F450080

General Info

Members Datasets Scaffolds Average Seq Length
468 250 422 146

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0802737|Ga0451793_0802737_709_1230
Length 173
Sequence LRHRHGAPGFLFDQAGFMTTESRVPSPRSRLFSWPTRIYWEDTDAGGVVYHARYVAFLERARTEWLRALGYGQERLRLQHDLVFAVRAMQLDFLRPAHLDDTLQVGVALSQCKRASLLFAQSIHRDGELLLRAQVKVAALGAGNFRPRGIDDALYDMLKALEITETELLRNDG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
17 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
18 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
19 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
20 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
21 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
22 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
23 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
24 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
25 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
26 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
27 2919513703 Luteimonas sp. 3794 Isolate Unclassified
28 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
29 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
30 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
31 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
32 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
33 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
34 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
35 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
36 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
37 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
38 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
39 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
40 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
41 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
42 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
43 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
155 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
193 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
247 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
248 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
249 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
250 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.17
Metatranscriptomes 0
Isolates 9.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 22.44
Nodule 0.21
Rhizoplane 6.2
Rhizosphere 48.5
Stem 0
Stem Tuber 0
Unclassified 22.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_133374 2162886007 Bacteria 5083
2 SwRhRL2b_contig_183084 2162886007 Bacteria 5833
3 JGI25152J39213_1000170 3300002773 Bacteria 43894
4 JGI25150J39212_1000122 3300002774 Bacteria 43890
5 JGI25151J46595_10000411 3300003187 Bacteria 43894
6 JGI25151J46595_10040138 3300003187 Bacteria 1719
7 JGI25151J46595_10060528 3300003187 Bacteria 1210
8 JGI25406J46586_10193305 3300003203 Bacteria 594
9 JGI25153J46596_10000252 3300003215 Bacteria 43894
10 rootH2_10039924 3300003320 Bacteria 1733
11 rootH1_10123618 3300003323 Bacteria 1174
12 rootH1_10332456 3300003323 Bacteria 1165
13 Ga0055526_1000022 3300003771 Bacteria 172746
14 Ga0055526_1001381 3300003771 Bacteria 17361
15 Ga0055526_1014034 3300003771 Bacteria 3330
16 Ga0055537_1000009 3300003773 Bacteria 140933
17 Ga0055537_1000085 3300003773 Bacteria 67908
18 Ga0055524_1000036 3300003775 Bacteria 171459
19 Ga0055524_1017286 3300003775 Bacteria 2548
20 Ga0055524_1038314 3300003775 Bacteria 1256
21 Ga0055524_1053368 3300003775 Bacteria 895
22 Ga0055524_1081807 3300003775 Bacteria 585
23 Ga0055536_1001085 3300003781 Bacteria 17131
24 Ga0055536_1009147 3300003781 Bacteria 4146
25 Ga0055536_1012787 3300003781 Bacteria 3082
26 Ga0055536_1015211 3300003781 Bacteria 2648
27 Ga0055536_1017645 3300003781 Bacteria 2325
28 Ga0055536_1017646 3300003781 Bacteria 2325
29 Ga0055536_1029477 3300003781 Bacteria 1474
30 Ga0055536_1029658 3300003781 Bacteria 1465
31 Ga0055536_1083139 3300003781 Bacteria 603
32 Ga0055534_1000010 3300003784 Bacteria 171486
33 Ga0055534_1000476 3300003784 Bacteria 22547
34 Ga0055528_1000014 3300003790 Bacteria 172746
35 Ga0055528_1000121 3300003790 Bacteria 62003
36 Ga0055530_10003719 3300003791 Bacteria 8478
37 Ga0055530_10004345 3300003791 Bacteria 7356
38 Ga0055530_10004553 3300003791 Bacteria 7083
39 Ga0055540_1062688 3300003792 Bacteria 740
40 Ga0055531_10011794 3300003794 Bacteria 4173
41 Ga0055531_10016173 3300003794 Bacteria 3236
42 Ga0055531_10028285 3300003794 Bacteria 1938
43 Ga0055531_10032208 3300003794 Bacteria 1717
44 Ga0055531_10038093 3300003794 Bacteria 1449
45 Ga0058692_1000011 3300003856 Bacteria 321321
46 Ga0058692_1000033 3300003856 Bacteria 174393
47 Ga0065714_10095844 3300005288 Bacteria 1776
48 Ga0065704_10000377 3300005289 Bacteria 25325
49 Ga0065704_10071669 3300005289 Bacteria 10309
50 Ga0065704_10177511 3300005289 Bacteria 1255
51 Ga0065715_10336124 3300005293 Bacteria 975
52 Ga0065715_10427161 3300005293 Bacteria 851
53 Ga0065715_10968613 3300005293 Bacteria 552
54 Ga0070658_11752104 3300005327 Bacteria 537
55 Ga0070670_100259773 3300005331 Bacteria 1514
56 Ga0070670_100303993 3300005331 Bacteria 1396
57 Ga0070660_100072518 3300005339 Bacteria 2691
58 Ga0070660_100737986 3300005339 Bacteria 827
59 Ga0070668_100519672 3300005347 Bacteria 1033
60 Ga0070669_100687379 3300005353 Bacteria 863
61 Ga0070669_100891257 3300005353 Bacteria 759
62 Ga0070675_100856482 3300005354 Bacteria 832
63 Ga0070671_100151737 3300005355 Bacteria 1956
64 Ga0070674_100080225 3300005356 Bacteria 2330
65 Ga0070674_100457192 3300005356 Bacteria 1055
66 Ga0070659_100102268 3300005366 Bacteria 2307
67 Ga0070659_100319348 3300005366 Bacteria 1298
68 Ga0070667_100578130 3300005367 Bacteria 1034
69 Ga0070667_101626502 3300005367 Bacteria 607
70 Ga0070678_100149067 3300005456 Bacteria 1882
71 Ga0068853_100887402 3300005539 Bacteria 856
72 Ga0070672_100055517 3300005543 Bacteria 3103
73 Ga0070672_100349002 3300005543 Bacteria 1261
74 Ga0070693_100171619 3300005547 Bacteria 1390
75 Ga0070665_100236002 3300005548 Bacteria 1829
76 Ga0068855_100447755 3300005563 Bacteria 1409
77 Ga0070664_101665144 3300005564 Bacteria 605
78 Ga0068864_100691757 3300005618 Bacteria 995
79 Ga0068862_100090458 3300005844 Bacteria 2665
80 Ga0081539_10051661 3300005985 Bacteria 2314
81 Ga0075363_100299377 3300006048 Bacteria 933
82 Ga0075363_100554585 3300006048 Bacteria 686
83 Ga0075364_10062410 3300006051 Bacteria 2445
