F450085

General Info

Members Datasets Scaffolds Average Seq Length
468 181 936 76

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0044892|Ga0466969_0044892_67_294
Length 69
Sequence MDDDTARRRLLVYSLLRFGGVAIFFLGGLVRPGGWPQVGAIVAIVGVLDALLAPHLLKRAWDRQDQEDQ

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.06
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0044892 3300044656 Bacteria 2196
2 JGI24741J21665_1046959 3300001915 Unclassified 635
3 JGI24741J21665_1068349 3300001915 Bacteria 526
4 JGI24740J21852_10000347 3300001979 Bacteria 19765
5 JGI24740J21852_10085495 3300001979 Unclassified 820
6 JGI24739J22299_10025342 3300001989 Bacteria 2086
7 JGI24739J22299_10102976 3300001989 Bacteria 861
8 JGI24737J22298_10002262 3300001990 Bacteria 6862
9 JGI24737J22298_10024647 3300001990 Bacteria 1905
10 JGI24737J22298_10210776 3300001990 Bacteria 573
11 JGI24735J21928_10071544 3300002067 Bacteria 993
12 JGI24735J21928_10115300 3300002067 Bacteria 773
13 JGI24738J21930_10006068 3300002075 Bacteria 2859
14 Ga0065715_10311770 3300005293 Bacteria 1019
15 Ga0070658_10005858 3300005327 Bacteria 9966
16 Ga0070658_10023792 3300005327 Bacteria 4913
17 Ga0070658_10094540 3300005327 Bacteria 2466
18 Ga0070658_10245800 3300005327 Bacteria 1517
19 Ga0070658_10360807 3300005327 Bacteria 1244
20 Ga0070658_10436619 3300005327 Bacteria 1127
21 Ga0070658_10453989 3300005327 Bacteria 1104
22 Ga0070676_10133758 3300005328 Bacteria 1571
23 Ga0070676_10856087 3300005328 Bacteria 674
24 Ga0070683_100002263 3300005329 Bacteria 15247
25 Ga0070683_100163502 3300005329 Bacteria 2112
26 Ga0070683_100274516 3300005329 Bacteria 1603
27 Ga0070683_102260946 3300005329 Bacteria 522
28 Ga0070670_100043672 3300005331 Bacteria 3853
29 Ga0070670_100468110 3300005331 Bacteria 1118
30 Ga0068869_101435119 3300005334 Unclassified 611
31 Ga0070666_11275969 3300005335 Bacteria 548
32 Ga0070680_100725275 3300005336 Unclassified 855
33 Ga0070682_100044377 3300005337 Bacteria 2752
34 Ga0070682_100141821 3300005337 Bacteria 1639
35 Ga0070660_100018067 3300005339 Bacteria 5146
36 Ga0070660_100047401 3300005339 Bacteria 3298
37 Ga0070660_100117522 3300005339 Bacteria 2121
38 Ga0070660_100201613 3300005339 Bacteria 1614
39 Ga0070689_100338807 3300005340 Bacteria 1259
40 Ga0070691_10370465 3300005341 Bacteria 800
41 Ga0070661_100000079 3300005344 Bacteria 77180
42 Ga0070661_100465512 3300005344 Bacteria 1007
43 Ga0070661_100746323 3300005344 Unclassified 800
44 Ga0070692_10005986 3300005345 Bacteria 5241
45 Ga0070692_10259732 3300005345 Bacteria 1043
46 Ga0070692_11015380 3300005345 Unclassified 581
47 Ga0070668_100094415 3300005347 Bacteria 2361
48 Ga0070668_100115554 3300005347 Bacteria 2139
49 Ga0070671_100000469 3300005355 Bacteria 28112
50 Ga0070674_101526644 3300005356 Unclassified 601
51 Ga0070673_100011976 3300005364 Bacteria 5940
52 Ga0070659_100000165 3300005366 Bacteria 51041
53 Ga0070659_100009589 3300005366 Bacteria 7117
54 Ga0070659_100040172 3300005366 Bacteria 3655
55 Ga0070659_100116178 3300005366 Bacteria 2163
56 Ga0070659_100466524 3300005366 Bacteria 1073
57 Ga0070659_101035345 3300005366 Unclassified 722
58 Ga0070659_101995759 3300005366 Bacteria 521
59 Ga0070667_100048153 3300005367 Bacteria 3588
60 Ga0070667_100622352 3300005367 Bacteria 995
61 Ga0070714_100016527 3300005435 Bacteria 5962
62 Ga0070714_100170013 3300005435 Bacteria 1978
63 Ga0070711_101254363 3300005439 Bacteria 642
64 Ga0070694_100021437 3300005444 Bacteria 4129
65 Ga0070663_100039111 3300005455 Bacteria 3313
66 Ga0070663_100046594 3300005455 Bacteria 3068
67 Ga0070663_100338414 3300005455 Bacteria 1215
68 Ga0070678_101509708 3300005456 Unclassified 629
69 Ga0070662_100000171 3300005457 Bacteria 37981
70 Ga0070662_100035087 3300005457 Bacteria 3540
71 Ga0070662_100847759 3300005457 Bacteria 778
72 Ga0070681_10266803 3300005458 Bacteria 1623
73 Ga0070681_10595238 3300005458 Bacteria 1020
74 Ga0070679_100557698 3300005530 Unclassified 1089
75 Ga0070679_100819771 3300005530 Bacteria 874
76 Ga0070679_101180509 3300005530 Bacteria 710
77 Ga0070684_100047459 3300005535 Bacteria 3721
78 Ga0070684_100078898 3300005535 Bacteria 2910
79 Ga0070684_101259097 3300005535 Bacteria 696
80 Ga0068853_100001092 3300005539 Bacteria 19210
