009147 Bacteria 2653
117 Ga0105243_10060486 3300009148 Bacteria 3026
118 Ga0105241_10009077 3300009174 Bacteria 7315
119 Ga0105241_10160137 3300009174 Bacteria 1849
120 Ga0105242_10021182 3300009176 Bacteria 5103
121 Ga0105242_10146846 3300009176 Bacteria 2052
122 Ga0105242_10162931 3300009176 Bacteria 1954
123 Ga0105242_10369926 3300009176 Bacteria 1329
124 Ga0105248_10011338 3300009177 Bacteria 9824
125 Ga0105248_10014487 3300009177 Bacteria 8680
126 Ga0105248_10086844 3300009177 Bacteria 3520
127 Ga0105248_10090378 3300009177 Unclassified 3448
128 Ga0105248_10172521 3300009177 Bacteria 2438
129 Ga0105248_10190498 3300009177 Bacteria 2311
130 Ga0105248_10212800 3300009177 Bacteria 2178
131 Ga0105248_10843926 3300009177 Unclassified 1034
132 Ga0105237_10014903 3300009545 Bacteria 8107
133 Ga0105237_10020070 3300009545 Bacteria 6898
134 Ga0105237_10035223 3300009545 Bacteria 5066
135 Ga0105237_10043120 3300009545 Bacteria 4547
136 Ga0105238_10054930 3300009551 Bacteria 3999
137 Ga0105238_10212077 3300009551 Bacteria 1913
138 Ga0105239_10021580 3300010375 Bacteria 7101
139 Ga0105239_10043698 3300010375 Bacteria 4913
140 Ga0105239_10207896 3300010375 Bacteria 2193
141 Ga0157371_10155636 3300013102 Unclassified 1631
142 Ga0157371_10295588 3300013102 Bacteria 1172
143 Ga0157371_10422844 3300013102 Unclassified 977
144 Ga0157370_10008793 3300013104 Bacteria 10849
145 Ga0157370_10033507 3300013104 Bacteria 5008
146 Ga0157370_10147608 3300013104 Unclassified 2189
147 Ga0157370_10226846 3300013104 Bacteria 1729
148 Ga0157370_10379854 3300013104 Bacteria 1301
149 Ga0157369_10002980 3300013105 Bacteria 20260
150 Ga0157369_10008243 3300013105 Bacteria 11946
151 Ga0157369_10018191 3300013105 Bacteria 7881
152 Ga0157369_10090967 3300013105 Bacteria 3258
153 Ga0157369_10156947 3300013105 Bacteria 2403
154 Ga0157369_10467608 3300013105 Bacteria 1305
155 Ga0157374_10028553 3300013296 Bacteria 5041
156 Ga0157374_10094234 3300013296 Bacteria 2861
157 Ga0157374_10166838 3300013296 Unclassified 2146
158 Ga0157374_10263217 3300013296 Bacteria 1699
159 Ga0157378_10709628 3300013297 Bacteria 1026
160 Ga0163162_10117749 3300013306 Bacteria 2758
161 Ga0163162_10274815 3300013306 Bacteria 1817
162 Ga0157372_10087034 3300013307 Bacteria 3544
163 Ga0157372_10110563 3300013307 Bacteria 3148
164 Ga0157372_10523705 3300013307 Unclassified 1382
165 Ga0157372_10567687 3300013307 Unclassified 1323
166 Ga0157372_10642051 3300013307 Unclassified 1236
167 Ga0157375_10005506 3300013308 Bacteria 11018
168 Ga0157375_10365794 3300013308 Bacteria 1608
169 Ga0163163_10007738 3300014325 Bacteria 9496
170 Ga0163163_10030037 3300014325 Bacteria 5231
171 Ga0163163_10060399 3300014325 Unclassified 3754
172 Ga0163163_10215808 3300014325 Bacteria 1967
173 Ga0163163_10262804 3300014325 Bacteria 1777
174 Ga0157379_10002170 3300014968 Bacteria 16310
175 Ga0157376_10124542 3300014969 Bacteria 2289
176 Ga0157376_10298534 3300014969 Bacteria 1524
177 Ga0213872_10000182 3300021361 Bacteria 56427
178 Ga0213876_10001101 3300021384 Bacteria 17298
179 Ga0213876_10012915 3300021384 Bacteria 4441
180 Ga0213876_10017670 3300021384 Bacteria 3763
181 Ga0213876_10033868 3300021384 Bacteria 2693
182 Ga0213875_10000002 3300021388 Bacteria 921066
183 Ga0213875_10000112 3300021388 Bacteria 91961
184 Ga0213875_10002433 3300021388 Bacteria 11139
185 Ga0213875_10010594 3300021388 Unclassified 4613
186 Ga0213875_10019453 3300021388 Bacteria 3266
187 Ga0213875_10027672 3300021388 Bacteria 2698
188 Ga0213875_10030734 3300021388 Unclassified 2542
189 Ga0213875_10064972 3300021388 Bacteria 1705
190 Ga0213875_10072014 3300021388 Unclassified 1613
191 Ga0213875_10141472 3300021388 Bacteria 1126
192 Ga0207685_10130120 3300025905 Bacteria 1116
193 Ga0207705_10004239 3300025909 Bacteria 10862
194 Ga0207705_10251052 3300025909 Bacteria 1349
195 Ga0207654_10071147 3300025911 Bacteria 2067
196 Ga0207654_10092098 3300025911 Bacteria 1850
197 Ga0207654_10094372 3300025911 Bacteria 1831
198 Ga0207707_10005115 3300025912 Bacteria 11497
199 Ga0207707_10007242 3300025912 Bacteria 9653
200 Ga0207707_10018406 3300025912 Bacteria 6090
201 Ga0207707_10070907 3300025912 Bacteria 3036
202 Ga0207707_10100247 3300025912 Bacteria 2531
203 Ga0207695_10001643 3300025913 Bacteria 36050
204 Ga0207695_10004872 3300025913 Bacteria 18104
205 Ga0207695_10011537 3300025913 Bacteria 10692
206 Ga0207695_10021488 3300025913 Bacteria 7361
207 Ga0207695_10189756 3300025913 Bacteria 1973
208 Ga0207695_10203491 3300025913 Unclassified 1893
209 Ga0207671_10013835 3300025914 Bacteria 6408
210 Ga0207671_10031873 3300025914 Bacteria 3925
211 Ga0207671_10036999 3300025914 Bacteria 3619
212 Ga0207671_10133008 3300025914 Unclassified 1910
213 Ga0207663_10041403 3300025916 Bacteria 2807
214 Ga0207663_10095369 3300025916 Unclassified 1984
215 Ga0207660_10087717 3300025917 Bacteria 2299
216 Ga0207660_10120501 3300025917 Unclassified 1986
217 Ga0207660_10322488 3300025917 Bacteria 1234
218 Ga0207657_10006856 3300025919 Bacteria 11750
219 Ga0207657_10210593 3300025919 Bacteria 1560
220 Ga0207652_10051504 3300025921 Bacteria 3530
221 Ga0207652_10162651 3300025921 Unclassified 2001
222 Ga0207694_10021690 3300025924 Bacteria 4867
223 Ga0207694_10113398 3300025924 Bacteria 2158
224 Ga0207687_10006599 3300025927 Bacteria 7654
225 Ga0207687_10059356 3300025927 Bacteria 2695
226 Ga0207687_10090667 3300025927 Bacteria 2228
227 Ga0207700_10006266 3300025928 Bacteria 7176
228 Ga0207700_10025071 3300025928 Bacteria 4135
229 Ga0207700_10151176 3300025928 Bacteria 1919
230 Ga0207664_10009750 3300025929 Bacteria 6754
231 Ga0207644_10056471 3300025931 Bacteria 2833
232 Ga0207686_10044422 3300025934 Bacteria 2728
233 Ga0207686_10097490 3300025934 Bacteria 1956
234 Ga0207709_10049941 3300025935 Bacteria 2555
235 Ga0207709_10410129 3300025935 Bacteria 1038
236 Ga0207670_10384823 3300025936 Unclassified 1118