84 Ga0075364_10184209 3300006051 Bacteria 1414
85 Ga0075364_10309070 3300006051 Bacteria 1076
86 Ga0075364_10476108 3300006051 Bacteria 853
87 Ga0075364_10780626 3300006051 Bacteria 651
88 Ga0075364_10820434 3300006051 Bacteria 634
89 Ga0075362_10136447 3300006177 Bacteria 1170
90 Ga0075367_10031080 3300006178 Bacteria 3066
91 Ga0075369_10102818 3300006186 Bacteria 1283
92 Ga0105251_10000076 3300009011 Bacteria 93688
93 Ga0105251_10014369 3300009011 Bacteria 4382
94 Ga0105244_10023879 3300009036 Bacteria 3344
95 Ga0105244_10170783 3300009036 Bacteria 1035
96 Ga0105250_10160933 3300009092 Bacteria 937
97 Ga0105243_10043817 3300009148 Bacteria 3508
98 Ga0105243_10138400 3300009148 Bacteria 2074
99 Ga0105246_11210157 3300011119 Bacteria 696
100 Ga0157316_1008670 3300012510 Bacteria 895
101 Ga0157373_10110856 3300013100 Bacteria 1929
102 Ga0157373_10176517 3300013100 Bacteria 1504
103 Ga0157373_11320728 3300013100 Bacteria 546
104 Ga0157371_10004109 3300013102 Bacteria 12851
105 Ga0157371_10076513 3300013102 Bacteria 2370
106 Ga0157371_10141016 3300013102 Bacteria 1716
107 Ga0157371_10173931 3300013102 Bacteria 1539
108 Ga0157371_10299609 3300013102 Bacteria 1164
109 Ga0157371_10542655 3300013102 Bacteria 861
110 Ga0157370_10068012 3300013104 Bacteria 3367
111 Ga0157370_10179751 3300013104 Bacteria 1966
112 Ga0157370_10260211 3300013104 Bacteria 1604
113 Ga0157369_10036315 3300013105 Bacteria 5399
114 Ga0157369_10065953 3300013105 Bacteria 3895
115 Ga0163162_10132071 3300013306 Bacteria 2606
116 Ga0157372_10075425 3300013307 Bacteria 3805
117 Ga0157372_10482882 3300013307 Bacteria 1445
118 Ga0157375_10486132 3300013308 Bacteria 1399
119 Ga0157380_10260689 3300014326 Bacteria 1574
120 Ga0157380_10560739 3300014326 Bacteria 1122
121 Ga0157380_11370799 3300014326 Bacteria 757
122 Ga0182008_10000064 3300014497 Bacteria 88760
123 Ga0182008_10060738 3300014497 Bacteria 1863
124 Ga0182006_1077462 3300015261 Bacteria 1219
125 Ga0182006_1088962 3300015261 Bacteria 1114
126 Ga0182006_1150627 3300015261 Bacteria 789
127 Ga0182007_10000026 3300015262 Bacteria 168694
128 Ga0182005_1000232 3300015265 Bacteria 36038
129 Ga0182005_1004536 3300015265 Bacteria 4473
130 Ga0163161_10118906 3300017792 Bacteria 1984
131 Ga0163161_10231302 3300017792 Bacteria 1435
132 Ga0163161_10375232 3300017792 Bacteria 1136
133 Ga0163161_10384870 3300017792 Bacteria 1122
134 Ga0163161_10864323 3300017792 Bacteria 764
135 Ga0207425_1000066 3300025245 Bacteria 125463
136 Ga0207425_1035805 3300025245 Bacteria 967
137 Ga0209129_1000135 3300025258 Bacteria 125520
138 Ga0209565_1000001 3300025263 Bacteria 2950419
139 Ga0209565_1000023 3300025263 Bacteria 388244
140 Ga0209673_1000001 3300025273 Bacteria 3176258
141 Ga0209673_1000116 3300025273 Bacteria 175933
142 Ga0209130_1002852 3300025284 Bacteria 8013
143 Ga0209130_1004177 3300025284 Bacteria 5647
144 Ga0209675_1000001 3300025291 Bacteria 2950293
145 Ga0209675_1000016 3300025291 Bacteria 391965
146 Ga0209676_1000037 3300025292 Bacteria 457562
147 Ga0209676_1000129 3300025292 Bacteria 187495
148 Ga0209676_1000549 3300025292 Bacteria 57408
149 Ga0209676_1001804 3300025292 Bacteria 17921
150 Ga0209676_1003577 3300025292 Bacteria 9387
151 Ga0209676_1023943 3300025292 Bacteria 1988
152 Ga0209676_1035036 3300025292 Bacteria 1477
153 Ga0209025_1000006 3300025294 Bacteria 1153444
154 Ga0209025_1000013 3300025294 Bacteria 871757
155 Ga0209025_1005017 3300025294 Bacteria 11051
156 Ga0209025_1010348 3300025294 Bacteria 6330
157 Ga0209025_1044935 3300025294 Bacteria 1839
158 Ga0209025_1131028 3300025294 Bacteria 729
159 Ga0209564_1000001 3300025295 Bacteria 3176258
160 Ga0209564_1001691 3300025295 Bacteria 20950
161 Ga0209564_1006245 3300025295 Bacteria 6498
162 Ga0209758_1000014 3300025297 Bacteria 871757
163 Ga0209758_1008478 3300025297 Bacteria 6643
164 Ga0209758_1022513 3300025297 Bacteria 2884
165 Ga0209050_1001795 3300025298 Bacteria 21074
166 Ga0209050_1004211 3300025298 Bacteria 9928
167 Ga0209050_1004412 3300025298 Bacteria 9524
168 Ga0209256_1000006 3300025299 Bacteria 1250310
169 Ga0209256_1004858 3300025299 Bacteria 8120
170 Ga0209256_1008734 3300025299 Bacteria 4621
171 Ga0209256_1010089 3300025299 Bacteria 4018
172 Ga0209256_1011430 3300025299 Bacteria 3551
173 Ga0209256_1043350 3300025299 Bacteria 1130
174 Ga0207426_1123399 3300025302 Bacteria 637
175 Ga0209051_1002501 3300025303 Bacteria 13095
176 Ga0209257_1000219 3300025304 Bacteria 135666
177 Ga0209257_1000398 3300025304 Bacteria 85573
178 Ga0209257_1002658 3300025304 Bacteria 17158
179 Ga0209257_1005158 3300025304 Bacteria 9428
180 Ga0209257_1007310 3300025304 Bacteria 6713
181 Ga0209257_1010357 3300025304 Bacteria 4739
182 Ga0207655_1021365 3300025728 Bacteria 3286
183 Ga0207713_1000308 3300025735 Bacteria 55649
184 Ga0207713_1015809 3300025735 Bacteria 3856
185 Ga0207705_10050568 3300025909 Bacteria 2992
186 Ga0207657_10121482 3300025919 Bacteria 2149
187 Ga0207657_11091044 3300025919 Bacteria 610
188 Ga0207652_10619346 3300025921 Bacteria 970
189 Ga0207681_10316875 3300025923 Bacteria 1239
190 Ga0207681_10843356 3300025923 Bacteria 766
191 Ga0207650_10002715 3300025925 Bacteria 12222
192 Ga0207650_10050889 3300025925 Bacteria 3065
193 Ga0207690_10068613 3300025932 Bacteria 2437
194 Ga0207690_10274047 3300025932 Bacteria 1312
195 Ga0207709_10003998 3300025935 Bacteria 8598
196 Ga0207709_10020946 3300025935 Bacteria 3695
197 Ga0207669_10502513 3300025937 Bacteria 970
198 Ga0207669_10633358 3300025937 Bacteria 873
199 Ga0207691_10005846 3300025940 Bacteria 11899
200 Ga0207691_10199640 3300025940 Bacteria 1741
201 Ga0207679_10337940 3300025945 Bacteria 1309
202 Ga0207667_10584849 3300025949 Bacteria 1127
203 Ga0207651_10375902 3300025960 Bacteria 1203
204 Ga0207668_10018301 3300025972 Bacteria 4405
205 Ga0207668_10508197 3300025972 Bacteria 1038
206 Ga0207668_10790177 3300025972 Bacteria 839
207 Ga0207658_10295507 3300025986 Bacteria 1394
208 Ga0207658_11346974 3300025986 Bacteria 653
209 Ga0207639_10593416 3300026041 Bacteria 1021
210 Ga0207648_10283181 3300026089 Bacteria 1483
211 Ga0207676_10189782 3300026095 Bacteria 1807
212 Ga0207683_10017482 3300026121 Bacteria 6112
213 Ga0207698_10484423 3300026142 Bacteria 1200
214 Ga0207698_11054404 3300026142 Bacteria 825
215 Ga0209371_1000007 3300027312 Bacteria 1050654
216 Ga0209371_1000088 3300027312 Bacteria 174446
217 Ga0209969_1000607 3300027360 Bacteria 4789