81 Ga0068853_100226159 3300005539 Bacteria 1710
82 Ga0068853_100244195 3300005539 Bacteria 1646
83 Ga0070672_100072263 3300005543 Bacteria 2747
84 Ga0070672_100131765 3300005543 Bacteria 2055
85 Ga0070695_100854064 3300005545 Unclassified 733
86 Ga0070693_100025521 3300005547 Bacteria 3182
87 Ga0070693_100196301 3300005547 Bacteria 1308
88 Ga0070693_100618726 3300005547 Bacteria 784
89 Ga0070665_100051379 3300005548 Bacteria 4134
90 Ga0070665_100802632 3300005548 Bacteria 954
91 Ga0068855_100000447 3300005563 Bacteria 51000
92 Ga0068855_100033747 3300005563 Bacteria 6105
93 Ga0068855_100303136 3300005563 Bacteria 1769
94 Ga0068855_100342434 3300005563 Bacteria 1648
95 Ga0068855_100400098 3300005563 Bacteria 1505
96 Ga0068855_100843430 3300005563 Bacteria 971
97 Ga0068855_102379090 3300005563 Bacteria 529
98 Ga0070664_100000311 3300005564 Bacteria 35468
99 Ga0070664_100028355 3300005564 Bacteria 4656
100 Ga0070664_100065894 3300005564 Bacteria 3092
101 Ga0070664_100213687 3300005564 Bacteria 1724
102 Ga0070664_101265454 3300005564 Bacteria 696
103 Ga0068857_100102630 3300005577 Bacteria 2567
104 Ga0068857_100519082 3300005577 Bacteria 1119
105 Ga0068854_100087253 3300005578 Bacteria 2314
106 Ga0068854_100112215 3300005578 Bacteria 2058
107 Ga0068854_100129837 3300005578 Bacteria 1923
108 Ga0068854_101356755 3300005578 Bacteria 641
109 Ga0068856_100000979 3300005614 Bacteria 30480
110 Ga0068856_100464532 3300005614 Bacteria 1286
111 Ga0068856_100483881 3300005614 Bacteria 1259
112 Ga0068856_101035692 3300005614 Unclassified 839
113 Ga0068852_100003556 3300005616 Bacteria 10908
114 Ga0068852_100070138 3300005616 Bacteria 3074
115 Ga0068852_100488257 3300005616 Bacteria 1225
116 Ga0068852_100579464 3300005616 Bacteria 1125
117 Ga0068852_100627385 3300005616 Bacteria 1081
118 Ga0068852_100805057 3300005616 Bacteria 954
119 Ga0068852_101009712 3300005616 Bacteria 851
120 Ga0068852_101250219 3300005616 Bacteria 764
121 Ga0068859_100086475 3300005617 Bacteria 3182
122 Ga0068859_100319174 3300005617 Bacteria 1647
123 Ga0068859_102954601 3300005617 Bacteria 520
124 Ga0068864_100014358 3300005618 Bacteria 6578
125 Ga0068864_100056884 3300005618 Bacteria 3379
126 Ga0068864_101003407 3300005618 Bacteria 828
127 Ga0068861_102352209 3300005719 Unclassified 535
128 Ga0068851_10385298 3300005834 Bacteria 822
129 Ga0068851_10413462 3300005834 Bacteria 795
130 Ga0068851_10526635 3300005834 Bacteria 712
131 Ga0068851_10856120 3300005834 Archaea 567
132 Ga0068863_100181544 3300005841 Bacteria 2020
133 Ga0068863_100411942 3300005841 Bacteria 1323
134 Ga0068858_100103557 3300005842 Bacteria 2655
135 Ga0068858_100134540 3300005842 Bacteria 2319
136 Ga0068858_101323856 3300005842 Bacteria 709
137 Ga0068860_100049833 3300005843 Bacteria 3987
138 Ga0068860_100811544 3300005843 Bacteria 949
139 Ga0068860_100857480 3300005843 Bacteria 923
140 Ga0068862_100090518 3300005844 Bacteria 2664
141 Ga0068862_100103021 3300005844 Bacteria 2499
142 Ga0068862_101616454 3300005844 Bacteria 655
143 Ga0081540_1301444 3300005983 Unclassified 551
144 Ga0070712_100072236 3300006175 Bacteria 2471
145 Ga0097621_100081827 3300006237 Bacteria 2688
146 Ga0075434_100402937 3300006871 Bacteria 1389
147 Ga0068865_101133098 3300006881 Unclassified 690
148 Ga0097620_100086474 3300006931 Bacteria 3182
149 Ga0097620_100319172 3300006931 Bacteria 1647
150 Ga0097620_102954580 3300006931 Bacteria 520
151 Ga0105245_10010041 3300009098 Bacteria 8246
152 Ga0105245_10066363 3300009098 Bacteria 3265
153 Ga0105247_10174779 3300009101 Bacteria 1430
154 Ga0105243_10102278 3300009148 Bacteria 2380
155 Ga0105241_11956675 3300009174 Bacteria 576
156 Ga0105248_10000117 3300009177 Bacteria 90169
157 Ga0105248_10000928 3300009177 Bacteria 32626
158 Ga0105248_10808920 3300009177 Bacteria 1058
159 Ga0105248_13469399 3300009177 Bacteria 501
160 Ga0105238_10461603 3300009551 Bacteria 1268
161 Ga0105238_11657522 3300009551 Unclassified 670
162 Ga0105238_11685393 3300009551 Unclassified 665
163 Ga0105249_10115630 3300009553 Bacteria 2542
164 Ga0105249_10317648 3300009553 Bacteria 1568
165 Ga0105239_10249089 3300010375 Bacteria 1995
166 Ga0157373_10050008 3300013100 Bacteria 2978