237 Ga0207704_10039779 3300025938 Bacteria 2742
238 Ga0207704_10268234 3300025938 Bacteria 1291
239 Ga0207665_10086356 3300025939 Bacteria 2167
240 Ga0207711_10010896 3300025941 Bacteria 7556
241 Ga0207711_10016663 3300025941 Bacteria 6102
242 Ga0207711_10060297 3300025941 Bacteria 3269
243 Ga0207711_10120653 3300025941 Bacteria 2340
244 Ga0207711_10175039 3300025941 Bacteria 1949
245 Ga0207711_10263841 3300025941 Bacteria 1583
246 Ga0207689_10356429 3300025942 Bacteria 1216
247 Ga0207661_10002898 3300025944 Bacteria 11851
248 Ga0207661_10045282 3300025944 Bacteria 3482
249 Ga0207661_10071628 3300025944 Bacteria 2833
250 Ga0207661_10328995 3300025944 Unclassified 1375
251 Ga0207667_10002897 3300025949 Bacteria 21302
252 Ga0207667_10007403 3300025949 Bacteria 13200
253 Ga0207667_10015382 3300025949 Bacteria 8696
254 Ga0207667_10053542 3300025949 Bacteria 4246
255 Ga0207667_10058921 3300025949 Bacteria 4025
256 Ga0207667_10076171 3300025949 Unclassified 3482
257 Ga0207651_10080175 3300025960 Bacteria 2348
258 Ga0207651_10128700 3300025960 Bacteria 1934
259 Ga0207658_10286479 3300025986 Bacteria 1414
260 Ga0207677_10013085 3300026023 Bacteria 4796
261 Ga0207703_10032063 3300026035 Bacteria 4157
262 Ga0207639_10071858 3300026041 Unclassified 2708
263 Ga0207639_10268384 3300026041 Bacteria 1496
264 Ga0207639_10429448 3300026041 Bacteria 1196
265 Ga0207702_10046537 3300026078 Unclassified 3653
266 Ga0207702_10073066 3300026078 Bacteria 2956
267 Ga0207702_10095606 3300026078 Bacteria 2611
268 Ga0207702_10110808 3300026078 Unclassified 2440
269 Ga0207702_10146814 3300026078 Bacteria 2141
270 Ga0207641_10152713 3300026088 Bacteria 2092
271 Ga0207641_10206911 3300026088 Unclassified 1812
272 Ga0207641_10416349 3300026088 Bacteria 1293
273 Ga0207648_10342903 3300026089 Bacteria 1346
274 Ga0207674_10000915 3300026116 Bacteria 38455
275 Ga0207674_10003947 3300026116 Bacteria 18047
276 Ga0207674_10039864 3300026116 Bacteria 4867
277 Ga0207683_10095240 3300026121 Unclassified 2654
278 Ga0207683_10324153 3300026121 Bacteria 1411
279 Ga0207698_10538264 3300026142 Bacteria 1142
280 Ga0268265_10189884 3300028380 Bacteria 1773
281 Ga0268264_10012279 3300028381 Bacteria 7049
282 Ga0265323_10000134 3300028653 Bacteria 42370
283 Ga0265338_10104265 3300028800 Unclassified 2301
284 Ga0265330_10072275 3300031235 Bacteria 1492
285 Ga0265332_10034732 3300031238 Bacteria 2190
286 Ga0265328_10005285 3300031239 Bacteria 5546
287 Ga0265320_10000647 3300031240 Bacteria 26595
288 Ga0265325_10040510 3300031241 Bacteria 2446
289 Ga0265339_10048793 3300031249 Unclassified 2321
290 Ga0265331_10026752 3300031250 Unclassified 2896
291 Ga0265331_10032071 3300031250 Bacteria 2606
292 Ga0265327_10127010 3300031251 Unclassified 1203
293 Ga0265316_10002494 3300031344 Bacteria 19058
294 Ga0265316_10002556 3300031344 Bacteria 18804
295 Ga0265316_10007312 3300031344 Bacteria 10417
296 Ga0265316_10051195 3300031344 Bacteria 3245
297 Ga0265316_10069771 3300031344 Bacteria 2712
298 Ga0265316_10103536 3300031344 Bacteria 2161
299 Ga0265316_10118307 3300031344 Bacteria 2002
300 Ga0265313_10121876 3300031595 Unclassified 1136
301 Ga0265314_10003430 3300031711 Bacteria 15320
302 Ga0265314_10004067 3300031711 Bacteria 13797
303 Ga0265314_10007627 3300031711 Bacteria 9365
304 Ga0265314_10056536 3300031711 Bacteria 2700
305 Ga0265314_10169291 3300031711 Bacteria 1320
306 Ga0265342_10008795 3300031712 Bacteria 7195
307 Ga0373923_0036566 3300035111 Unclassified 2005
308 Ga0373955_0091102 3300035172 Bacteria 1738
309 Ga0373961_0103773 3300035241 Bacteria 923
310 Ga0373935_0041804 3300035692 Unclassified 2881
311 Ga0373935_0152538 3300035692 Bacteria 1569
312 Ga0373935_0244315 3300035692 Bacteria 1254
313 Ga0373935_0470262 3300035692 Unclassified 910
314 Ga0373927_0001152 3300035695 Bacteria 20006
315 Ga0373927_0002176 3300035695 Bacteria 14391
316 Ga0373927_0021009 3300035695 Bacteria 4279
317 Ga0373927_0063960 3300035695 Bacteria 2380
318 Ga0373933_0290008 3300035724 Bacteria 1058
319 Ga0373947_0000440 3300035725 Bacteria 23586
320 Ga0373947_0048032 3300035725 Bacteria 2560
321 Ga0373947_0339258 3300035725 Unclassified 1007
322 Ga0373937_0004941 3300036401 Bacteria 11335
323 Ga0373937_0031410 3300036401 Bacteria 4813
324 Ga0373937_0171804 3300036401 Bacteria 2034
325 Ga0373937_0178704 3300036401 Unclassified 1993
326 Ga0373937_0243085 3300036401 Unclassified 1696
327 Ga0373937_0579710 3300036401 Bacteria 1065
328 Ga0373925_0000291 3300037068 Bacteria 52433
329 Ga0373925_0038328 3300037068 Bacteria 3543
330 Ga0373925_0102937 3300037068 Bacteria 2197
331 Ga0373925_0122619 3300037068 Bacteria 2019
332 Ga0373925_0198034 3300037068 Bacteria 1596
333 Ga0436364_0160423 3300037853 Bacteria 5256
334 Ga0436364_0323484 3300037853 Bacteria 2519
335 Ga0436364_0417184 3300037853 Bacteria 3004
336 Ga0436364_0462115 3300037853 Unclassified 1299
337 Ga0436364_0517360 3300037853 Bacteria 13526
338 Ga0436364_0602871 3300037853 Bacteria 4426
339 Ga0436364_0612043 3300037853 Bacteria 326330
340 Ga0436364_0749502 3300037853 Bacteria 105484
341 Ga0436364_0885924 3300037853 Unclassified 1613
342 Ga0436364_0919396 3300037853 Bacteria 13386
343 Ga0436364_1074929 3300037853 Bacteria 14867
344 Ga0436364_1190248 3300037853 Unclassified 3609
345 Ga0436364_1199688 3300037853 Unclassified 1624
346 Ga0436364_1275864 3300037853 Bacteria 1975
347 Ga0436364_1320403 3300037853 Bacteria 5756
348 Ga0436364_1350595 3300037853 Bacteria 8723
349 Ga0436365_0041310 3300039437 Bacteria 28215
350 Ga0436365_0188047 3300039437 Bacteria 7244
351 Ga0436365_0781995 3300039437 Bacteria 6534
352 Ga0436365_1556319 3300039437 Bacteria 3994
353 Ga0436360_0083056 3300039438 Bacteria 3383
354 Ga0436360_0386665 3300039438 Unclassified 2411
355 Ga0436361_0126076 3300039447 Bacteria 97470
356 Ga0436363_0946280 3300039450 Bacteria 2355
357 Ga0436362_0107282 3300039453 Unclassified 971