218 Ga0209984_1000797 3300027424 Bacteria 3383
219 Ga0209999_1000969 3300027543 Bacteria 4841
220 Ga0209982_1001093 3300027552 Bacteria 3625
221 Ga0209983_1001046 3300027665 Bacteria 6099
222 Ga0209971_1000510 3300027682 Bacteria 10315
223 Ga0209974_10048740 3300027876 Bacteria 1421
224 Ga0268266_10094375 3300028379 Bacteria 2626
225 Ga0268266_10097510 3300028379 Bacteria 2585
226 Ga0268256_1000008 3300030500 Bacteria 1050654
227 Ga0268256_1000079 3300030500 Bacteria 174445
228 Ga0316177_1093807 3300030731 Bacteria 607
229 Ga0316176_1004137 3300030732 Bacteria 6054
230 Ga0316176_1034964 3300030732 Bacteria 1389
231 Ga0314311_1052745 3300030733 Bacteria 1374
232 Ga0316183_1028100 3300030742 Bacteria 10382
233 Ga0307513_10009744 3300031456 Bacteria 12133
234 Ga0307513_10036964 3300031456 Bacteria 5439
235 Ga0307513_10475497 3300031456 Bacteria 970
236 Ga0307408_100121489 3300031548 Bacteria 2024
237 Ga0307405_11042413 3300031731 Bacteria 700
238 Ga0307410_10677892 3300031852 Bacteria 867
239 Ga0307406_10000893 3300031901 Bacteria 16767
240 Ga0307412_11345034 3300031911 Bacteria 644
241 Ga0307414_10001352 3300032004 Bacteria 12689
242 Ga0307414_10019233 3300032004 Bacteria 4227
243 Ga0307414_10041724 3300032004 Bacteria 3111
244 Ga0307414_10293060 3300032004 Bacteria 1372
245 Ga0307414_10340593 3300032004 Bacteria 1283
246 Ga0307411_11614683 3300032005 Bacteria 598
247 Ga0395898_0360465 3300037466 Bacteria 1386
248 Ga0395905_0243803 3300037471 Bacteria 1679
249 Ga0237819_00086 3300038705 Bacteria 34074
250 Ga0237819_08280 3300038705 Bacteria 1447
251 Ga0439436_0038428 3300041404 Bacteria 1376
252 Ga0439436_0045734 3300041404 Bacteria 1245
253 Ga0439439_0003777 3300041406 Bacteria 3364
254 Ga0439461_0097625 3300041410 Bacteria 712
255 Ga0439465_0003782 3300041413 Bacteria 4938
256 Ga0439465_0012477 3300041413 Bacteria 2656
257 Ga0439465_0022784 3300041413 Bacteria 1968
258 Ga0439465_0151129 3300041413 Bacteria 829
259 Ga0451789_0018191 3300041443 Bacteria 689
260 Ga0451789_0038346 3300041443 Bacteria 825
261 Ga0451789_0657753 3300041443 Bacteria 1380
262 Ga0451791_0188113 3300041451 Bacteria 1201
263 Ga0451791_0331040 3300041451 Bacteria 1635
264 Ga0451793_0802737 3300041452 Bacteria 1890
265 Ga0451797_1221500 3300041453 Bacteria 1286
266 Ga0451797_1248946 3300041453 Bacteria 1090
267 Ga0451797_1583063 3300041453 Bacteria 1174
268 Ga0451795_1227841 3300041456 Bacteria 3404
269 Ga0451800_0330334 3300041459 Bacteria 3475
270 Ga0451802_2148098 3300041460 Bacteria 1026
271 Ga0451806_726251 3300041462 Bacteria 3324
272 Ga0451804_1182897 3300041463 Bacteria 3895
273 Ga0451807_1757347 3300041486 Bacteria 765
274 Ga0451837_1096263 3300041494 Bacteria 553
275 Ga0451839_1339831 3300041496 Bacteria 707
276 Ga0451843_1167302 3300041509 Bacteria 1148
277 Ga0451843_1741926 3300041509 Bacteria 1258
278 Ga0439433_0020833 3300041999 Bacteria 1465
279 Ga0439433_0060246 3300041999 Bacteria 904
280 Ga0439445_0007606 3300042004 Bacteria 2519
281 Ga0439445_0102229 3300042004 Bacteria 813
282 Ga0439445_0159595 3300042004 Bacteria 658
283 Ga0439432_031126 3300042006 Bacteria 1727
284 Ga0439432_069696 3300042006 Bacteria 1073
285 Ga0439449_0051129 3300042007 Bacteria 1528
286 Ga0439449_0056214 3300042007 Bacteria 1453
287 Ga0439449_0080676 3300042007 Bacteria 1200
288 Ga0439449_0088570 3300042007 Bacteria 1142
289 Ga0439449_0262883 3300042007 Bacteria 649
290 Ga0439452_022271 3300042010 Bacteria 1641
291 Ga0439462_0144121 3300042015 Bacteria 668
292 Ga0450911_032580 3300042115 Bacteria 676
293 Ga0450897_008905 3300042128 Bacteria 941
294 Ga0439446_0083574 3300042156 Bacteria 992
295 Ga0439434_0036389 3300042435 Bacteria 1506
296 Ga0450893_0069408 3300042532 Bacteria 683
297 Ga0450901_004198 3300042533 Bacteria 1493
298 Ga0453684_0225711 3300044712 Bacteria 2166
299 Ga0495627_050843 3300046453 Bacteria 1247
300 Ga0495627_223745 3300046453 Bacteria 516
301 Ga0495591_118859 3300046458 Bacteria 646
302 Ga0495638_0177335 3300046460 Bacteria 1218
303 Ga0495638_0299215 3300046460 Bacteria 867
304 Ga0495610_0002119 3300046512 Bacteria 16907
305 Ga0495631_0012955 3300046518 Bacteria 4060
306 Ga0495643_0000916 3300046522 Bacteria 31012
307 Ga0495643_0482613 3300046522 Bacteria 535
308 Ga0495663_0005422 3300046525 Bacteria 3535
309 Ga0495663_0011149 3300046525 Bacteria 2501
310 Ga0495663_0028231 3300046525 Bacteria 1650
311 Ga0495663_0035865 3300046525 Bacteria 1491
312 Ga0495663_0044403 3300046525 Bacteria 1360
313 Ga0495663_0044766 3300046525 Bacteria 1355
314 Ga0495598_0000687 3300046537 Bacteria 6430
315 Ga0495621_0131946 3300046539 Bacteria 972
316 Ga0495633_0009673 3300046558 Bacteria 5303
317 Ga0495633_0107265 3300046558 Bacteria 1295
318 Ga0495633_0137207 3300046558 Bacteria 1131
319 Ga0495633_0138322 3300046558 Bacteria 1126
320 Ga0495633_0298260 3300046558 Bacteria 732
321 Ga0495656_0006523 3300046615 Bacteria 4097
322 Ga0495668_0389988 3300046616 Bacteria 765
323 Ga0495669_0086983 3300046684 Bacteria 1440
324 Ga0495670_0331557 3300046691 Bacteria 818
325 Ga0495671_0012097 3300046692 Bacteria 4717
326 Ga0495636_0004393 3300047318 Bacteria 5526
327 Ga0495636_0130511 3300047318 Bacteria 1117
328 Ga0495672_0000115 3300047320 Bacteria 127462
329 Ga0495672_0291445 3300047320 Bacteria 776
330 Ga0495686_0026699 3300047472 Bacteria 3777
331 Ga0496101_0667408 3300048904 Bacteria 821
332 Ga0496104_0730615 3300048907 Bacteria 897
333 Ga0496105_0057829 3300048908 Bacteria 3201
334 Ga0496106_0120489 3300048909 Bacteria 2050
335 Ga0496108_0044470 3300048911 Bacteria 3706
336 Ga0496108_0411101 3300048911 Bacteria 1182
337 Ga0496109_1207729 3300048912 Bacteria 693
338 Ga0496110_0366271 3300048913 Bacteria 1313
339 Ga0496110_0800762 3300048913 Bacteria 847
340 Ga0496111_0284038 3300048914 Bacteria 1227
341 Ga0496112_0127935 3300048915 Bacteria 2511
342 Ga0496113_0125647 3300048916 Bacteria 2008
343 Ga0496114_0031167 3300048917 Bacteria 4386
344 Ga0496114_0037936 3300048917 Bacteria 3986
345 Ga0496116_0047232 3300048919 Bacteria 2899
346 Ga0496116_0185894 3300048919 Bacteria 1106
347 Ga0496116_0230946 3300048919 Bacteria 938
348 Ga0496116_0238865 3300048919 Bacteria 914
349 Ga0496117_0001130 3300048920 Bacteria 40272
350 Ga0496117_0004975 3300048920 Bacteria 14253
351 Ga0496117_0161092 3300048920 Bacteria 1314
352 Ga0496117_0164689 3300048920 Bacteria 1294
353 Ga0496117_0183560 3300048920 Bacteria 1199
354 Ga0496118_0001143 3300048921 Bacteria 40948