167 Ga0157373_10129775 3300013100 Bacteria 1772
168 Ga0157373_10159823 3300013100 Bacteria 1585
169 Ga0157373_10220017 3300013100 Bacteria 1339
170 Ga0157373_10257038 3300013100 Unclassified 1236
171 Ga0157371_10007113 3300013102 Bacteria 9092
172 Ga0157371_10045436 3300013102 Bacteria 3125
173 Ga0157371_10085985 3300013102 Bacteria 2227
174 Ga0157371_10135757 3300013102 Bacteria 1752
175 Ga0157371_10224221 3300013102 Bacteria 1350
176 Ga0157371_10246233 3300013102 Bacteria 1287
177 Ga0157371_11311736 3300013102 Bacteria 560
178 Ga0157370_10005854 3300013104 Bacteria 13734
179 Ga0157369_10132324 3300013105 Bacteria 2642
180 Ga0157369_10191511 3300013105 Bacteria 2149
181 Ga0157369_10452744 3300013105 Bacteria 1329
182 Ga0157369_12625009 3300013105 Archaea 509
183 Ga0157374_10160267 3300013296 Bacteria 2191
184 Ga0163162_10219424 3300013306 Bacteria 2031
185 Ga0163162_12397024 3300013306 Bacteria 607
186 Ga0157372_10056479 3300013307 Bacteria 4386
187 Ga0157372_10675845 3300013307 Bacteria 1202
188 Ga0157372_10933962 3300013307 Bacteria 1006
189 Ga0157372_12893046 3300013307 Bacteria 550
190 Ga0163163_10000380 3300014325 Bacteria 42243
191 Ga0157380_11246825 3300014326 Bacteria 789
192 Ga0157379_10018659 3300014968 Bacteria 6115
193 Ga0157379_10601696 3300014968 Bacteria 1026
194 Ga0157376_11035965 3300014969 Bacteria 844
195 Ga0206354_11010786 3300020081 Bacteria 910
196 Ga0206354_11689322 3300020081 Bacteria 506
197 Ga0206353_10036903 3300020082 Bacteria 1636
198 Ga0206353_10395856 3300020082 Bacteria 807
199 Ga0206353_10651727 3300020082 Bacteria 1030
200 Ga0207656_10175714 3300025321 Bacteria 1026
201 Ga0207656_10547265 3300025321 Archaea 589
202 Ga0207688_10341880 3300025901 Unclassified 921
203 Ga0207680_10383235 3300025903 Bacteria 991
204 Ga0207647_10000181 3300025904 Bacteria 50570
205 Ga0207647_10045581 3300025904 Bacteria 2735
206 Ga0207645_10140419 3300025907 Bacteria 1574
207 Ga0207645_10430539 3300025907 Bacteria 889
208 Ga0207705_10000222 3300025909 Bacteria 56707
209 Ga0207705_10021882 3300025909 Bacteria 4562
210 Ga0207705_10027115 3300025909 Bacteria 4083
211 Ga0207705_10063711 3300025909 Bacteria 2663
212 Ga0207705_10087387 3300025909 Bacteria 2279
213 Ga0207705_10827435 3300025909 Bacteria 718
214 Ga0207707_11086963 3300025912 Bacteria 652
215 Ga0207693_10306726 3300025915 Bacteria 1243
216 Ga0207660_10806249 3300025917 Unclassified 766
217 Ga0207660_11570031 3300025917 Bacteria 531
218 Ga0207657_10000378 3300025919 Bacteria 47118
219 Ga0207657_10032225 3300025919 Bacteria 4738
220 Ga0207657_10033167 3300025919 Bacteria 4657
221 Ga0207657_10067669 3300025919 Bacteria 3036
222 Ga0207657_10183324 3300025919 Bacteria 1691
223 Ga0207657_10184034 3300025919 Bacteria 1688
224 Ga0207657_10288906 3300025919 Bacteria 1301
225 Ga0207649_10000135 3300025920 Bacteria 63197
226 Ga0207649_10627939 3300025920 Unclassified 828
227 Ga0207649_10984839 3300025920 Bacteria 663
228 Ga0207652_10254521 3300025921 Bacteria 1584
229 Ga0207652_10716299 3300025921 Bacteria 892
230 Ga0207652_11054165 3300025921 Bacteria 713
231 Ga0207652_11057012 3300025921 Bacteria 712
232 Ga0207681_11152625 3300025923 Bacteria 651
233 Ga0207694_10390810 3300025924 Bacteria 1156
234 Ga0207650_10327292 3300025925 Bacteria 1256
235 Ga0207650_10451380 3300025925 Bacteria 1070
236 Ga0207687_10119611 3300025927 Bacteria 1968
237 Ga0207687_10136559 3300025927 Bacteria 1855
238 Ga0207664_10015281 3300025929 Bacteria 5566
239 Ga0207664_11053135 3300025929 Bacteria 728
240 Ga0207644_10000514 3300025931 Bacteria 25001
241 Ga0207690_10000509 3300025932 Bacteria 25193
242 Ga0207690_10016605 3300025932 Bacteria 4483
243 Ga0207690_10064682 3300025932 Bacteria 2498
244 Ga0207690_10093676 3300025932 Bacteria 2129
245 Ga0207690_10172477 3300025932 Bacteria 1622
246 Ga0207690_10308885 3300025932 Bacteria 1240
247 Ga0207690_11776569 3300025932 Bacteria 515
248 Ga0207706_10000513 3300025933 Bacteria 41181
249 Ga0207706_10003711 3300025933 Bacteria 14568
250 Ga0207706_10041755 3300025933 Bacteria 4065
251 Ga0207706_10689993 3300025933 Bacteria 873
252 Ga0207706_11724490 3300025933 Unclassified 504
253 Ga0207709_10173550 3300025935 Bacteria 1515
254 Ga0207670_10224779 3300025936 Bacteria 1439