358 Ga0453684_0719470 3300044712 Bacteria 1083
359 Ga0451576_0027465 3300045051 Bacteria 6112
360 Ga0495651_0012820 3300046462 Bacteria 6473
361 Ga0495651_0013954 3300046462 Bacteria 6213
362 Ga0495653_0062251 3300046463 Bacteria 2820
363 Ga0495653_0351902 3300046463 Unclassified 947
364 Ga0495580_0000307 3300046472 Bacteria 39901
365 Ga0495580_0009214 3300046472 Bacteria 7779
366 Ga0495580_0092746 3300046472 Bacteria 2102
367 Ga0495580_0097462 3300046472 Bacteria 2045
368 Ga0495580_0114746 3300046472 Bacteria 1871
369 Ga0495580_0157241 3300046472 Bacteria 1574
370 Ga0495582_0170535 3300046473 Bacteria 1239
371 Ga0495662_0020034 3300046476 Bacteria 3237
372 Ga0495664_0001207 3300046477 Bacteria 13502
373 Ga0495594_0100623 3300046499 Bacteria 1626
374 Ga0495608_0098605 3300046511 Bacteria 1885
375 Ga0495618_0011534 3300046514 Bacteria 5362
376 Ga0495628_0060980 3300046516 Unclassified 2959
377 Ga0495628_0096927 3300046516 Bacteria 2278
378 Ga0495628_0153509 3300046516 Unclassified 1753
379 Ga0495630_0021418 3300046517 Bacteria 4773
380 Ga0495666_0121362 3300046526 Unclassified 1224
381 Ga0495652_0012517 3300046529 Bacteria 7650
382 Ga0495652_0222003 3300046529 Unclassified 1420
383 Ga0495665_0265394 3300046531 Unclassified 882
384 Ga0495640_0014385 3300046533 Bacteria 5991
385 Ga0495640_0305244 3300046533 Unclassified 988
386 Ga0495587_0060073 3300046536 Bacteria 2230
387 Ga0495587_0067703 3300046536 Bacteria 2081
388 Ga0495645_0001895 3300046543 Bacteria 14223
389 Ga0495645_0052350 3300046543 Unclassified 2970
390 Ga0495645_0254639 3300046543 Unclassified 1165
391 Ga0495667_0017192 3300046559 Bacteria 4885
392 Ga0495667_0055543 3300046559 Bacteria 2604
393 Ga0495667_0096555 3300046559 Unclassified 1913
394 Ga0495667_0120381 3300046559 Unclassified 1695
395 Ga0495667_0254309 3300046559 Bacteria 1118
396 Ga0495634_0324998 3300046642 Bacteria 925
397 Ga0495635_0387461 3300046663 Unclassified 929
398 Ga0495657_0090832 3300046675 Unclassified 1960
399 Ga0495599_0254758 3300046678 Unclassified 1067
400 Ga0495599_0276675 3300046678 Bacteria 1017
401 Ga0495623_0008815 3300046679 Bacteria 6545
402 Ga0495623_0129573 3300046679 Unclassified 1512
403 Ga0495623_0150502 3300046679 Bacteria 1376
404 Ga0495646_0003605 3300046680 Bacteria 9667
405 Ga0495613_0149147 3300046689 Bacteria 1669
406 Ga0495624_0118277 3300046690 Bacteria 1628
407 Ga0495600_0029021 3300046809 Bacteria 3581
408 Ga0495600_0288351 3300046809 Unclassified 1038
409 Ga0495604_0134157 3300047317 Bacteria 1776
410 Ga0495604_0201921 3300047317 Bacteria 1378
411 Ga0495604_0209313 3300047317 Unclassified 1348
412 Ga0495674_0021714 3300047319 Bacteria 5935
413 Ga0495674_0051736 3300047319 Bacteria 3620
414 Ga0495674_0085631 3300047319 Bacteria 2699
415 Ga0495680_0050172 3300047322 Bacteria 3264
416 Ga0495680_0059986 3300047322 Bacteria 2935
417 Ga0495675_0026271 3300047444 Bacteria 3713
418 Ga0495675_0046610 3300047444 Bacteria 2759
419 Ga0495675_0149789 3300047444 Unclassified 1442
420 Ga0495675_0233069 3300047444 Bacteria 1110
421 Ga0495684_0001076 3300047471 Bacteria 22103
422 Ga0495684_0059530 3300047471 Bacteria 2909
423 Ga0495684_0329103 3300047471 Bacteria 1090
424 Ga0495602_0058118 3300048088 Bacteria 3388
425 Ga0495602_0202928 3300048088 Bacteria 1511
426 Ga0496101_0448541 3300048904 Bacteria 1018
427 Ga0496112_0280315 3300048915 Bacteria 1614
428 Ga0496114_0346075 3300048917 Bacteria 1315
429 Ga0496115_0041258 3300048918 Bacteria 3672
430 Ga0496115_0494068 3300048918 Bacteria 984
431 Ga0501031_0001243 3300049568 Bacteria 15625
432 Ga0501032_0000837 3300049569 Bacteria 25024
433 Ga0501033_0012592 3300049570 Bacteria 6454
434 Ga0501036_0004940 3300049572 Bacteria 10777
435 Ga0501037_0007636 3300049573 Bacteria 7917
436 Ga0501038_0018241 3300049574 Bacteria 6334
437 Ga0501038_0262861 3300049574 Bacteria 1363
438 Ga0501039_0005686 3300049575 Bacteria 9445
439 Ga0501040_0118464 3300049576 Unclassified 1857
440 Ga0501043_0003588 3300049579 Bacteria 12740
441 Ga0501046_0000591 3300049580 Bacteria 35671
442 Ga0501046_0179356 3300049580 Bacteria 1585
443 Ga0501047_0002992 3300049581 Bacteria 16028
444 Ga0501047_0039486 3300049581 Bacteria 4565
445 Ga0501047_0109908 3300049581 Bacteria 2640
446 Ga0501067_0005951 3300049583 Bacteria 6761
447 Ga0501069_0000329 3300049585 Bacteria 21365
448 Ga0501070_0010268 3300049586 Bacteria 7919
449 Ga0501072_0001356 3300049588 Bacteria 18370
450 Ga0501073_0003261 3300049589 Bacteria 12180
451 Ga0501077_0001401 3300049593 Bacteria 14499
452 Ga0501080_0000466 3300049742 Bacteria 31417
453 Ga0501080_0806598 3300049742 Bacteria 823
454 Ga0501083_0032300 3300049744 Bacteria 3590
455 Ga0501035_0542257 3300049822 Bacteria 953
456 Ga0501044_0010485 3300049823 Bacteria 10056
457 nmdc:mga05p37_270944_c1 3300050507 Bacteria 2028
458 nmdc:mga05p37_664719_c1 3300050507 Bacteria 1164
459 nmdc:mga09592_431077_c1 3300050508 Bacteria 1138
460 nmdc:mga0qj67_16078_c1 3300050509 Bacteria 5668
461 nmdc:mga06r32_2312_c1 3300050510 Bacteria 17061
462 nmdc:mga08x19_166722_c1 3300050514 Bacteria 1498
463 nmdc:mga08x19_1799_c1 3300050514 Bacteria 13172
464 nmdc:mga08x19_99120_c1 3300050514 Bacteria 1353
465 Ga0500568_0001026 3300053139 Bacteria 19117
466 Ga0501084_0006326 3300054114 Bacteria 9724
467 Ga0501082_0000628 3300060353 Bacteria 31112
468 Ga0501082_0026085 3300060353 Bacteria 5037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0719470 Ga0453684_0719470_167_868 233
2 3300049742 Ga0501080_0806598 Ga0501080_0806598_103_813 236
3 3300005439 Ga0070711_100079581 Ga0070711_1000795812 241
4 3300005548 Ga0070665_100379222 Ga0070665_1003792222 241
5 3300025905 Ga0207685_10130120 Ga0207685_101301201 241
6 3300025916 Ga0207663_10095369 Ga0207663_100953692 241
7 3300035692 Ga0373935_0470262 Ga0373935_0470262_47_811 241
8 3300046533 Ga0495640_0305244 Ga0495640_0305244_30_794 241