355 Ga0496118_0014552 3300048921 Bacteria 7355
356 Ga0496118_0147378 3300048921 Bacteria 1479
357 Ga0496118_0160105 3300048921 Bacteria 1393
358 Ga0496118_0170509 3300048921 Bacteria 1330
359 Ga0496118_0174928 3300048921 Bacteria 1305
360 Ga0496118_0185588 3300048921 Bacteria 1250
361 Ga0496118_0212426 3300048921 Bacteria 1134
362 Ga0496118_0302936 3300048921 Bacteria 876
363 Ga0496118_0478915 3300048921 Bacteria 624
364 Ga0496119_0000978 3300048922 Bacteria 36685
365 Ga0496119_0006448 3300048922 Bacteria 10861
366 Ga0496120_0000220 3300048923 Bacteria 98722
367 Ga0496120_0000245 3300048923 Bacteria 92114
368 Ga0496121_0001534 3300048924 Bacteria 38645
369 Ga0496121_0045069 3300048924 Bacteria 3794
370 Ga0496121_0244366 3300048924 Bacteria 1248
371 Ga0496121_0264165 3300048924 Bacteria 1186
372 Ga0496121_0269325 3300048924 Bacteria 1171
373 Ga0496121_0422002 3300048924 Bacteria 867
374 Ga0496122_0022543 3300048925 Bacteria 5591
375 Ga0496122_0035344 3300048925 Bacteria 4067
376 Ga0496122_0035599 3300048925 Bacteria 4045
377 Ga0496122_0069290 3300048925 Bacteria 2527
378 Ga0496122_0115392 3300048925 Bacteria 1749
379 Ga0496122_0334423 3300048925 Bacteria 798
380 Ga0496122_0389892 3300048925 Bacteria 711
381 Ga0496122_0474335 3300048925 Bacteria 614
382 Ga0496123_0005623 3300048926 Bacteria 12520
383 Ga0496123_0028124 3300048926 Bacteria 4169
384 Ga0496123_0028351 3300048926 Bacteria 4147
385 Ga0496123_0109321 3300048926 Bacteria 1584
386 Ga0496123_0234849 3300048926 Bacteria 915
387 Ga0496124_0001016 3300048927 Bacteria 44491
388 Ga0496124_0023916 3300048927 Bacteria 5564
389 Ga0496124_0040500 3300048927 Bacteria 4028
390 Ga0496124_0050804 3300048927 Bacteria 3530
391 Ga0496124_0097586 3300048927 Bacteria 2386
392 Ga0496124_0264871 3300048927 Bacteria 1262
393 Ga0496124_0268927 3300048927 Bacteria 1249
394 Ga0496124_0271206 3300048927 Bacteria 1242
395 Ga0496124_0307979 3300048927 Bacteria 1140
396 Ga0496125_0024831 3300048928 Bacteria 5500
397 Ga0496125_0031926 3300048928 Bacteria 4685
398 Ga0496125_0045474 3300048928 Bacteria 3693
399 Ga0496125_0075481 3300048928 Bacteria 2608
400 Ga0496125_0080955 3300048928 Bacteria 2483
401 Ga0496125_0092049 3300048928 Bacteria 2268
402 Ga0496125_0214990 3300048928 Bacteria 1244
403 Ga0496126_0003318 3300048929 Bacteria 20477
404 Ga0496126_0035045 3300048929 Bacteria 4707
405 Ga0496126_0043930 3300048929 Bacteria 4119
406 Ga0496126_0378864 3300048929 Bacteria 1152
407 Ga0496126_0397540 3300048929 Bacteria 1118
408 Ga0496126_0398565 3300048929 Bacteria 1117
409 Ga0496126_0477553 3300048929 Bacteria 999
410 Ga0501034_0002645 3300049571 Bacteria 21210
411 Ga0501034_0014481 3300049571 Bacteria 8122
412 Ga0501034_0807492 3300049571 Bacteria 830
413 Ga0501043_0010853 3300049579 Bacteria 7132
414 nmdc:mga03683_415133_c1 3300050489 Bacteria 644
415 nmdc:mga03n38_234034_c1 3300050490 Bacteria 964
416 nmdc:mga00v17_222485_c1 3300050491 Bacteria 1222
417 nmdc:mga00v17_282936_c1 3300050491 Bacteria 1077
418 nmdc:mga00v17_736429_c1 3300050491 Bacteria 631
419 nmdc:mga00v17_823361_c1 3300050491 Bacteria 591
420 nmdc:mga0sz30_479074_c1 3300050516 Bacteria 559
421 Ga0500658_0150048 3300053134 Bacteria 1050
422 Ga0500624_081225 3300053157 Bacteria 646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11752104 Ga0070658_117521041 132
2 3300005339 Ga0070660_100072518 Ga0070660_1000725184 132
3 3300005339 Ga0070660_100737986 Ga0070660_1007379862 132
4 3300005366 Ga0070659_100102268 Ga0070659_1001022682 132
5 3300005547 Ga0070693_100171619 Ga0070693_1001716192 132
6 3300005563 Ga0068855_100447755 Ga0068855_1004477552 132
7 3300005564 Ga0070664_101665144 Ga0070664_1016651441 132
8 3300013105 Ga0157369_10036315 Ga0157369_100363152 132
9 3300013307 Ga0157372_10075425 Ga0157372_100754254 132
10 3300025909 Ga0207705_10050568 Ga0207705_100505682 132
11 3300025919 Ga0207657_10121482 Ga0207657_101214822 132
12 3300025919 Ga0207657_11091044 Ga0207657_110910441 132
13 3300025921 Ga0207652_10619346 Ga0207652_106193462 132
14 3300025932 Ga0207690_10068613 Ga0207690_100686132 132
15 3300025945 Ga0207679_10337940 Ga0207679_103379402 132
16 3300025949 Ga0207667_10584849 Ga0207667_105848492 132
17 3300037466 Ga0395898_0360465 Ga0395898_0360465_649_1071 132
18 3300037471 Ga0395905_0243803 Ga0395905_0243803_459_881 132
19 3300005293 Ga0065715_10427161 Ga0065715_104271612 136
20 3300005288 Ga0065714_10095844 Ga0065714_100958442 137
21 3300005293 Ga0065715_10968613 Ga0065715_109686131 137
22 3300013102 Ga0157371_10141016 Ga0157371_101410162 137
23 3300013102 Ga0157371_10299609 Ga0157371_102996092 137
24 3300013104 Ga0157370_10260211 Ga0157370_102602112 137
25 3300013307 Ga0157372_10482882 Ga0157372_104828822 137
26 3300027876 Ga0209974_10048740 Ga0209974_100487402 137
27 3300005331 Ga0070670_100303993 Ga0070670_1003039932 138
28 3300005539 Ga0068853_100887402 Ga0068853_1008874022 138
29 3300030733 Ga0314311_1052745 Ga0314311_10527452 138
30 iso_pu_bacteria 2643221559 2643815491 138
31 iso_pu_bacteria 2643221573 2643881827 138
32 iso_pu_bacteria 2643221586 2643941212 138
33 iso_pu_bacteria 2643221612 2644079715 138
34 iso_pu_bacteria 2643221727 2644696134 138
35 iso_pu_bacteria 2842757796 2842758892 138
36 3300005356 Ga0070674_100080225 Ga0070674_1000802251 139
37 3300013308 Ga0157375_10486132 Ga0157375_104861322 139
38 3300025937 Ga0207669_10633358 Ga0207669_106333582 139
39 3300025940 Ga0207691_10199640 Ga0207691_101996402 139
40 3300025960 Ga0207651_10375902 Ga0207651_103759022 139
41 3300026142 Ga0207698_11054404 Ga0207698_110544042 139
42 3300032004 Ga0307414_10041724 Ga0307414_100417243 139
43 3300048911 Ga0496108_0411101 Ga0496108_0411101_519_962 139
44 3300048912 Ga0496109_1207729 Ga0496109_1207729_50_493 139
45 iso_pu_bacteria 2547132130 2547501409 139
46 iso_pu_bacteria 2576861471 2578457292 139
47 iso_pu_bacteria 2747842428 2747949413 139
48 iso_pu_bacteria 2765235840 2765580198 139
49 iso_pu_bacteria 2816332141 2816518771 139
50 iso_pu_bacteria 2842391507 2842393824 139
51 iso_pu_bacteria 2857442823 2857446646 139
52 iso_pu_bacteria 2874220319 2874222883 139
53 iso_pu_bacteria 2919089067 2919093025 139
54 iso_pu_bacteria 2919134579 2919137785 139
55 iso_pu_bacteria 2928496128 2928499591 139
56 iso_pu_bacteria 2931380184 2931383655 139
57 iso_pu_bacteria 2939589442 2939589496 139
58 iso_pu_bacteria 2939622612 2939626653 139
59 iso_pu_bacteria 2939626828 2939631093 139
60 iso_pu_bacteria 2961047084 2961049648 139