255 Ga0207691_10114518 3300025940 Bacteria 2396
256 Ga0207711_10000243 3300025941 Bacteria 58447
257 Ga0207711_10000558 3300025941 Bacteria 37953
258 Ga0207711_10019840 3300025941 Bacteria 5603
259 Ga0207689_10019298 3300025942 Bacteria 5747
260 Ga0207661_10014630 3300025944 Bacteria 5754
261 Ga0207661_11021612 3300025944 Bacteria 761
262 Ga0207679_10000460 3300025945 Bacteria 28726
263 Ga0207679_10001962 3300025945 Bacteria 12761
264 Ga0207679_10063699 3300025945 Bacteria 2753
265 Ga0207679_10083792 3300025945 Bacteria 2445
266 Ga0207679_10549011 3300025945 Bacteria 1036
267 Ga0207679_10811697 3300025945 Unclassified 853
268 Ga0207667_10001204 3300025949 Bacteria 32354
269 Ga0207667_10016616 3300025949 Bacteria 8308
270 Ga0207667_10073272 3300025949 Bacteria 3558
271 Ga0207667_10161775 3300025949 Bacteria 2302
272 Ga0207667_10407694 3300025949 Bacteria 1384
273 Ga0207667_10814284 3300025949 Bacteria 930
274 Ga0207667_12185851 3300025949 Bacteria 511
275 Ga0207651_10009419 3300025960 Bacteria 5347
276 Ga0207712_10030569 3300025961 Bacteria 3622
277 Ga0207712_10089088 3300025961 Bacteria 2268
278 Ga0207668_10066451 3300025972 Bacteria 2556
279 Ga0207668_10082200 3300025972 Bacteria 2339
280 Ga0207640_10066880 3300025981 Bacteria 2402
281 Ga0207640_10111282 3300025981 Bacteria 1942
282 Ga0207640_10227387 3300025981 Bacteria 1433
283 Ga0207658_10089384 3300025986 Bacteria 2384
284 Ga0207658_11542865 3300025986 Bacteria 607
285 Ga0207677_10780757 3300026023 Bacteria 854
286 Ga0207703_10118506 3300026035 Bacteria 2270
287 Ga0207703_10350678 3300026035 Bacteria 1359
288 Ga0207703_11809556 3300026035 Unclassified 587
289 Ga0207639_10034273 3300026041 Bacteria 3752
290 Ga0207639_10364832 3300026041 Bacteria 1293
291 Ga0207678_10013189 3300026067 Bacteria 7252
292 Ga0207678_10159123 3300026067 Bacteria 1929
293 Ga0207678_10373036 3300026067 Bacteria 1233
294 Ga0207678_11328863 3300026067 Bacteria 636
295 Ga0207702_10001066 3300026078 Bacteria 28071
296 Ga0207702_10145868 3300026078 Bacteria 2148
297 Ga0207702_11060757 3300026078 Bacteria 804
298 Ga0207641_10412507 3300026088 Bacteria 1299
299 Ga0207676_10004790 3300026095 Bacteria 9602
300 Ga0207676_10125046 3300026095 Bacteria 2176
301 Ga0207674_10017715 3300026116 Bacteria 7763
302 Ga0207674_10311866 3300026116 Bacteria 1522
303 Ga0207674_10654524 3300026116 Bacteria 1014
304 Ga0207698_10000675 3300026142 Bacteria 19796
305 Ga0207698_10068739 3300026142 Bacteria 2798
306 Ga0207698_10268060 3300026142 Bacteria 1572
307 Ga0207698_10449694 3300026142 Bacteria 1243
308 Ga0207698_10630541 3300026142 Bacteria 1060
309 Ga0207698_11686466 3300026142 Bacteria 649
310 Ga0268266_10010722 3300028379 Bacteria 7985
311 Ga0268266_11110496 3300028379 Bacteria 765
312 Ga0268265_10012968 3300028380 Bacteria 5659
313 Ga0268265_10064990 3300028380 Bacteria 2813
314 Ga0268265_11295721 3300028380 Unclassified 728
315 Ga0268264_10003847 3300028381 Bacteria 12881
316 Ga0268264_10829830 3300028381 Bacteria 925
317 Ga0307408_100211859 3300031548 Bacteria 1575
318 Ga0307408_100482126 3300031548 Bacteria 1082
319 Ga0307408_101666864 3300031548 Bacteria 607
320 Ga0307405_10013485 3300031731 Bacteria 4362
321 Ga0307405_10519927 3300031731 Bacteria 957
322 Ga0307413_10013600 3300031824 Bacteria 4097
323 Ga0307413_10026213 3300031824 Bacteria 3209
324 Ga0307413_10369447 3300031824 Bacteria 1113
325 Ga0307413_10385950 3300031824 Bacteria 1093
326 Ga0307413_11233279 3300031824 Unclassified 652
327 Ga0307410_10002679 3300031852 Bacteria 8686
328 Ga0307410_10115030 3300031852 Bacteria 1952
329 Ga0307410_10540571 3300031852 Unclassified 964
330 Ga0307410_10583197 3300031852 Unclassified 930
331 Ga0307410_11007696 3300031852 Bacteria 718
332 Ga0307410_11178017 3300031852 Bacteria 667
333 Ga0307406_10037962 3300031901 Bacteria 2979
334 Ga0307407_10019722 3300031903 Bacteria 3439
335 Ga0307407_11522004 3300031903 Bacteria 529
336 Ga0307407_11665729 3300031903 Unclassified 507
337 Ga0307412_10696308 3300031911 Bacteria 871
338 Ga0307412_11507188 3300031911 Bacteria 611
339 Ga0307409_100026845 3300031995 Bacteria 4069
340 Ga0307409_100221168 3300031995 Bacteria 1709
341 Ga0307409_100248891 3300031995 Bacteria 1623
342 Ga0307409_100272925 3300031995 Bacteria 1558