9 3300006028 Ga0070717_10191700 Ga0070717_101917002 246
10 3300047471 Ga0495684_0329103 Ga0495684_0329103_288_1058 246
11 3300021388 Ga0213875_10141472 Ga0213875_101414722 248
12 3300035111 Ga0373923_0036566 Ga0373923_0036566_801_1562 248
13 3300046531 Ga0495665_0265394 Ga0495665_0265394_76_861 248
14 3300049574 Ga0501038_0262861 Ga0501038_0262861_390_1145 251
15 3300049581 Ga0501047_0002992 Ga0501047_0002992_2253_3008 251
16 3300035172 Ga0373955_0091102 Ga0373955_0091102_879_1643 253
17 3300039450 Ga0436363_0946280 Ga0436363_0946280_969_1733 253
18 3300005563 Ga0068855_100012079 Ga0068855_1000120792 255
19 3300025917 Ga0207660_10120501 Ga0207660_101205012 255
20 3300025949 Ga0207667_10076171 Ga0207667_100761712 255
21 3300021388 Ga0213875_10072014 Ga0213875_100720142 256
22 3300021388 Ga0213875_10010594 Ga0213875_100105943 259
23 3300006028 Ga0070717_10020123 Ga0070717_100201236 260
24 3300025928 Ga0207700_10025071 Ga0207700_100250713 260
25 3300021388 Ga0213875_10002433 Ga0213875_100024337 261
26 3300005459 Ga0068867_100155932 Ga0068867_1001559322 263
27 3300005842 Ga0068858_100100663 Ga0068858_1001006632 264
28 3300006931 Ga0097620_100035984 Ga0097620_1000359845 264
29 3300009177 Ga0105248_10172521 Ga0105248_101725212 264
30 3300039447 Ga0436361_0126076 Ga0436361_0126076_33825_34619 264
31 3300005344 Ga0070661_100004454 Ga0070661_1000044548 266
32 3300005366 Ga0070659_100020609 Ga0070659_1000206093 266
33 3300005456 Ga0070678_100058141 Ga0070678_1000581412 266
34 3300005539 Ga0068853_100089196 Ga0068853_1000891962 266
35 3300005563 Ga0068855_100006182 Ga0068855_10000618211 266
36 3300005614 Ga0068856_100113021 Ga0068856_1001130212 266
37 3300006237 Ga0097621_100007782 Ga0097621_1000077826 266
38 3300025949 Ga0207667_10015382 Ga0207667_100153825 266
39 3300026041 Ga0207639_10071858 Ga0207639_100718582 266
40 3300026078 Ga0207702_10110808 Ga0207702_101108082 266
41 3300009093 Ga0105240_10006036 Ga0105240_100060363 267
42 3300009545 Ga0105237_10020070 Ga0105237_100200703 267
43 3300013308 Ga0157375_10365794 Ga0157375_103657943 267
44 3300021361 Ga0213872_10000182 Ga0213872_1000018225 267
45 3300025928 Ga0207700_10151176 Ga0207700_101511763 267
46 3300014325 Ga0163163_10262804 Ga0163163_102628042 268
47 3300031711 Ga0265314_10004067 Ga0265314_1000406713 268
48 3300036401 Ga0373937_0579710 Ga0373937_0579710_240_1049 268
49 3300005563 Ga0068855_100422270 Ga0068855_1004222702 270
50 3300005614 Ga0068856_100078134 Ga0068856_1000781343 270
51 3300006871 Ga0075434_100519730 Ga0075434_1005197301 270
52 3300009093 Ga0105240_10002380 Ga0105240_100023803 270
53 3300013104 Ga0157370_10008793 Ga0157370_100087934 270
54 3300013105 Ga0157369_10002980 Ga0157369_1000298019 270
55 3300013297 Ga0157378_10709628 Ga0157378_107096282 270
56 3300013307 Ga0157372_10642051 Ga0157372_106420512 270
57 3300025949 Ga0207667_10002897 Ga0207667_1000289718 270
58 3300026078 Ga0207702_10073066 Ga0207702_100730663 270
59 3300006914 Ga0075436_100245419 Ga0075436_1002454192 273
60 3300013105 Ga0157369_10018191 Ga0157369_100181912 273
61 3300035725 Ga0373947_0339258 Ga0373947_0339258_29_850 273
62 3300050514 nmdc:mga08x19_166722_c1 nmdc:mga08x19_166722_c1_304_1125 273
63 3300045051 Ga0451576_0027465 Ga0451576_0027465_1680_2507 274
64 3300013296 Ga0157374_10094234 Ga0157374_100942343 276
65 3300035695 Ga0373927_0021009 Ga0373927_0021009_541_1371 276
66 3300036401 Ga0373937_0031410 Ga0373937_0031410_2739_3677 276
67 3300046472 Ga0495580_0009214 Ga0495580_0009214_6518_7456 276
68 3300046473 Ga0495582_0170535 Ga0495582_0170535_68_1006 276
69 3300053139 Ga0500568_0001026 Ga0500568_0001026_11836_12678 276
70 3300005329 Ga0070683_100181982 Ga0070683_1001819822 277
71 3300009093 Ga0105240_10000438 Ga0105240_1000043810 277
72 3300025913 Ga0207695_10001643 Ga0207695_1000164328 277
73 3300025927 Ga0207687_10059356 Ga0207687_100593564 277
74 3300049580 Ga0501046_0179356 Ga0501046_0179356_278_1180 279
75 3300005340 Ga0070689_100035832 Ga0070689_1000358323 280
76 3300005365 Ga0070688_100060103 Ga0070688_1000601033 280
77 3300005614 Ga0068856_100007745 Ga0068856_1000077459 280
78 3300009177 Ga0105248_10843926 Ga0105248_108439261 280
79 3300025936 Ga0207670_10384823 Ga0207670_103848232 280
80 3300026078 Ga0207702_10046537 Ga0207702_100465374 280
81 3300031344 Ga0265316_10069771 Ga0265316_100697712 280
82 3300039438 Ga0436360_0083056 Ga0436360_0083056_1033_1875 280
83 3300005329 Ga0070683_100151603 Ga0070683_1001516032 281
84 3300005458 Ga0070681_10181872 Ga0070681_101818722 281
85 3300013102 Ga0157371_10295588 Ga0157371_102955881 281
86 3300013104 Ga0157370_10379854 Ga0157370_103798542 281
87 3300025912 Ga0207707_10070907 Ga0207707_100709073 281
88 3300025921 Ga0207652_10162651 Ga0207652_101626512 281
89 3300025944 Ga0207661_10045282 Ga0207661_100452822 281
90 3300005436 Ga0070713_100069971 Ga0070713_1000699713 282
91 3300006914 Ga0075436_100148030 Ga0075436_1001480303 282
92 3300021388 Ga0213875_10030734 Ga0213875_100307342 282
93 3300025928 Ga0207700_10006266 Ga0207700_100062667 282
94 3300035692 Ga0373935_0152538 Ga0373935_0152538_266_1117 282
95 3300035695 Ga0373927_0002176 Ga0373927_0002176_5919_6770 282
96 3300037853 Ga0436364_1320403 Ga0436364_1320403_3011_3859 282
97 3300039437 Ga0436365_0781995 Ga0436365_0781995_4988_5836 282
98 3300039453 Ga0436362_0107282 Ga0436362_0107282_35_883 282
99 3300046472 Ga0495580_0157241 Ga0495580_0157241_586_1437 282
100 3300050514 nmdc:mga08x19_99120_c1 nmdc:mga08x19_99120_c1_84_944 282
101 3300046463 Ga0495653_0351902 Ga0495653_0351902_14_904 283
102 3300046663 Ga0495635_0387461 Ga0495635_0387461_18_908 283
103 3300046809 Ga0495600_0288351 Ga0495600_0288351_120_1010 283
104 3300014325 Ga0163163_10060399 Ga0163163_100603993 285
105 3300014968 Ga0157379_10002170 Ga0157379_100021703 285
106 3300021388 Ga0213875_10000112 Ga0213875_1000011226 285