61 iso_pu_bacteria 2961064222 2961066676 139
62 iso_pu_bacteria 2974307012 2974307931 139
63 iso_pu_bacteria 2977247770 2977248666 139
64 iso_pu_bacteria 2984514374 2984516865 139
65 3300014326 Ga0157380_11370799 Ga0157380_113707991 140
66 3300042004 Ga0439445_0159595 Ga0439445_0159595_69_491 140
67 3300042128 Ga0450897_008905 Ga0450897_008905_315_737 140
68 3300046558 Ga0495633_0137207 Ga0495633_0137207_434_856 140
69 3300003187 JGI25151J46595_10060528 JGI25151J46595_100605281 141
70 3300003794 Ga0055531_10016173 Ga0055531_100161733 141
71 3300006048 Ga0075363_100299377 Ga0075363_1002993772 141
72 3300025294 Ga0209025_1005017 Ga0209025_10050173 141
73 3300025304 Ga0209257_1000219 Ga0209257_100021966 141
74 3300025986 Ga0207658_11346974 Ga0207658_113469742 141
75 3300030731 Ga0316177_1093807 Ga0316177_10938072 141
76 3300046525 Ga0495663_0011149 Ga0495663_0011149_1604_2029 141
77 3300046525 Ga0495663_0035865 Ga0495663_0035865_470_943 141
78 3300046537 Ga0495598_0000687 Ga0495598_0000687_4270_4743 141
79 3300046539 Ga0495621_0131946 Ga0495621_0131946_385_858 141
80 3300048928 Ga0496125_0031926 Ga0496125_0031926_1279_1704 141
81 iso_pu_bacteria 2643221579 2643907158 141
82 3300003781 Ga0055536_1015211 Ga0055536_10152113 142
83 3300025292 Ga0209676_1000549 Ga0209676_100054942 142
84 3300025297 Ga0209758_1022513 Ga0209758_10225134 142
85 3300030732 Ga0316176_1034964 Ga0316176_10349642 142
86 3300042004 Ga0439445_0102229 Ga0439445_0102229_104_538 142
87 3300042533 Ga0450901_004198 Ga0450901_004198_642_1100 142
88 3300046525 Ga0495663_0028231 Ga0495663_0028231_1035_1493 142
89 3300046558 Ga0495633_0009673 Ga0495633_0009673_4171_4629 142
90 3300050489 nmdc:mga03683_415133_c1 nmdc:mga03683_415133_c1_60_518 142
91 3300050491 nmdc:mga00v17_736429_c1 nmdc:mga00v17_736429_c1_36_494 142
92 iso_pu_bacteria 8003014200 8003015156 142
93 3300003203 JGI25406J46586_10193305 JGI25406J46586_101933051 143
94 3300003320 rootH2_10039924 rootH2_100399242 143
95 3300003323 rootH1_10123618 rootH1_101236182 143
96 3300003771 Ga0055526_1001381 Ga0055526_100138111 143
97 3300003771 Ga0055526_1014034 Ga0055526_10140345 143
98 3300003773 Ga0055537_1000085 Ga0055537_100008514 143
99 3300003775 Ga0055524_1038314 Ga0055524_10383142 143
100 3300003775 Ga0055524_1053368 Ga0055524_10533682 143
101 3300003775 Ga0055524_1081807 Ga0055524_10818071 143
102 3300003781 Ga0055536_1001085 Ga0055536_10010852 143
103 3300003781 Ga0055536_1017645 Ga0055536_10176452 143
104 3300003781 Ga0055536_1017646 Ga0055536_10176462 143
105 3300003781 Ga0055536_1029658 Ga0055536_10296582 143
106 3300003784 Ga0055534_1000476 Ga0055534_100047620 143
107 3300003790 Ga0055528_1000121 Ga0055528_100012144 143
108 3300003791 Ga0055530_10003719 Ga0055530_1000371910 143
109 3300003791 Ga0055530_10004345 Ga0055530_100043452 143
110 3300003791 Ga0055530_10004553 Ga0055530_100045534 143
111 3300003792 Ga0055540_1062688 Ga0055540_10626882 143
112 3300003794 Ga0055531_10011794 Ga0055531_100117941 143
113 3300003794 Ga0055531_10028285 Ga0055531_100282852 143
114 3300003794 Ga0055531_10038093 Ga0055531_100380932 143
115 3300003856 Ga0058692_1000011 Ga0058692_1000011283 143
116 3300005293 Ga0065715_10336124 Ga0065715_103361241 143
117 3300005331 Ga0070670_100259773 Ga0070670_1002597732 143
118 3300005347 Ga0070668_100519672 Ga0070668_1005196722 143
119 3300005353 Ga0070669_100687379 Ga0070669_1006873792 143
120 3300005353 Ga0070669_100891257 Ga0070669_1008912572 143
121 3300005355 Ga0070671_100151737 Ga0070671_1001517372 143
122 3300005366 Ga0070659_100319348 Ga0070659_1003193482 143
123 3300005456 Ga0070678_100149067 Ga0070678_1001490672 143
124 3300005543 Ga0070672_100349002 Ga0070672_1003490022 143
125 3300005548 Ga0070665_100236002 Ga0070665_1002360022 143
126 3300005618 Ga0068864_100691757 Ga0068864_1006917572 143
127 3300005844 Ga0068862_100090458 Ga0068862_1000904582 143
128 3300005985 Ga0081539_10051661 Ga0081539_100516612 143
129 3300006051 Ga0075364_10062410 Ga0075364_100624102 143
130 3300006051 Ga0075364_10184209 Ga0075364_101842092 143
131 3300006051 Ga0075364_10309070 Ga0075364_103090702 143
132 3300006051 Ga0075364_10820434 Ga0075364_108204342 143
133 3300006178 Ga0075367_10031080 Ga0075367_100310802 143
134 3300006186 Ga0075369_10102818 Ga0075369_101028182 143
135 3300009011 Ga0105251_10014369 Ga0105251_100143694 143
136 3300009036 Ga0105244_10170783 Ga0105244_101707832 143
137 3300009092 Ga0105250_10160933 Ga0105250_101609332 143
138 3300009148 Ga0105243_10138400 Ga0105243_101384003 143
139 3300012510 Ga0157316_1008670 Ga0157316_10086702 143
140 3300013100 Ga0157373_10110856 Ga0157373_101108562 143
141 3300013100 Ga0157373_10176517 Ga0157373_101765172 143
142 3300013102 Ga0157371_10004109 Ga0157371_100041096 143
143 3300013102 Ga0157371_10173931 Ga0157371_101739312 143
144 3300013102 Ga0157371_10542655 Ga0157371_105426551 143
145 3300013104 Ga0157370_10068012 Ga0157370_100680122 143
146 3300013104 Ga0157370_10179751 Ga0157370_101797512 143
147 3300013105 Ga0157369_10065953 Ga0157369_100659534 143
148 3300013306 Ga0163162_10132071 Ga0163162_101320714 143
149 3300014326 Ga0157380_10260689 Ga0157380_102606892 143
150 3300014497 Ga0182008_10000064 Ga0182008_10000064100 143
151 3300014497 Ga0182008_10060738 Ga0182008_100607382 143
152 3300015261 Ga0182006_1077462 Ga0182006_10774622 143
153 3300015261 Ga0182006_1088962 Ga0182006_10889622 143
154 3300017792 Ga0163161_10118906 Ga0163161_101189062 143
155 3300017792 Ga0163161_10231302 Ga0163161_102313022 143
156 3300017792 Ga0163161_10375232 Ga0163161_103752321 143
157 3300017792 Ga0163161_10384870 Ga0163161_103848702 143
158 3300025263 Ga0209565_1000023 Ga0209565_1000023193 143
159 3300025273 Ga0209673_1000116 Ga0209673_100011697 143
160 3300025284 Ga0209130_1002852 Ga0209130_10028525 143
161 3300025284 Ga0209130_1004177 Ga0209130_10041773 143
162 3300025291 Ga0209675_1000016 Ga0209675_1000016299 143
163 3300025292 Ga0209676_1000037 Ga0209676_1000037264 143
164 3300025292 Ga0209676_1001804 Ga0209676_10018044 143
165 3300025292 Ga0209676_1003577 Ga0209676_10035772 143
166 3300025295 Ga0209564_1001691 Ga0209564_100169110 143
167 3300025295 Ga0209564_1006245 Ga0209564_10062452 143
168 3300025298 Ga0209050_1001795 Ga0209050_100179513 143
169 3300025298 Ga0209050_1004211 Ga0209050_100421110 143
170 3300025298 Ga0209050_1004412 Ga0209050_10044122 143
171 3300025299 Ga0209256_1008734 Ga0209256_10087344 143