343 Ga0307409_100606584 3300031995 Bacteria 1082
344 Ga0307409_101099931 3300031995 Bacteria 816
345 Ga0307409_102028576 3300031995 Bacteria 605
346 Ga0307416_100003493 3300032002 Bacteria 9243
347 Ga0307416_101481255 3300032002 Bacteria 784
348 Ga0307414_10102556 3300032004 Bacteria 2156
349 Ga0307414_10187610 3300032004 Bacteria 1670
350 Ga0307414_10412054 3300032004 Bacteria 1176
351 Ga0307414_10602318 3300032004 Bacteria 985
352 Ga0307414_10684182 3300032004 Bacteria 927
353 Ga0307411_10191078 3300032005 Bacteria 1563
354 Ga0307411_10460301 3300032005 Bacteria 1066
355 Ga0307411_10705076 3300032005 Bacteria 879
356 Ga0307411_10838147 3300032005 Bacteria 812
357 Ga0307411_12223384 3300032005 Bacteria 514
358 Ga0307415_100008828 3300032126 Bacteria 5611
359 Ga0307415_100714621 3300032126 Bacteria 906
360 Ga0307415_100849367 3300032126 Bacteria 837
361 Ga0373958_0043241 3300034819 Bacteria 928
362 Ga0373959_0040663 3300034820 Bacteria 974
363 Ga0373929_0005703 3300035085 Bacteria 2246
364 Ga0373941_0529449 3300035115 Unclassified 505
365 Ga0395899_0013200 3300037312 Bacteria 6320
366 Ga0395899_0109034 3300037312 Bacteria 1992
367 Ga0395899_0161842 3300037312 Bacteria 1580
368 Ga0395899_0221623 3300037312 Bacteria 1310
369 Ga0395899_0246494 3300037312 Bacteria 1227
370 Ga0395899_0250509 3300037312 Bacteria 1215
371 Ga0395899_0268964 3300037312 Unclassified 1163
372 Ga0395899_0323421 3300037312 Bacteria 1038
373 Ga0395899_0425261 3300037312 Bacteria 874
374 Ga0395899_0451564 3300037312 Bacteria 841
375 Ga0395900_0019881 3300037418 Bacteria 6846
376 Ga0395900_0033961 3300037418 Bacteria 5250
377 Ga0395900_0062881 3300037418 Bacteria 3815
378 Ga0395900_0084972 3300037418 Bacteria 3252
379 Ga0395900_0207662 3300037418 Bacteria 1978
380 Ga0395900_0383205 3300037418 Bacteria 1373
381 Ga0395900_0542502 3300037418 Bacteria 1108
382 Ga0395900_0583623 3300037418 Bacteria 1059
383 Ga0395900_0738167 3300037418 Bacteria 916
384 Ga0395900_1091394 3300037418 Bacteria 715
385 Ga0395900_1432795 3300037418 Bacteria 603
386 Ga0395900_1842547 3300037418 Bacteria 515
387 Ga0395900_1901914 3300037418 Unclassified 505
388 Ga0395898_0115205 3300037466 Bacteria 2575
389 Ga0395898_0140346 3300037466 Bacteria 2313
390 Ga0395898_0315510 3300037466 Bacteria 1491
391 Ga0395898_0321213 3300037466 Bacteria 1477
392 Ga0395898_0478049 3300037466 Bacteria 1185
393 Ga0395898_0629883 3300037466 Bacteria 1015
394 Ga0395905_0007664 3300037471 Bacteria 10715
395 Ga0395905_0063946 3300037471 Bacteria 3442
396 Ga0395905_0106888 3300037471 Bacteria 2627
397 Ga0395905_0112556 3300037471 Bacteria 2556
398 Ga0395905_0128376 3300037471 Bacteria 2384
399 Ga0395905_0216251 3300037471 Bacteria 1794
400 Ga0395905_0233270 3300037471 Bacteria 1720
401 Ga0395905_0233776 3300037471 Bacteria 1718
402 Ga0395905_0350311 3300037471 Bacteria 1368
403 Ga0395905_0446148 3300037471 Bacteria 1191
404 Ga0395905_0507302 3300037471 Bacteria 1106
405 Ga0395905_0531359 3300037471 Unclassified 1077
406 Ga0395905_0709073 3300037471 Unclassified 908
407 Ga0395905_1779419 3300037471 Bacteria 522
408 Ga0395901_0049408 3300038443 Bacteria 4370
409 Ga0395901_0074241 3300038443 Bacteria 3548
410 Ga0395901_0143740 3300038443 Bacteria 2507
411 Ga0395901_0290579 3300038443 Bacteria 1696
412 Ga0395901_0304591 3300038443 Bacteria 1651
413 Ga0395901_0449193 3300038443 Bacteria 1318
414 Ga0395901_0499494 3300038443 Bacteria 1238
415 Ga0395901_0594478 3300038443 Bacteria 1116
416 Ga0395901_0674102 3300038443 Bacteria 1034
417 Ga0395901_0732568 3300038443 Bacteria 983
418 Ga0395901_0758783 3300038443 Bacteria 962
419 Ga0395901_0759827 3300038443 Bacteria 962
420 Ga0466966_0250647 3300044684 Bacteria 1066
421 Ga0466966_0846612 3300044684 Bacteria 551
422 Ga0466961_0275430 3300044693 Bacteria 1030
423 Ga0466963_0046907 3300044694 Bacteria 2850
424 Ga0466963_0073336 3300044694 Bacteria 2307
425 Ga0466963_0084381 3300044694 Bacteria 2155
426 Ga0466971_0058365 3300044719 Bacteria 1742
427 Ga0466957_0328617 3300044842 Bacteria 1033
428 Ga0466959_0080519 3300045049 Bacteria 2347
429 Ga0466959_0629057 3300045049 Bacteria 721
430 Ga0466958_0245483 3300045836 Bacteria 1144
431 Ga0466967_0028602 3300045976 Bacteria 4655