107 3300035695 Ga0373927_0001152 Ga0373927_0001152_16840_17697 285
108 3300035724 Ga0373933_0290008 Ga0373933_0290008_55_939 285
109 3300035725 Ga0373947_0000440 Ga0373947_0000440_708_1565 285
110 3300037068 Ga0373925_0000291 Ga0373925_0000291_36781_37638 285
111 3300046690 Ga0495624_0118277 Ga0495624_0118277_701_1558 285
112 3300049568 Ga0501031_0001243 Ga0501031_0001243_4521_5381 285
113 3300049569 Ga0501032_0000837 Ga0501032_0000837_9675_10535 285
114 3300049570 Ga0501033_0012592 Ga0501033_0012592_1755_2615 285
115 3300049572 Ga0501036_0004940 Ga0501036_0004940_2067_2927 285
116 3300049573 Ga0501037_0007636 Ga0501037_0007636_5119_5979 285
117 3300049574 Ga0501038_0018241 Ga0501038_0018241_2067_2927 285
118 3300049575 Ga0501039_0005686 Ga0501039_0005686_4984_5844 285
119 3300049579 Ga0501043_0003588 Ga0501043_0003588_9942_10802 285
120 3300049580 Ga0501046_0000591 Ga0501046_0000591_29048_29908 285
121 3300049583 Ga0501067_0005951 Ga0501067_0005951_2018_2878 285
122 3300049585 Ga0501069_0000329 Ga0501069_0000329_6883_7743 285
123 3300049586 Ga0501070_0010268 Ga0501070_0010268_4451_5311 285
124 3300049588 Ga0501072_0001356 Ga0501072_0001356_3408_4268 285
125 3300049589 Ga0501073_0003261 Ga0501073_0003261_5247_6107 285
126 3300049593 Ga0501077_0001401 Ga0501077_0001401_1585_2445 285
127 3300049742 Ga0501080_0000466 Ga0501080_0000466_3756_4616 285
128 3300049744 Ga0501083_0032300 Ga0501083_0032300_792_1652 285
129 3300049822 Ga0501035_0542257 Ga0501035_0542257_82_942 285
130 3300049823 Ga0501044_0010485 Ga0501044_0010485_2429_3289 285
131 3300054114 Ga0501084_0006326 Ga0501084_0006326_3840_4700 285
132 3300060353 Ga0501082_0026085 Ga0501082_0026085_210_1070 285
133 3300005435 Ga0070714_100000466 Ga0070714_10000046621 286
134 3300005436 Ga0070713_100050114 Ga0070713_1000501143 286
135 3300025929 Ga0207664_10009750 Ga0207664_100097503 286
136 3300035692 Ga0373935_0041804 Ga0373935_0041804_1374_2249 286
137 3300036401 Ga0373937_0004941 Ga0373937_0004941_5915_6790 286
138 3300060353 Ga0501082_0000628 Ga0501082_0000628_23082_23945 286
139 3300005334 Ga0068869_100366776 Ga0068869_1003667761 287
140 3300005335 Ga0070666_10001216 Ga0070666_100012165 287
141 3300005338 Ga0068868_100014924 Ga0068868_1000149243 287
142 3300005339 Ga0070660_100016895 Ga0070660_1000168952 287
143 3300005355 Ga0070671_100062168 Ga0070671_1000621683 287
144 3300005367 Ga0070667_100014117 Ga0070667_1000141175 287
145 3300005456 Ga0070678_100190465 Ga0070678_1001904652 287
146 3300005458 Ga0070681_10003750 Ga0070681_100037503 287
147 3300005458 Ga0070681_10076188 Ga0070681_100761882 287
148 3300005458 Ga0070681_10168655 Ga0070681_101686552 287
149 3300005530 Ga0070679_100045021 Ga0070679_1000450212 287
150 3300005535 Ga0070684_100053642 Ga0070684_1000536425 287
151 3300005539 Ga0068853_100285655 Ga0068853_1002856552 287
152 3300005563 Ga0068855_100007115 Ga0068855_10000711513 287
153 3300005563 Ga0068855_100075132 Ga0068855_1000751322 287
154 3300005563 Ga0068855_100311963 Ga0068855_1003119632 287
155 3300005564 Ga0070664_100287734 Ga0070664_1002877342 287
156 3300005577 Ga0068857_100042008 Ga0068857_1000420083 287
157 3300005577 Ga0068857_100044035 Ga0068857_1000440355 287
158 3300005614 Ga0068856_100017457 Ga0068856_1000174576 287
159 3300005616 Ga0068852_100236810 Ga0068852_1002368101 287
160 3300005617 Ga0068859_100287841 Ga0068859_1002878412 287
161 3300005617 Ga0068859_100555121 Ga0068859_1005551211 287
162 3300005718 Ga0068866_10117744 Ga0068866_101177442 287
163 3300005841 Ga0068863_100029155 Ga0068863_1000291555 287
164 3300005842 Ga0068858_100007077 Ga0068858_1000070777 287
165 3300005843 Ga0068860_100017361 Ga0068860_1000173611 287
166 3300005844 Ga0068862_100314713 Ga0068862_1003147132 287
167 3300006237 Ga0097621_100005171 Ga0097621_1000051716 287
168 3300006237 Ga0097621_100037857 Ga0097621_1000378572 287
169 3300006358 Ga0068871_100012234 Ga0068871_1000122342 287
170 3300006358 Ga0068871_100022119 Ga0068871_1000221195 287
171 3300006881 Ga0068865_100006713 Ga0068865_1000067136 287
172 3300006881 Ga0068865_100303868 Ga0068865_1003038681 287
173 3300006931 Ga0097620_100287843 Ga0097620_1002878431 287
174 3300006931 Ga0097620_100555198 Ga0097620_1005551982 287
175 3300009093 Ga0105240_10134068 Ga0105240_101340684 287
176 3300009093 Ga0105240_10349729 Ga0105240_103497292 287
177 3300009098 Ga0105245_10004645 Ga0105245_1000464512 287
178 3300009098 Ga0105245_10011492 Ga0105245_100114926 287
179 3300009098 Ga0105245_10139230 Ga0105245_101392302 287
180 3300009148 Ga0105243_10060486 Ga0105243_100604863 287
181 3300009174 Ga0105241_10009077 Ga0105241_100090773 287
182 3300009174 Ga0105241_10160137 Ga0105241_101601372 287
183 3300009176 Ga0105242_10021182 Ga0105242_100211824 287
184 3300009176 Ga0105242_10146846 Ga0105242_101468462 287
185 3300009176 Ga0105242_10162931 Ga0105242_101629312 287
186 3300009177 Ga0105248_10011338 Ga0105248_100113386 287
187 3300009177 Ga0105248_10014487 Ga0105248_1001448710 287
188 3300009177 Ga0105248_10190498 Ga0105248_101904982 287
189 3300009545 Ga0105237_10035223 Ga0105237_100352235 287
190 3300009551 Ga0105238_10054930 Ga0105238_100549305 287
191 3300009551 Ga0105238_10212077 Ga0105238_102120772 287
192 3300010375 Ga0105239_10021580 Ga0105239_100215807 287
193 3300010375 Ga0105239_10043698 Ga0105239_100436984 287
194 3300013104 Ga0157370_10033507 Ga0157370_100335074 287
195 3300013105 Ga0157369_10090967 Ga0157369_100909673 287
196 3300013105 Ga0157369_10156947 Ga0157369_101569474 287
197 3300013296 Ga0157374_10263217 Ga0157374_102632172 287
198 3300013306 Ga0163162_10117749 Ga0163162_101177493 287
199 3300013306 Ga0163162_10274815 Ga0163162_102748152 287
200 3300013307 Ga0157372_10087034 Ga0157372_100870342 287
201 3300013308 Ga0157375_10005506 Ga0157375_100055062 287
202 3300014325 Ga0163163_10007738 Ga0163163_1000773810 287
203 3300014969 Ga0157376_10124542 Ga0157376_101245423 287