172 3300025299 Ga0209256_1010089 Ga0209256_10100893 143
173 3300025299 Ga0209256_1011430 Ga0209256_10114303 143
174 3300025303 Ga0209051_1002501 Ga0209051_100250112 143
175 3300025304 Ga0209257_1002658 Ga0209257_100265817 143
176 3300025304 Ga0209257_1005158 Ga0209257_10051587 143
177 3300025304 Ga0209257_1007310 Ga0209257_10073107 143
178 3300025735 Ga0207713_1015809 Ga0207713_10158093 143
179 3300025923 Ga0207681_10843356 Ga0207681_108433562 143
180 3300025932 Ga0207690_10274047 Ga0207690_102740472 143
181 3300025935 Ga0207709_10003998 Ga0207709_100039989 143
182 3300025972 Ga0207668_10018301 Ga0207668_100183015 143
183 3300025972 Ga0207668_10508197 Ga0207668_105081972 143
184 3300026089 Ga0207648_10283181 Ga0207648_102831812 143
185 3300026095 Ga0207676_10189782 Ga0207676_101897823 143
186 3300026121 Ga0207683_10017482 Ga0207683_100174823 143
187 3300027312 Ga0209371_1000007 Ga0209371_1000007676 143
188 3300028379 Ga0268266_10097510 Ga0268266_100975104 143
189 3300030500 Ga0268256_1000008 Ga0268256_1000008274 143
190 3300030732 Ga0316176_1004137 Ga0316176_10041375 143
191 3300030742 Ga0316183_1028100 Ga0316183_10281006 143
192 3300031731 Ga0307405_11042413 Ga0307405_110424132 143
193 3300031852 Ga0307410_10677892 Ga0307410_106778922 143
194 3300031911 Ga0307412_11345034 Ga0307412_113450342 143
195 3300032004 Ga0307414_10293060 Ga0307414_102930602 143
196 3300032004 Ga0307414_10340593 Ga0307414_103405932 143
197 3300032005 Ga0307411_11614683 Ga0307411_116146831 143
198 3300038705 Ga0237819_08280 Ga0237819_08280_913_1344 143
199 3300041443 Ga0451789_0018191 Ga0451789_0018191_118_549 143
200 3300041453 Ga0451797_1248946 Ga0451797_1248946_184_615 143
201 3300041494 Ga0451837_1096263 Ga0451837_1096263_80_511 143
202 3300042006 Ga0439432_031126 Ga0439432_031126_713_1144 143
203 3300042006 Ga0439432_069696 Ga0439432_069696_387_818 143
204 3300042007 Ga0439449_0088570 Ga0439449_0088570_585_1037 143
205 3300042115 Ga0450911_032580 Ga0450911_032580_109_546 143
206 3300046453 Ga0495627_050843 Ga0495627_050843_232_663 143
207 3300046453 Ga0495627_223745 Ga0495627_223745_50_481 143
208 3300046458 Ga0495591_118859 Ga0495591_118859_176_607 143
209 3300046460 Ga0495638_0177335 Ga0495638_0177335_449_880 143
210 3300046460 Ga0495638_0299215 Ga0495638_0299215_337_768 143
211 3300046512 Ga0495610_0002119 Ga0495610_0002119_792_1223 143
212 3300046518 Ga0495631_0012955 Ga0495631_0012955_2941_3372 143
213 3300046522 Ga0495643_0000916 Ga0495643_0000916_29121_29552 143
214 3300046525 Ga0495663_0044403 Ga0495663_0044403_353_787 143
215 3300046525 Ga0495663_0044766 Ga0495663_0044766_606_1037 143
216 3300046558 Ga0495633_0298260 Ga0495633_0298260_74_505 143
217 3300046615 Ga0495656_0006523 Ga0495656_0006523_2082_2516 143
218 3300046616 Ga0495668_0389988 Ga0495668_0389988_180_614 143
219 3300046684 Ga0495669_0086983 Ga0495669_0086983_783_1217 143
220 3300046691 Ga0495670_0331557 Ga0495670_0331557_190_624 143
221 3300047318 Ga0495636_0004393 Ga0495636_0004393_4063_4497 143
222 3300047318 Ga0495636_0130511 Ga0495636_0130511_180_614 143
223 3300047320 Ga0495672_0000115 Ga0495672_0000115_17317_17748 143
224 3300047320 Ga0495672_0291445 Ga0495672_0291445_245_676 143
225 3300047472 Ga0495686_0026699 Ga0495686_0026699_481_912 143
226 3300048904 Ga0496101_0667408 Ga0496101_0667408_189_620 143
227 3300048907 Ga0496104_0730615 Ga0496104_0730615_98_529 143
228 3300048908 Ga0496105_0057829 Ga0496105_0057829_2510_2941 143
229 3300048909 Ga0496106_0120489 Ga0496106_0120489_1114_1548 143
230 3300048911 Ga0496108_0044470 Ga0496108_0044470_2803_3237 143
231 3300048913 Ga0496110_0366271 Ga0496110_0366271_306_737 143
232 3300048913 Ga0496110_0800762 Ga0496110_0800762_246_680 143
233 3300048914 Ga0496111_0284038 Ga0496111_0284038_684_1118 143
234 3300048915 Ga0496112_0127935 Ga0496112_0127935_1622_2056 143
235 3300048916 Ga0496113_0125647 Ga0496113_0125647_313_747 143
236 3300048917 Ga0496114_0031167 Ga0496114_0031167_2310_2744 143
237 3300048919 Ga0496116_0047232 Ga0496116_0047232_2326_2763 143
238 3300048920 Ga0496117_0001130 Ga0496117_0001130_38241_38672 143
239 3300048920 Ga0496117_0161092 Ga0496117_0161092_798_1229 143
240 3300048920 Ga0496117_0164689 Ga0496117_0164689_414_845 143
241 3300048920 Ga0496117_0183560 Ga0496117_0183560_683_1114 143
242 3300048921 Ga0496118_0001143 Ga0496118_0001143_38242_38673 143
243 3300048921 Ga0496118_0014552 Ga0496118_0014552_5534_5965 143
244 3300048921 Ga0496118_0160105 Ga0496118_0160105_555_986 143
245 3300048921 Ga0496118_0185588 Ga0496118_0185588_611_1042 143
246 3300048921 Ga0496118_0212426 Ga0496118_0212426_423_854 143
247 3300048921 Ga0496118_0302936 Ga0496118_0302936_150_581 143
248 3300048921 Ga0496118_0478915 Ga0496118_0478915_135_572 143
249 3300048922 Ga0496119_0006448 Ga0496119_0006448_1995_2426 143
250 3300048923 Ga0496120_0000245 Ga0496120_0000245_89694_90125 143
251 3300048924 Ga0496121_0045069 Ga0496121_0045069_518_949 143
252 3300048924 Ga0496121_0264165 Ga0496121_0264165_530_961 143
253 3300048924 Ga0496121_0422002 Ga0496121_0422002_357_794 143
254 3300048925 Ga0496122_0115392 Ga0496122_0115392_461_892 143
255 3300048925 Ga0496122_0334423 Ga0496122_0334423_151_582 143
256 3300048925 Ga0496122_0389892 Ga0496122_0389892_249_680 143
257 3300048925 Ga0496122_0474335 Ga0496122_0474335_47_484 143
258 3300048926 Ga0496123_0234849 Ga0496123_0234849_130_561 143
259 3300048927 Ga0496124_0001016 Ga0496124_0001016_2129_2560 143
260 3300048927 Ga0496124_0050804 Ga0496124_0050804_548_979 143
261 3300048927 Ga0496124_0097586 Ga0496124_0097586_689_1120 143
262 3300048927 Ga0496124_0264871 Ga0496124_0264871_528_959 143
263 3300048927 Ga0496124_0268927 Ga0496124_0268927_635_1066 143
264 3300048927 Ga0496124_0271206 Ga0496124_0271206_669_1106 143
265 3300048927 Ga0496124_0307979 Ga0496124_0307979_306_737 143
266 3300048928 Ga0496125_0024831 Ga0496125_0024831_541_972 143
267 3300048928 Ga0496125_0075481 Ga0496125_0075481_258_689 143
268 3300048928 Ga0496125_0080955 Ga0496125_0080955_858_1289 143
269 3300048929 Ga0496126_0003318 Ga0496126_0003318_18922_19353 143
270 3300048929 Ga0496126_0397540 Ga0496126_0397540_130_567 143
271 3300048929 Ga0496126_0398565 Ga0496126_0398565_584_1015 143
272 3300048929 Ga0496126_0477553 Ga0496126_0477553_43_474 143
273 3300049571 Ga0501034_0807492 Ga0501034_0807492_143_574 143
274 3300050491 nmdc:mga00v17_222485_c1 nmdc:mga00v17_222485_c1_261_692 143
275 3300050491 nmdc:mga00v17_282936_c1 nmdc:mga00v17_282936_c1_330_761 143