432 Ga0466967_0100563 3300045976 Bacteria 2642
433 Ga0466967_0724331 3300045976 Bacteria 986
434 Ga0466967_1065016 3300045976 Bacteria 805
435 Ga0466967_1978653 3300045976 Bacteria 579
436 Ga0495639_0497820 3300046475 Bacteria 622
437 Ga0495588_0730575 3300046674 Unclassified 518
438 Ga0495669_0020108 3300046684 Bacteria 2886
439 Ga0496100_0014427 3300048903 Bacteria 4586
440 Ga0496101_0004188 3300048904 Bacteria 9038
441 Ga0496101_0177776 3300048904 Bacteria 1638
442 Ga0496102_0696555 3300048905 Unclassified 939
443 Ga0496106_0000666 3300048909 Bacteria 24598
444 Ga0496106_1380920 3300048909 Bacteria 545
445 Ga0496107_0000181 3300048910 Bacteria 32803
446 Ga0496107_0170686 3300048910 Bacteria 1614
447 Ga0496107_0559367 3300048910 Bacteria 847
448 Ga0496108_0000229 3300048911 Bacteria 50203
449 Ga0496108_0101492 3300048911 Bacteria 2454
450 Ga0496108_0227384 3300048911 Bacteria 1622
451 Ga0496109_0000774 3300048912 Bacteria 26581
452 Ga0496109_0612406 3300048912 Bacteria 1025
453 Ga0496110_0000647 3300048913 Bacteria 23828
454 Ga0496111_0010055 3300048914 Bacteria 6330
455 Ga0496112_0000354 3300048915 Bacteria 29882
456 Ga0496112_0679861 3300048915 Bacteria 958
457 Ga0496113_0012911 3300048916 Bacteria 5633
458 Ga0501070_0018388 3300049586 Bacteria 5864
459 Ga0501071_0667052 3300049587 Bacteria 800
460 Ga0501074_0675150 3300049590 Bacteria 729
461 Ga0501233_043566 3300049668 Bacteria 1064
462 Ga0501247_024071 3300049677 Bacteria 804
463 Ga0501249_031732 3300049679 Bacteria 1180
464 Ga0501225_0231371 3300049705 Bacteria 600
465 Ga0501080_0238337 3300049742 Bacteria 1661
466 Ga0501268_089910 3300049765 Bacteria 645
467 nmdc:mga0n895_625483_c1 3300050512 Bacteria 1077
468 Ga0466962_0054774 3300061719 Bacteria 1906
469 Ga0466969_0044892
470 JGI24741J21665_1046959
471 JGI24741J21665_1068349
472 JGI24740J21852_10000347
473 JGI24740J21852_10085495
474 JGI24739J22299_10025342
475 JGI24739J22299_10102976
476 JGI24737J22298_10002262
477 JGI24737J22298_10024647
478 JGI24737J22298_10210776
479 JGI24735J21928_10071544
480 JGI24735J21928_10115300
481 JGI24738J21930_10006068
482 Ga0065715_10311770
483 Ga0070658_10005858
484 Ga0070658_10023792
485 Ga0070658_10094540
486 Ga0070658_10245800
487 Ga0070658_10360807
488 Ga0070658_10436619
489 Ga0070658_10453989
490 Ga0070676_10133758
491 Ga0070676_10856087
492 Ga0070683_100002263
493 Ga0070683_100163502
494 Ga0070683_100274516
495 Ga0070683_102260946
496 Ga0070670_100043672
497 Ga0070670_100468110
498 Ga0068869_101435119
499 Ga0070666_11275969
500 Ga0070680_100725275
501 Ga0070682_100044377
502 Ga0070682_100141821
503 Ga0070660_100018067
504 Ga0070660_100047401
505 Ga0070660_100117522
506 Ga0070660_100201613
507 Ga0070689_100338807
508 Ga0070691_10370465
509 Ga0070661_100000079
510 Ga0070661_100465512
511 Ga0070661_100746323
512 Ga0070692_10005986
513 Ga0070692_10259732
514 Ga0070692_11015380
515 Ga0070668_100094415
516 Ga0070668_100115554
517 Ga0070671_100000469
518 Ga0070674_101526644
519 Ga0070673_100011976
520 Ga0070659_100000165
521 Ga0070659_100009589
522 Ga0070659_100040172
523 Ga0070659_100116178
524 Ga0070659_100466524
525 Ga0070659_101035345
526 Ga0070659_101995759
527 Ga0070667_100048153
528 Ga0070667_100622352
529 Ga0070714_100016527
530 Ga0070714_100170013
531 Ga0070711_101254363
532 Ga0070694_100021437
533 Ga0070663_100039111
534 Ga0070663_100046594
535 Ga0070663_100338414
536 Ga0070678_101509708
537 Ga0070662_100000171
538 Ga0070662_100035087
539 Ga0070662_100847759
540 Ga0070681_10266803
541 Ga0070681_10595238
542 Ga0070679_100557698
543 Ga0070679_100819771
544 Ga0070679_101180509
545 Ga0070684_100047459
546 Ga0070684_100078898
547 Ga0070684_101259097
548 Ga0068853_100001092
549 Ga0068853_100226159
550 Ga0068853_100244195
551 Ga0070672_100072263
552 Ga0070672_100131765
553 Ga0070695_100854064
554 Ga0070693_100025521
555 Ga0070693_100196301
556 Ga0070693_100618726
557 Ga0070665_100051379
558 Ga0070665_100802632
559 Ga0068855_100000447
560 Ga0068855_100033747
561 Ga0068855_100303136
562 Ga0068855_100342434
563 Ga0068855_100400098
564 Ga0068855_100843430
565 Ga0068855_102379090
566 Ga0070664_100000311
567 Ga0070664_100028355
568 Ga0070664_100065894
569 Ga0070664_100213687
570 Ga0070664_101265454