204 3300025909 Ga0207705_10251052 Ga0207705_102510522 287
205 3300025911 Ga0207654_10071147 Ga0207654_100711472 287
206 3300025911 Ga0207654_10092098 Ga0207654_100920982 287
207 3300025911 Ga0207654_10094372 Ga0207654_100943722 287
208 3300025912 Ga0207707_10007242 Ga0207707_100072428 287
209 3300025912 Ga0207707_10018406 Ga0207707_100184065 287
210 3300025913 Ga0207695_10004872 Ga0207695_1000487214 287
211 3300025913 Ga0207695_10021488 Ga0207695_100214886 287
212 3300025913 Ga0207695_10203491 Ga0207695_102034913 287
213 3300025914 Ga0207671_10031873 Ga0207671_100318733 287
214 3300025914 Ga0207671_10036999 Ga0207671_100369993 287
215 3300025917 Ga0207660_10322488 Ga0207660_103224881 287
216 3300025919 Ga0207657_10006856 Ga0207657_100068566 287
217 3300025919 Ga0207657_10210593 Ga0207657_102105931 287
218 3300025921 Ga0207652_10051504 Ga0207652_100515042 287
219 3300025924 Ga0207694_10021690 Ga0207694_100216903 287
220 3300025924 Ga0207694_10113398 Ga0207694_101133982 287
221 3300025927 Ga0207687_10006599 Ga0207687_100065992 287
222 3300025927 Ga0207687_10090667 Ga0207687_100906672 287
223 3300025931 Ga0207644_10056471 Ga0207644_100564712 287
224 3300025934 Ga0207686_10044422 Ga0207686_100444224 287
225 3300025934 Ga0207686_10097490 Ga0207686_100974902 287
226 3300025935 Ga0207709_10049941 Ga0207709_100499412 287
227 3300025935 Ga0207709_10410129 Ga0207709_104101292 287
228 3300025938 Ga0207704_10039779 Ga0207704_100397791 287
229 3300025938 Ga0207704_10268234 Ga0207704_102682342 287
230 3300025941 Ga0207711_10010896 Ga0207711_100108965 287
231 3300025941 Ga0207711_10060297 Ga0207711_100602975 287
232 3300025941 Ga0207711_10120653 Ga0207711_101206532 287
233 3300025941 Ga0207711_10263841 Ga0207711_102638411 287
234 3300025942 Ga0207689_10356429 Ga0207689_103564292 287
235 3300025944 Ga0207661_10071628 Ga0207661_100716285 287
236 3300025949 Ga0207667_10058921 Ga0207667_100589213 287
237 3300025986 Ga0207658_10286479 Ga0207658_102864791 287
238 3300026023 Ga0207677_10013085 Ga0207677_100130854 287
239 3300026035 Ga0207703_10032063 Ga0207703_100320636 287
240 3300026041 Ga0207639_10268384 Ga0207639_102683842 287
241 3300026041 Ga0207639_10429448 Ga0207639_104294481 287
242 3300026078 Ga0207702_10095606 Ga0207702_100956062 287
243 3300026078 Ga0207702_10146814 Ga0207702_101468142 287
244 3300026088 Ga0207641_10152713 Ga0207641_101527133 287
245 3300026089 Ga0207648_10342903 Ga0207648_103429032 287
246 3300026116 Ga0207674_10000915 Ga0207674_100009157 287
247 3300026116 Ga0207674_10003947 Ga0207674_100039477 287
248 3300026116 Ga0207674_10039864 Ga0207674_100398643 287
249 3300026121 Ga0207683_10324153 Ga0207683_103241532 287
250 3300026142 Ga0207698_10538264 Ga0207698_105382642 287
251 3300028380 Ga0268265_10189884 Ga0268265_101898842 287
252 3300028381 Ga0268264_10012279 Ga0268264_100122795 287
253 3300031250 Ga0265331_10032071 Ga0265331_100320712 287
254 3300031344 Ga0265316_10103536 Ga0265316_101035362 287
255 3300031595 Ga0265313_10121876 Ga0265313_101218761 287
256 3300031711 Ga0265314_10003430 Ga0265314_100034302 287
257 3300035241 Ga0373961_0103773 Ga0373961_0103773_20_889 287
258 3300035692 Ga0373935_0244315 Ga0373935_0244315_353_1219 287
259 3300036401 Ga0373937_0171804 Ga0373937_0171804_340_1206 287
260 3300036401 Ga0373937_0178704 Ga0373937_0178704_318_1184 287
261 3300037068 Ga0373925_0038328 Ga0373925_0038328_2650_3516 287
262 3300046499 Ga0495594_0100623 Ga0495594_0100623_50_916 287
263 3300046559 Ga0495667_0254309 Ga0495667_0254309_230_1096 287
264 3300048904 Ga0496101_0448541 Ga0496101_0448541_141_1007 287
265 3300009098 Ga0105245_10559140 Ga0105245_105591402 288
266 3300009177 Ga0105248_10086844 Ga0105248_100868443 288
267 3300005364 Ga0070673_100103610 Ga0070673_1001036102 290
268 3300005458 Ga0070681_10057910 Ga0070681_100579102 290
269 3300006847 Ga0075431_100002093 Ga0075431_1000020934 290
270 3300009147 Ga0114129_10190332 Ga0114129_101903322 290
271 3300009147 Ga0114129_10207124 Ga0114129_102071243 290
272 3300014969 Ga0157376_10298534 Ga0157376_102985342 290
273 3300025912 Ga0207707_10005115 Ga0207707_100051152 290
274 3300025960 Ga0207651_10080175 Ga0207651_100801752 290
275 3300036401 Ga0373937_0243085 Ga0373937_0243085_645_1520 290
276 3300037068 Ga0373925_0102937 Ga0373925_0102937_17_919 290
277 3300037068 Ga0373925_0198034 Ga0373925_0198034_332_1207 290
278 3300050507 nmdc:mga05p37_270944_c1 nmdc:mga05p37_270944_c1_258_1133 290
279 3300050507 nmdc:mga05p37_664719_c1 nmdc:mga05p37_664719_c1_40_915 290
280 3300050510 nmdc:mga06r32_2312_c1 nmdc:mga06r32_2312_c1_14665_15540 290
281 3300005435 Ga0070714_100236375 Ga0070714_1002363752 291
282 3300046472 Ga0495580_0114746 Ga0495580_0114746_840_1769 291
283 3300049576 Ga0501040_0118464 Ga0501040_0118464_270_1148 291
284 3300005329 Ga0070683_100341953 Ga0070683_1003419532 292
285 3300013102 Ga0157371_10155636 Ga0157371_101556362 292
286 3300013307 Ga0157372_10523705 Ga0157372_105237052 292
287 3300025944 Ga0207661_10328995 Ga0207661_103289952 292
288 3300013104 Ga0157370_10226846 Ga0157370_102268462 293
289 3300049581 Ga0501047_0109908 Ga0501047_0109908_1632_2516 293
290 3300046543 Ga0495645_0254639 Ga0495645_0254639_32_955 294
291 3300046559 Ga0495667_0096555 Ga0495667_0096555_408_1331 294
292 3300047319 Ga0495674_0085631 Ga0495674_0085631_324_1247 294
293 3300047471 Ga0495684_0059530 Ga0495684_0059530_1598_2521 294
294 3300005841 Ga0068863_100022659 Ga0068863_1000226594 295
295 3300009177 Ga0105248_10090378 Ga0105248_100903782 295
296 3300025941 Ga0207711_10016663 Ga0207711_100166631 295
297 3300026088 Ga0207641_10206911 Ga0207641_102069111 295
298 3300005329 Ga0070683_100004185 Ga0070683_1000041858 296
299 3300005535 Ga0070684_100003472 Ga0070684_1000034728 296
300 3300005544 Ga0070686_100181348 Ga0070686_1001813482 296
301 3300005563 Ga0068855_100068165 Ga0068855_1000681652 296