276 3300050491 nmdc:mga00v17_823361_c1 nmdc:mga00v17_823361_c1_55_486 143
277 3300050516 nmdc:mga0sz30_479074_c1 nmdc:mga0sz30_479074_c1_22_453 143
278 3300053157 Ga0500624_081225 Ga0500624_081225_135_566 143
279 iso_pu_bacteria 2842780639 2842781730 143
280 iso_pu_bacteria 2937610967 2937615207 143
281 iso_pu_bacteria 2941475908 2941479027 143
282 3300002773 JGI25152J39213_1000170 JGI25152J39213_100017011 144
283 3300002774 JGI25150J39212_1000122 JGI25150J39212_100012239 144
284 3300003187 JGI25151J46595_10000411 JGI25151J46595_1000041139 144
285 3300003187 JGI25151J46595_10040138 JGI25151J46595_100401382 144
286 3300003215 JGI25153J46596_10000252 JGI25153J46596_1000025239 144
287 3300003775 Ga0055524_1017286 Ga0055524_10172863 144
288 3300003781 Ga0055536_1012787 Ga0055536_10127872 144
289 3300003781 Ga0055536_1029477 Ga0055536_10294772 144
290 3300003781 Ga0055536_1083139 Ga0055536_10831391 144
291 3300003794 Ga0055531_10032208 Ga0055531_100322082 144
292 3300025245 Ga0207425_1000066 Ga0207425_100006611 144
293 3300025258 Ga0209129_1000135 Ga0209129_1000135104 144
294 3300025292 Ga0209676_1023943 Ga0209676_10239432 144
295 3300025292 Ga0209676_1035036 Ga0209676_10350362 144
296 3300025294 Ga0209025_1000013 Ga0209025_1000013294 144
297 3300025294 Ga0209025_1010348 Ga0209025_10103482 144
298 3300025294 Ga0209025_1044935 Ga0209025_10449352 144
299 3300025294 Ga0209025_1131028 Ga0209025_11310282 144
300 3300025297 Ga0209758_1000014 Ga0209758_1000014294 144
301 3300025299 Ga0209256_1004858 Ga0209256_10048583 144
302 3300025299 Ga0209256_1043350 Ga0209256_10433501 144
303 3300025302 Ga0207426_1123399 Ga0207426_11233991 144
304 3300025304 Ga0209257_1000398 Ga0209257_100039845 144
305 3300025304 Ga0209257_1010357 Ga0209257_10103575 144
306 3300031548 Ga0307408_100121489 Ga0307408_1001214892 144
307 3300031901 Ga0307406_10000893 Ga0307406_100008937 144
308 3300041404 Ga0439436_0038428 Ga0439436_0038428_736_1173 144
309 3300041404 Ga0439436_0045734 Ga0439436_0045734_563_997 144
310 3300041413 Ga0439465_0012477 Ga0439465_0012477_2060_2494 144
311 3300042007 Ga0439449_0056214 Ga0439449_0056214_771_1205 144
312 3300042007 Ga0439449_0262883 Ga0439449_0262883_168_602 144
313 3300042010 Ga0439452_022271 Ga0439452_022271_446_880 144
314 3300048925 Ga0496122_0035599 Ga0496122_0035599_2855_3289 144
315 3300048926 Ga0496123_0028124 Ga0496123_0028124_706_1140 144
316 3300048929 Ga0496126_0035045 Ga0496126_0035045_2876_3310 144
317 3300049579 Ga0501043_0010853 Ga0501043_0010853_6292_6726 144
318 3300003781 Ga0055536_1009147 Ga0055536_10091473 145
319 3300005354 Ga0070675_100856482 Ga0070675_1008564822 145
320 3300005356 Ga0070674_100457192 Ga0070674_1004571922 145
321 3300005367 Ga0070667_100578130 Ga0070667_1005781302 145
322 3300005543 Ga0070672_100055517 Ga0070672_1000555173 145
323 3300006048 Ga0075363_100554585 Ga0075363_1005545851 145
324 3300014326 Ga0157380_10560739 Ga0157380_105607392 145
325 3300025292 Ga0209676_1000129 Ga0209676_1000129110 145
326 3300025923 Ga0207681_10316875 Ga0207681_103168752 145
327 3300025925 Ga0207650_10050889 Ga0207650_100508894 145
328 3300025937 Ga0207669_10502513 Ga0207669_105025132 145
329 3300025940 Ga0207691_10005846 Ga0207691_100058463 145
330 3300025986 Ga0207658_10295507 Ga0207658_102955072 145
331 3300026041 Ga0207639_10593416 Ga0207639_105934162 145
332 3300026142 Ga0207698_10484423 Ga0207698_104844232 145
333 3300027360 Ga0209969_1000607 Ga0209969_10006074 145
334 3300027424 Ga0209984_1000797 Ga0209984_10007973 145
335 3300027543 Ga0209999_1000969 Ga0209999_10009693 145
336 3300027552 Ga0209982_1001093 Ga0209982_10010934 145
337 3300027665 Ga0209983_1001046 Ga0209983_10010462 145
338 3300027682 Ga0209971_1000510 Ga0209971_10005102 145
339 3300032004 Ga0307414_10001352 Ga0307414_100013528 145
340 3300041406 Ga0439439_0003777 Ga0439439_0003777_398_865 145
341 3300041413 Ga0439465_0022784 Ga0439465_0022784_1183_1620 145
342 3300041413 Ga0439465_0151129 Ga0439465_0151129_332_799 145
343 3300041443 Ga0451789_0657753 Ga0451789_0657753_408_845 145
344 3300041456 Ga0451795_1227841 Ga0451795_1227841_2292_2729 145
345 3300041460 Ga0451802_2148098 Ga0451802_2148098_204_641 145
346 3300041486 Ga0451807_1757347 Ga0451807_1757347_293_730 145
347 3300041509 Ga0451843_1741926 Ga0451843_1741926_492_929 145
348 3300041999 Ga0439433_0020833 Ga0439433_0020833_450_917 145
349 3300041999 Ga0439433_0060246 Ga0439433_0060246_261_698 145
350 3300042007 Ga0439449_0051129 Ga0439449_0051129_653_1090 145
351 3300042007 Ga0439449_0080676 Ga0439449_0080676_166_609 145
352 3300048917 Ga0496114_0037936 Ga0496114_0037936_265_702 145
353 3300048929 Ga0496126_0043930 Ga0496126_0043930_3032_3469 145
354 3300049571 Ga0501034_0014481 Ga0501034_0014481_1975_2412 145
355 3300050490 nmdc:mga03n38_234034_c1 nmdc:mga03n38_234034_c1_256_693 145
356 iso_pu_bacteria 2643221720 2644663017 145
357 iso_pu_bacteria 2643221728 2644699827 145
358 iso_pu_bacteria 2919513703 2919515497 145
359 iso_pu_bacteria 2941489479 2941490977 145
360 3300013100 Ga0157373_11320728 Ga0157373_113207281 146
361 3300013102 Ga0157371_10076513 Ga0157371_100765131 146
362 3300031456 Ga0307513_10009744 Ga0307513_1000974411 146
363 3300031456 Ga0307513_10036964 Ga0307513_100369643 146
364 3300031456 Ga0307513_10475497 Ga0307513_104754972 146
365 3300041410 Ga0439461_0097625 Ga0439461_0097625_22_462 146
366 3300041413 Ga0439465_0003782 Ga0439465_0003782_2990_3430 146
367 3300041443 Ga0451789_0038346 Ga0451789_0038346_63_503 146
368 3300041451 Ga0451791_0331040 Ga0451791_0331040_653_1093 146
369 3300041453 Ga0451797_1221500 Ga0451797_1221500_367_807 146
370 3300042004 Ga0439445_0007606 Ga0439445_0007606_1097_1537 146
371 3300042015 Ga0439462_0144121 Ga0439462_0144121_170_610 146
372 3300042156 Ga0439446_0083574 Ga0439446_0083574_356_796 146
373 3300042435 Ga0439434_0036389 Ga0439434_0036389_227_667 146
374 3300042532 Ga0450893_0069408 Ga0450893_0069408_213_653 146
375 3300046522 Ga0495643_0482613 Ga0495643_0482613_27_467 146
376 3300046525 Ga0495663_0005422 Ga0495663_0005422_1828_2268 146
377 3300046558 Ga0495633_0138322 Ga0495633_0138322_104_553 146
378 3300046692 Ga0495671_0012097 Ga0495671_0012097_581_1021 146
379 3300048924 Ga0496121_0244366 Ga0496121_0244366_74_523 146
380 3300048925 Ga0496122_0069290 Ga0496122_0069290_681_1121 146
381 3300048926 Ga0496123_0028351 Ga0496123_0028351_1012_1452 146
382 3300053134 Ga0500658_0150048 Ga0500658_0150048_16_456 146