571 Ga0068857_100102630
572 Ga0068857_100519082
573 Ga0068854_100087253
574 Ga0068854_100112215
575 Ga0068854_100129837
576 Ga0068854_101356755
577 Ga0068856_100000979
578 Ga0068856_100464532
579 Ga0068856_100483881
580 Ga0068856_101035692
581 Ga0068852_100003556
582 Ga0068852_100070138
583 Ga0068852_100488257
584 Ga0068852_100579464
585 Ga0068852_100627385
586 Ga0068852_100805057
587 Ga0068852_101009712
588 Ga0068852_101250219
589 Ga0068859_100086475
590 Ga0068859_100319174
591 Ga0068859_102954601
592 Ga0068864_100014358
593 Ga0068864_100056884
594 Ga0068864_101003407
595 Ga0068861_102352209
596 Ga0068851_10385298
597 Ga0068851_10413462
598 Ga0068851_10526635
599 Ga0068851_10856120
600 Ga0068863_100181544
601 Ga0068863_100411942
602 Ga0068858_100103557
603 Ga0068858_100134540
604 Ga0068858_101323856
605 Ga0068860_100049833
606 Ga0068860_100811544
607 Ga0068860_100857480
608 Ga0068862_100090518
609 Ga0068862_100103021
610 Ga0068862_101616454
611 Ga0081540_1301444
612 Ga0070712_100072236
613 Ga0097621_100081827
614 Ga0075434_100402937
615 Ga0068865_101133098
616 Ga0097620_100086474
617 Ga0097620_100319172
618 Ga0097620_102954580
619 Ga0105245_10010041
620 Ga0105245_10066363
621 Ga0105247_10174779
622 Ga0105243_10102278
623 Ga0105241_11956675
624 Ga0105248_10000117
625 Ga0105248_10000928
626 Ga0105248_10808920
627 Ga0105248_13469399
628 Ga0105238_10461603
629 Ga0105238_11657522
630 Ga0105238_11685393
631 Ga0105249_10115630
632 Ga0105249_10317648
633 Ga0105239_10249089
634 Ga0157373_10050008
635 Ga0157373_10129775
636 Ga0157373_10159823
637 Ga0157373_10220017
638 Ga0157373_10257038
639 Ga0157371_10007113
640 Ga0157371_10045436
641 Ga0157371_10085985
642 Ga0157371_10135757
643 Ga0157371_10224221
644 Ga0157371_10246233
645 Ga0157371_11311736
646 Ga0157370_10005854
647 Ga0157369_10132324
648 Ga0157369_10191511
649 Ga0157369_10452744
650 Ga0157369_12625009
651 Ga0157374_10160267
652 Ga0163162_10219424
653 Ga0163162_12397024
654 Ga0157372_10056479
655 Ga0157372_10675845
656 Ga0157372_10933962
657 Ga0157372_12893046
658 Ga0163163_10000380
659 Ga0157380_11246825
660 Ga0157379_10018659
661 Ga0157379_10601696
662 Ga0157376_11035965
663 Ga0206354_11010786
664 Ga0206354_11689322
665 Ga0206353_10036903
666 Ga0206353_10395856
667 Ga0206353_10651727
668 Ga0207656_10175714
669 Ga0207656_10547265
670 Ga0207688_10341880
671 Ga0207680_10383235
672 Ga0207647_10000181
673 Ga0207647_10045581
674 Ga0207645_10140419
675 Ga0207645_10430539
676 Ga0207705_10000222
677 Ga0207705_10021882
678 Ga0207705_10027115
679 Ga0207705_10063711
680 Ga0207705_10087387
681 Ga0207705_10827435
682 Ga0207707_11086963
683 Ga0207693_10306726
684 Ga0207660_10806249
685 Ga0207660_11570031
686 Ga0207657_10000378
687 Ga0207657_10032225
688 Ga0207657_10033167
689 Ga0207657_10067669
690 Ga0207657_10183324
691 Ga0207657_10184034
692 Ga0207657_10288906
693 Ga0207649_10000135
694 Ga0207649_10627939
695 Ga0207649_10984839
696 Ga0207652_10254521
697 Ga0207652_10716299
698 Ga0207652_11054165
699 Ga0207652_11057012
700 Ga0207681_11152625
701 Ga0207694_10390810
702 Ga0207650_10327292
703 Ga0207650_10451380
704 Ga0207687_10119611
705 Ga0207687_10136559
706 Ga0207664_10015281
707 Ga0207664_11053135
708 Ga0207644_10000514
709 Ga0207690_10000509
710 Ga0207690_10016605
711 Ga0207690_10064682
712 Ga0207690_10093676
713 Ga0207690_10172477
714 Ga0207690_10308885
715 Ga0207690_11776569
716 Ga0207706_10000513
717 Ga0207706_10003711
718 Ga0207706_10041755
719 Ga0207706_10689993
720 Ga0207706_11724490
721 Ga0207709_10173550
722 Ga0207670_10224779
723 Ga0207691_10114518
724 Ga0207711_10000243
725 Ga0207711_10000558
726 Ga0207711_10019840
727 Ga0207689_10019298
728 Ga0207661_10014630
729 Ga0207661_11021612
730 Ga0207679_10000460
731 Ga0207679_10001962
732 Ga0207679_10063699
733 Ga0207679_10083792
734 Ga0207679_10549011
735 Ga0207679_10811697
736 Ga0207667_10001204
737 Ga0207667_10016616
738 Ga0207667_10073272
739 Ga0207667_10161775
740 Ga0207667_10407694
741 Ga0207667_10814284
742 Ga0207667_12185851
743 Ga0207651_10009419
744 Ga0207712_10030569
745 Ga0207712_10089088
746 Ga0207668_10066451
747 Ga0207668_10082200
748 Ga0207640_10066880
749 Ga0207640_10111282
750 Ga0207640_10227387
751 Ga0207658_10089384