302 3300006358 Ga0068871_100453483 Ga0068871_1004534832 296
303 3300009093 Ga0105240_10136637 Ga0105240_101366372 296
304 3300009177 Ga0105248_10212800 Ga0105248_102128002 296
305 3300009545 Ga0105237_10043120 Ga0105237_100431203 296
306 3300010375 Ga0105239_10207896 Ga0105239_102078963 296
307 3300014325 Ga0163163_10215808 Ga0163163_102158082 296
308 3300025913 Ga0207695_10189756 Ga0207695_101897562 296
309 3300025914 Ga0207671_10013835 Ga0207671_100138357 296
310 3300025941 Ga0207711_10175039 Ga0207711_101750392 296
311 3300025944 Ga0207661_10002898 Ga0207661_100028984 296
312 3300025949 Ga0207667_10053542 Ga0207667_100535423 296
313 3300031344 Ga0265316_10007312 Ga0265316_100073128 296
314 3300037853 Ga0436364_0885924 Ga0436364_0885924_640_1536 297
315 3300037853 Ga0436364_1190248 Ga0436364_1190248_1807_2814 298
316 3300005327 Ga0070658_10023937 Ga0070658_100239372 299
317 3300005327 Ga0070658_10039050 Ga0070658_100390502 299
318 3300005336 Ga0070680_100133221 Ga0070680_1001332212 299
319 3300005364 Ga0070673_100162879 Ga0070673_1001628792 299
320 3300005439 Ga0070711_100035437 Ga0070711_1000354372 299
321 3300005455 Ga0070663_100031635 Ga0070663_1000316353 299
322 3300005456 Ga0070678_100208066 Ga0070678_1002080662 299
323 3300005458 Ga0070681_10167108 Ga0070681_101671082 299
324 3300005467 Ga0070706_100153361 Ga0070706_1001533613 299
325 3300005467 Ga0070706_100493618 Ga0070706_1004936181 299
326 3300005518 Ga0070699_100177925 Ga0070699_1001779252 299
327 3300005530 Ga0070679_100009067 Ga0070679_1000090674 299
328 3300005535 Ga0070684_100025397 Ga0070684_1000253973 299
329 3300005535 Ga0070684_100173122 Ga0070684_1001731222 299
330 3300005536 Ga0070697_100057484 Ga0070697_1000574842 299
331 3300005536 Ga0070697_100270580 Ga0070697_1002705802 299
332 3300005546 Ga0070696_100002960 Ga0070696_1000029604 299
333 3300005563 Ga0068855_100011731 Ga0068855_1000117319 299
334 3300005563 Ga0068855_100258263 Ga0068855_1002582632 299
335 3300005937 Ga0081455_10021567 Ga0081455_100215674 299
336 3300006237 Ga0097621_100176696 Ga0097621_1001766962 299
337 3300006846 Ga0075430_100031547 Ga0075430_1000315473 299
338 3300006847 Ga0075431_100020038 Ga0075431_1000200386 299
339 3300006871 Ga0075434_100412272 Ga0075434_1004122722 299
340 3300006914 Ga0075436_100001102 Ga0075436_1000011028 299
341 3300009093 Ga0105240_10001298 Ga0105240_1000129816 299
342 3300009093 Ga0105240_10600270 Ga0105240_106002702 299
343 3300009098 Ga0105245_10170665 Ga0105245_101706653 299
344 3300009176 Ga0105242_10369926 Ga0105242_103699262 299
345 3300009545 Ga0105237_10014903 Ga0105237_100149031 299
346 3300013102 Ga0157371_10422844 Ga0157371_104228441 299
347 3300013104 Ga0157370_10147608 Ga0157370_101476082 299
348 3300013105 Ga0157369_10008243 Ga0157369_100082432 299
349 3300013105 Ga0157369_10467608 Ga0157369_104676081 299
350 3300013296 Ga0157374_10028553 Ga0157374_100285533 299
351 3300013296 Ga0157374_10166838 Ga0157374_101668382 299
352 3300013307 Ga0157372_10110563 Ga0157372_101105631 299
353 3300013307 Ga0157372_10567687 Ga0157372_105676872 299
354 3300014325 Ga0163163_10030037 Ga0163163_100300374 299
355 3300021384 Ga0213876_10001101 Ga0213876_100011012 299
356 3300021384 Ga0213876_10012915 Ga0213876_100129155 299
357 3300021384 Ga0213876_10017670 Ga0213876_100176702 299
358 3300021384 Ga0213876_10033868 Ga0213876_100338681 299
359 3300021388 Ga0213875_10000002 Ga0213875_10000002118 299
360 3300021388 Ga0213875_10019453 Ga0213875_100194533 299
361 3300021388 Ga0213875_10027672 Ga0213875_100276723 299
362 3300021388 Ga0213875_10064972 Ga0213875_100649722 299
363 3300025909 Ga0207705_10004239 Ga0207705_100042392 299
364 3300025912 Ga0207707_10100247 Ga0207707_101002472 299
365 3300025913 Ga0207695_10011537 Ga0207695_100115375 299
366 3300025914 Ga0207671_10133008 Ga0207671_101330082 299
367 3300025916 Ga0207663_10041403 Ga0207663_100414032 299
368 3300025917 Ga0207660_10087717 Ga0207660_100877172 299
369 3300025939 Ga0207665_10086356 Ga0207665_100863563 299
370 3300025949 Ga0207667_10007403 Ga0207667_1000740310 299
371 3300025960 Ga0207651_10128700 Ga0207651_101287002 299
372 3300026088 Ga0207641_10416349 Ga0207641_104163491 299
373 3300026121 Ga0207683_10095240 Ga0207683_100952403 299
374 3300028653 Ga0265323_10000134 Ga0265323_1000013419 299
375 3300028800 Ga0265338_10104265 Ga0265338_101042652 299
376 3300031235 Ga0265330_10072275 Ga0265330_100722752 299
377 3300031238 Ga0265332_10034732 Ga0265332_100347322 299
378 3300031239 Ga0265328_10005285 Ga0265328_100052852 299
379 3300031240 Ga0265320_10000647 Ga0265320_1000064723 299
380 3300031241 Ga0265325_10040510 Ga0265325_100405102 299
381 3300031249 Ga0265339_10048793 Ga0265339_100487931 299
382 3300031250 Ga0265331_10026752 Ga0265331_100267522 299
383 3300031251 Ga0265327_10127010 Ga0265327_101270102 299
384 3300031344 Ga0265316_10002494 Ga0265316_1000249413 299
385 3300031344 Ga0265316_10002556 Ga0265316_100025562 299
386 3300031344 Ga0265316_10051195 Ga0265316_100511952 299
387 3300031344 Ga0265316_10118307 Ga0265316_101183072 299
388 3300031711 Ga0265314_10007627 Ga0265314_100076279 299
389 3300031711 Ga0265314_10056536 Ga0265314_100565362 299
390 3300031711 Ga0265314_10169291 Ga0265314_101692911 299
391 3300031712 Ga0265342_10008795 Ga0265342_100087952 299
392 3300035695 Ga0373927_0063960 Ga0373927_0063960_1438_2367 299
393 3300035725 Ga0373947_0048032 Ga0373947_0048032_1195_2124 299
394 3300037068 Ga0373925_0122619 Ga0373925_0122619_535_1464 299
395 3300037853 Ga0436364_0160423 Ga0436364_0160423_3918_4820 299
396 3300037853 Ga0436364_0323484 Ga0436364_0323484_626_1576 299
397 3300037853 Ga0436364_0417184 Ga0436364_0417184_1302_2204 299
398 3300037853 Ga0436364_0462115 Ga0436364_0462115_92_994 299
399 3300037853 Ga0436364_0517360 Ga0436364_0517360_5843_6745 299
400 3300037853 Ga0436364_0602871 Ga0436364_0602871_633_1535 299