383 iso_pu_bacteria 2643221581 2643915072 146
384 iso_pu_bacteria 2643221593 2643972952 146
385 iso_pu_bacteria 8021622325 8021623632 146
386 iso_pu_bacteria 8021626552 8021627446 146
387 iso_pu_bacteria 8021648035 8021650587 146
388 3300009036 Ga0105244_10023879 Ga0105244_100238794 147
389 3300015261 Ga0182006_1150627 Ga0182006_11506272 147
390 3300015262 Ga0182007_10000026 Ga0182007_10000026102 147
391 3300015265 Ga0182005_1000232 Ga0182005_100023216 147
392 3300017792 Ga0163161_10864323 Ga0163161_108643232 147
393 3300025728 Ga0207655_1021365 Ga0207655_10213654 147
394 3300038705 Ga0237819_00086 Ga0237819_00086_28424_28867 147
395 3300046558 Ga0495633_0107265 Ga0495633_0107265_557_1000 147
396 3300048919 Ga0496116_0230946 Ga0496116_0230946_160_603 147
397 3300048919 Ga0496116_0238865 Ga0496116_0238865_32_475 147
398 3300048921 Ga0496118_0147378 Ga0496118_0147378_376_819 147
399 3300048924 Ga0496121_0269325 Ga0496121_0269325_42_485 147
400 3300048925 Ga0496122_0035344 Ga0496122_0035344_921_1364 147
401 3300048926 Ga0496123_0109321 Ga0496123_0109321_555_998 147
402 3300048927 Ga0496124_0040500 Ga0496124_0040500_3419_3862 147
403 3300048928 Ga0496125_0045474 Ga0496125_0045474_2472_2915 147
404 3300048928 Ga0496125_0092049 Ga0496125_0092049_1221_1664 147
405 iso_pu_bacteria 2747842501 2748016682 147
406 iso_pu_bacteria 2852684882 2852686755 147
407 iso_pu_bacteria 2919130084 2919134039 147
408 iso_pu_bacteria 2923516293 2923519389 147
409 iso_pu_bacteria 2995948881 2995950020 147
410 3300006051 Ga0075364_10476108 Ga0075364_104761081 148
411 3300025972 Ga0207668_10790177 Ga0207668_107901772 148
412 3300003771 Ga0055526_1000022 Ga0055526_1000022133 149
413 3300003773 Ga0055537_1000009 Ga0055537_1000009128 149
414 3300003775 Ga0055524_1000036 Ga0055524_1000036133 149
415 3300003784 Ga0055534_1000010 Ga0055534_100001018 149
416 3300003790 Ga0055528_1000014 Ga0055528_1000014133 149
417 3300006051 Ga0075364_10780626 Ga0075364_107806261 149
418 3300025263 Ga0209565_1000001 Ga0209565_1000001849 149
419 3300025273 Ga0209673_1000001 Ga0209673_1000001849 149
420 3300025291 Ga0209675_1000001 Ga0209675_10000011683 149
421 3300025295 Ga0209564_1000001 Ga0209564_10000011845 149
422 3300025299 Ga0209256_1000006 Ga0209256_1000006281 149
423 3300028379 Ga0268266_10094375 Ga0268266_100943753 149
424 3300041451 Ga0451791_0188113 Ga0451791_0188113_405_854 149
425 3300048924 Ga0496121_0001534 Ga0496121_0001534_14862_15317 149
426 3300005289 Ga0065704_10177511 Ga0065704_101775112 150
427 3300041452 Ga0451793_0802737 Ga0451793_0802737_709_1230 150
428 3300041459 Ga0451800_0330334 Ga0451800_0330334_2394_2915 150
429 3300041462 Ga0451806_726251 Ga0451806_726251_2379_2900 150
430 3300041463 Ga0451804_1182897 Ga0451804_1182897_2304_2825 150
431 3300041496 Ga0451839_1339831 Ga0451839_1339831_80_601 150
432 3300048919 Ga0496116_0185894 Ga0496116_0185894_521_991 150
433 3300048921 Ga0496118_0174928 Ga0496118_0174928_104_574 150
434 3300048927 Ga0496124_0023916 Ga0496124_0023916_670_1140 150
435 2162886007 SwRhRL2b_contig_133374 SwRhRL2b_0766.00004950 151
436 2162886007 SwRhRL2b_contig_183084 SwRhRL2b_0773.00007490 151
437 3300003323 rootH1_10332456 rootH1_103324562 151
438 3300003856 Ga0058692_1000033 Ga0058692_100003389 151
439 3300005289 Ga0065704_10000377 Ga0065704_100003777 151
440 3300005289 Ga0065704_10071669 Ga0065704_100716695 151
441 3300005367 Ga0070667_101626502 Ga0070667_1016265021 151
442 3300006177 Ga0075362_10136447 Ga0075362_101364472 151
443 3300009011 Ga0105251_10000076 Ga0105251_1000007637 151
444 3300009148 Ga0105243_10043817 Ga0105243_100438174 151
445 3300011119 Ga0105246_11210157 Ga0105246_112101572 151
446 3300015265 Ga0182005_1004536 Ga0182005_10045362 151
447 3300025245 Ga0207425_1035805 Ga0207425_10358052 151
448 3300025294 Ga0209025_1000006 Ga0209025_1000006243 151
449 3300025297 Ga0209758_1008478 Ga0209758_10084784 151
450 3300025735 Ga0207713_1000308 Ga0207713_100030817 151
451 3300025925 Ga0207650_10002715 Ga0207650_100027157 151
452 3300025935 Ga0207709_10020946 Ga0207709_100209462 151
453 3300027312 Ga0209371_1000088 Ga0209371_100008847 151
454 3300030500 Ga0268256_1000079 Ga0268256_100007990 151
455 3300032004 Ga0307414_10019233 Ga0307414_100192335 151
456 3300041453 Ga0451797_1583063 Ga0451797_1583063_58_558 151
457 3300041509 Ga0451843_1167302 Ga0451843_1167302_134_592 151
458 3300044712 Ga0453684_0225711 Ga0453684_0225711_232_693 151
459 3300048920 Ga0496117_0004975 Ga0496117_0004975_13650_14150 151
460 3300048921 Ga0496118_0170509 Ga0496118_0170509_210_683 151
461 3300048922 Ga0496119_0000978 Ga0496119_0000978_664_1164 151
462 3300048923 Ga0496120_0000220 Ga0496120_0000220_77325_77825 151
463 3300048925 Ga0496122_0022543 Ga0496122_0022543_678_1178 151
464 3300048926 Ga0496123_0005623 Ga0496123_0005623_4431_4931 151
465 3300048928 Ga0496125_0214990 Ga0496125_0214990_627_1085 151
466 3300048929 Ga0496126_0378864 Ga0496126_0378864_407_907 151
467 3300049571 Ga0501034_0002645 Ga0501034_0002645_3857_4312 151
468 iso_pu_bacteria 2929195423 2929196689 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

46

131

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

38

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9611 14 141
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9593 13 142
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9559 15 121
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9549 14 141
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9526 13 142
ID Description Score Start End Superfamily
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9611 14 141 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9559 15 121 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9549 14 141 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9392 14 141 3.10.129.10
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9368 13 134 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0K0GLX9-F1-model_v4 Thioesterase family protein 0.9975 32 147 GO:0047617
AF-G0CCF1-F1-model_v4 deleted 0.9891 32 149
AF-A0A4R4ELD6-F1-model_v4 Tol-pal system-associated acyl-CoA thioesterase 0.9884 15 147 GO:0047617
AF-W4S6X2-F1-model_v4 Thioesterase 0.9875 21 147 GO:0047617
AF-A0A1W9L4J6-F1-model_v4 Tol-pal system-associated acyl-CoA thioesterase 0.9868 13 139 GO:0047617

Feature Viewer

pLDDT pTM Quality
90.47 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map