752 Ga0207658_11542865
753 Ga0207677_10780757
754 Ga0207703_10118506
755 Ga0207703_10350678
756 Ga0207703_11809556
757 Ga0207639_10034273
758 Ga0207639_10364832
759 Ga0207678_10013189
760 Ga0207678_10159123
761 Ga0207678_10373036
762 Ga0207678_11328863
763 Ga0207702_10001066
764 Ga0207702_10145868
765 Ga0207702_11060757
766 Ga0207641_10412507
767 Ga0207676_10004790
768 Ga0207676_10125046
769 Ga0207674_10017715
770 Ga0207674_10311866
771 Ga0207674_10654524
772 Ga0207698_10000675
773 Ga0207698_10068739
774 Ga0207698_10268060
775 Ga0207698_10449694
776 Ga0207698_10630541
777 Ga0207698_11686466
778 Ga0268266_10010722
779 Ga0268266_11110496
780 Ga0268265_10012968
781 Ga0268265_10064990
782 Ga0268265_11295721
783 Ga0268264_10003847
784 Ga0268264_10829830
785 Ga0307408_100211859
786 Ga0307408_100482126
787 Ga0307408_101666864
788 Ga0307405_10013485
789 Ga0307405_10519927
790 Ga0307413_10013600
791 Ga0307413_10026213
792 Ga0307413_10369447
793 Ga0307413_10385950
794 Ga0307413_11233279
795 Ga0307410_10002679
796 Ga0307410_10115030
797 Ga0307410_10540571
798 Ga0307410_10583197
799 Ga0307410_11007696
800 Ga0307410_11178017
801 Ga0307406_10037962
802 Ga0307407_10019722
803 Ga0307407_11522004
804 Ga0307407_11665729
805 Ga0307412_10696308
806 Ga0307412_11507188
807 Ga0307409_100026845
808 Ga0307409_100221168
809 Ga0307409_100248891
810 Ga0307409_100272925
811 Ga0307409_100606584
812 Ga0307409_101099931
813 Ga0307409_102028576
814 Ga0307416_100003493
815 Ga0307416_101481255
816 Ga0307414_10102556
817 Ga0307414_10187610
818 Ga0307414_10412054
819 Ga0307414_10602318
820 Ga0307414_10684182
821 Ga0307411_10191078
822 Ga0307411_10460301
823 Ga0307411_10705076
824 Ga0307411_10838147
825 Ga0307411_12223384
826 Ga0307415_100008828
827 Ga0307415_100714621
828 Ga0307415_100849367
829 Ga0373958_0043241
830 Ga0373959_0040663
831 Ga0373929_0005703
832 Ga0373941_0529449
833 Ga0395899_0013200
834 Ga0395899_0109034
835 Ga0395899_0161842
836 Ga0395899_0221623
837 Ga0395899_0246494
838 Ga0395899_0250509
839 Ga0395899_0268964
840 Ga0395899_0323421
841 Ga0395899_0425261
842 Ga0395899_0451564
843 Ga0395900_0019881
844 Ga0395900_0033961
845 Ga0395900_0062881
846 Ga0395900_0084972
847 Ga0395900_0207662
848 Ga0395900_0383205
849 Ga0395900_0542502
850 Ga0395900_0583623
851 Ga0395900_0738167
852 Ga0395900_1091394
853 Ga0395900_1432795
854 Ga0395900_1842547
855 Ga0395900_1901914
856 Ga0395898_0115205
857 Ga0395898_0140346
858 Ga0395898_0315510
859 Ga0395898_0321213
860 Ga0395898_0478049
861 Ga0395898_0629883
862 Ga0395905_0007664
863 Ga0395905_0063946
864 Ga0395905_0106888
865 Ga0395905_0112556
866 Ga0395905_0128376
867 Ga0395905_0216251
868 Ga0395905_0233270
869 Ga0395905_0233776
870 Ga0395905_0350311
871 Ga0395905_0446148
872 Ga0395905_0507302
873 Ga0395905_0531359
874 Ga0395905_0709073
875 Ga0395905_1779419
876 Ga0395901_0049408
877 Ga0395901_0074241
878 Ga0395901_0143740
879 Ga0395901_0290579
880 Ga0395901_0304591
881 Ga0395901_0449193
882 Ga0395901_0499494
883 Ga0395901_0594478
884 Ga0395901_0674102
885 Ga0395901_0732568
886 Ga0395901_0758783
887 Ga0395901_0759827
888 Ga0466966_0250647
889 Ga0466966_0846612
890 Ga0466961_0275430
891 Ga0466963_0046907
892 Ga0466963_0073336
893 Ga0466963_0084381
894 Ga0466971_0058365
895 Ga0466957_0328617
896 Ga0466959_0080519
897 Ga0466959_0629057
898 Ga0466958_0245483
899 Ga0466967_0028602
900 Ga0466967_0100563
901 Ga0466967_0724331
902 Ga0466967_1065016
903 Ga0466967_1978653
904 Ga0495639_0497820
905 Ga0495588_0730575
906 Ga0495669_0020108
907 Ga0496100_0014427
908 Ga0496101_0004188
909 Ga0496101_0177776
910 Ga0496102_0696555
911 Ga0496106_0000666
912 Ga0496106_1380920
913 Ga0496107_0000181
914 Ga0496107_0170686
915 Ga0496107_0559367
916 Ga0496108_0000229
917 Ga0496108_0101492
918 Ga0496108_0227384
919 Ga0496109_0000774
920 Ga0496109_0612406
921 Ga0496110_0000647
922 Ga0496111_0010055
923 Ga0496112_0000354
924 Ga0496112_0679861
925 Ga0496113_0012911
926 Ga0501070_0018388
927 Ga0501071_0667052
928 Ga0501074_0675150
929 Ga0501233_043566
930 Ga0501247_024071
931 Ga0501249_031732
932 Ga0501225_0231371
933 Ga0501080_0238337
934 Ga0501268_089910
935 nmdc:mga0n895_625483_c1
936 Ga0466962_0054774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map