401 3300037853 Ga0436364_0612043 Ga0436364_0612043_135473_136375 299
402 3300037853 Ga0436364_0749502 Ga0436364_0749502_80939_81841 299
403 3300037853 Ga0436364_0919396 Ga0436364_0919396_7666_8568 299
404 3300037853 Ga0436364_1074929 Ga0436364_1074929_6313_7242 299
405 3300037853 Ga0436364_1199688 Ga0436364_1199688_604_1503 299
406 3300037853 Ga0436364_1275864 Ga0436364_1275864_574_1476 299
407 3300037853 Ga0436364_1350595 Ga0436364_1350595_4374_5276 299
408 3300039437 Ga0436365_0041310 Ga0436365_0041310_6603_7505 299
409 3300039437 Ga0436365_0188047 Ga0436365_0188047_2962_3864 299
410 3300039437 Ga0436365_1556319 Ga0436365_1556319_2266_3195 299
411 3300039438 Ga0436360_0386665 Ga0436360_0386665_803_1705 299
412 3300046462 Ga0495651_0012820 Ga0495651_0012820_3219_4118 299
413 3300046462 Ga0495651_0013954 Ga0495651_0013954_3955_4893 299
414 3300046463 Ga0495653_0062251 Ga0495653_0062251_163_1062 299
415 3300046472 Ga0495580_0000307 Ga0495580_0000307_33349_34287 299
416 3300046472 Ga0495580_0092746 Ga0495580_0092746_1079_1981 299
417 3300046472 Ga0495580_0097462 Ga0495580_0097462_803_1741 299
418 3300046476 Ga0495662_0020034 Ga0495662_0020034_243_1142 299
419 3300046477 Ga0495664_0001207 Ga0495664_0001207_9176_10075 299
420 3300046511 Ga0495608_0098605 Ga0495608_0098605_971_1870 299
421 3300046514 Ga0495618_0011534 Ga0495618_0011534_3940_4839 299
422 3300046516 Ga0495628_0060980 Ga0495628_0060980_1767_2705 299
423 3300046516 Ga0495628_0096927 Ga0495628_0096927_1346_2245 299
424 3300046516 Ga0495628_0153509 Ga0495628_0153509_279_1217 299
425 3300046517 Ga0495630_0021418 Ga0495630_0021418_1658_2557 299
426 3300046526 Ga0495666_0121362 Ga0495666_0121362_198_1097 299
427 3300046529 Ga0495652_0012517 Ga0495652_0012517_4961_5860 299
428 3300046529 Ga0495652_0222003 Ga0495652_0222003_302_1240 299
429 3300046533 Ga0495640_0014385 Ga0495640_0014385_3304_4203 299
430 3300046536 Ga0495587_0060073 Ga0495587_0060073_253_1152 299
431 3300046536 Ga0495587_0067703 Ga0495587_0067703_861_1799 299
432 3300046543 Ga0495645_0001895 Ga0495645_0001895_1660_2559 299
433 3300046543 Ga0495645_0052350 Ga0495645_0052350_250_1188 299
434 3300046559 Ga0495667_0017192 Ga0495667_0017192_1677_2576 299
435 3300046559 Ga0495667_0055543 Ga0495667_0055543_710_1648 299
436 3300046559 Ga0495667_0120381 Ga0495667_0120381_641_1579 299
437 3300046642 Ga0495634_0324998 Ga0495634_0324998_11_910 299
438 3300046675 Ga0495657_0090832 Ga0495657_0090832_698_1636 299
439 3300046678 Ga0495599_0254758 Ga0495599_0254758_101_1039 299
440 3300046678 Ga0495599_0276675 Ga0495599_0276675_77_976 299
441 3300046679 Ga0495623_0008815 Ga0495623_0008815_642_1580 299
442 3300046679 Ga0495623_0129573 Ga0495623_0129573_217_1155 299
443 3300046679 Ga0495623_0150502 Ga0495623_0150502_244_1182 299
444 3300046680 Ga0495646_0003605 Ga0495646_0003605_8758_9657 299
445 3300046689 Ga0495613_0149147 Ga0495613_0149147_694_1632 299
446 3300046809 Ga0495600_0029021 Ga0495600_0029021_2088_2987 299
447 3300047317 Ga0495604_0134157 Ga0495604_0134157_529_1467 299
448 3300047317 Ga0495604_0201921 Ga0495604_0201921_464_1363 299
449 3300047317 Ga0495604_0209313 Ga0495604_0209313_169_1107 299
450 3300047319 Ga0495674_0021714 Ga0495674_0021714_1659_2558 299
451 3300047319 Ga0495674_0051736 Ga0495674_0051736_1274_2203 299
452 3300047322 Ga0495680_0050172 Ga0495680_0050172_2098_2997 299
453 3300047322 Ga0495680_0059986 Ga0495680_0059986_1235_2173 299
454 3300047444 Ga0495675_0026271 Ga0495675_0026271_740_1678 299
455 3300047444 Ga0495675_0046610 Ga0495675_0046610_306_1205 299
456 3300047444 Ga0495675_0149789 Ga0495675_0149789_70_1008 299
457 3300047444 Ga0495675_0233069 Ga0495675_0233069_86_1024 299
458 3300047471 Ga0495684_0001076 Ga0495684_0001076_15581_16519 299
459 3300048088 Ga0495602_0058118 Ga0495602_0058118_1059_1997 299
460 3300048088 Ga0495602_0202928 Ga0495602_0202928_363_1262 299
461 3300048915 Ga0496112_0280315 Ga0496112_0280315_339_1241 299
462 3300048917 Ga0496114_0346075 Ga0496114_0346075_100_1029 299
463 3300048918 Ga0496115_0041258 Ga0496115_0041258_2429_3331 299
464 3300048918 Ga0496115_0494068 Ga0496115_0494068_55_954 299
465 3300049581 Ga0501047_0039486 Ga0501047_0039486_1972_2874 299
466 3300050508 nmdc:mga09592_431077_c1 nmdc:mga09592_431077_c1_133_1032 299
467 3300050509 nmdc:mga0qj67_16078_c1 nmdc:mga0qj67_16078_c1_2337_3236 299
468 3300050514 nmdc:mga08x19_1799_c1 nmdc:mga08x19_1799_c1_7179_8117 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

25

316

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8956 52 288
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8392 52 288
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8358 25 292
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.8138 17 289
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.752 25 292
ID Description Score Start End Superfamily
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6208 106 211 3.40.50.620
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6046 119 194 3.40.50.300
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5857 114 233 3.40.1010.10
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5806 114 233 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5377 114 233 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7C3DGD9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.979 1 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A7C3DGD9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9758 1 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A372IUT9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9635 8 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W0XF88-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9574 1 298 GO:0005886
GO:0009247
GO:0016746
AF-A0A348W4E7-F1-model_v4 deleted 0.9566 71 296

Feature Viewer

pLDDT pTM Quality
94.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map