F450089

General Info

Members Datasets Scaffolds Average Seq Length
468 206 936 200

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0004412|Ga0466957_0004412_5052_5762
Length 236
Sequence VSARGLRSSVAGANMKMMFQPSGLRFCWRDRVSYRSMALTLLSPVHHELVIKKSRFIACVQPMGDRAAAQQVVARLRAEHPAATHVCWALLAGGQSAAVDDGEPSGTAGRPMLDVLRHQDLEGVLATVVRYFGGVKLGAGGLVRAYTDSVAQALLQAQKVAIVRLQGLRCRVPYALEGLLRRELELAGATLEQVAHGDAVDLAFRLPAGRAEALVARLNEAGNGRVAWIGVPDGPA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
75 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
76 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
187 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
188 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
189 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
190 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
191 2643221556 Massilia sp. Root1485 Isolate Unclassified
192 2643221664 Massilia sp. Root418 Isolate Unclassified
193 2643221684 Massilia sp. Root133 Isolate Unclassified
194 2738541307 Variovorax sp. GV008 Isolate Unclassified
195 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
196 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
197 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
198 2885266251 Ralstonia sp. SET104 Isolate Nodule
199 2899924645 Variovorax sp. 369 Isolate Unclassified
200 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
201 2928037797 Variovorax sp. 1126 Isolate Unclassified
202 2928044640 Variovorax sp. 1128 Isolate Unclassified
203 2928051484 Variovorax sp. 1133 Isolate Unclassified
204 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
205 2928070936 Variovorax gossypii 1167 Isolate Unclassified
206 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0.85
Rhizoplane 5.34
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0004412 3300044842 Bacteria 7833
2 JGI25159J45721_1001038 3300002987 Bacteria 11872
3 JGI25159J45721_1023191 3300002987 Bacteria 1131
4 JGI25151J46595_10023679 3300003187 Bacteria 2524
5 JGI25153J46596_10018252 3300003215 Bacteria 2732
6 rootH1_10021326 3300003316 Bacteria 3706
7 Ga0055526_1023180 3300003771 Bacteria 2081
8 Ga0055524_1000015 3300003775 Bacteria 246493
9 Ga0055543_1012304 3300004625 Bacteria 1726
10 Ga0055543_1019108 3300004625 Bacteria 1270
11 Ga0055543_1024313 3300004625 Bacteria 1088
12 Ga0065165_1000455 3300005262 Bacteria 64259
13 Ga0065165_1001096 3300005262 Bacteria 32206
14 Ga0065165_1014936 3300005262 Bacteria 2989
15 Ga0070658_10169217 3300005327 Bacteria 1835
16 Ga0070680_100058181 3300005336 Bacteria 3161
17 Ga0070659_100095367 3300005366 Bacteria 2389
18 Ga0070659_100373820 3300005366 Bacteria 1199
19 Ga0070665_100467762 3300005548 Bacteria 1271
20 Ga0068855_100046129 3300005563 Bacteria 5152
21 Ga0068855_100258502 3300005563 Bacteria 1941
22 Ga0068855_100450962 3300005563 Bacteria 1404
23 Ga0068855_100654863 3300005563 Bacteria 1127
24 Ga0070664_100322601 3300005564 Bacteria 1400
25 Ga0068856_100423869 3300005614 Bacteria 1351
26 Ga0068852_100028411 3300005616 Bacteria 4577
27 Ga0099826_10000003 3300006948 Bacteria 1067817
28 Ga0105244_10025698 3300009036 Bacteria 3197
29 Ga0105240_10223997 3300009093 Bacteria 2189
30 Ga0105245_10185822 3300009098 Bacteria 1988
31 Ga0105242_10063790 3300009176 Bacteria 3034
32 Ga0105237_10019084 3300009545 Bacteria 7088
33 Ga0105238_10107863 3300009551 Bacteria 2765
34 Ga0105239_10318971 3300010375 Bacteria 1752
35 Ga0157370_10876985 3300013104 Bacteria 815
36 Ga0157372_10390962 3300013307 Bacteria 1620
37 Ga0157372_10988102 3300013307 Bacteria 975
38 Ga0182008_10060582 3300014497 Bacteria 1866
39 Ga0182006_1012197 3300015261 Bacteria 3763
40 Ga0182007_10024021 3300015262 Bacteria 2137
41 Ga0213872_10000763 3300021361 Bacteria 23609
42 Ga0213872_10001321 3300021361 Bacteria 16423
43 Ga0213872_10006091 3300021361 Bacteria 6103
44 Ga0213872_10056960 3300021361 Bacteria 1770
45 Ga0213872_10076865 3300021361 Bacteria 1501
46 Ga0209672_100962 3300025228 Bacteria 12795
47 Ga0209147_101143 3300025229 Bacteria 10894
48 Ga0209563_100015 3300025230 Bacteria 879901
49 Ga0209258_100015 3300025242 Bacteria 706310
50 Ga0207425_1004478 3300025245 Bacteria 4179
51 Ga0209677_104059 3300025253 Bacteria 4399
52 Ga0209148_1000028 3300025254 Bacteria 582773
53 Ga0209565_1023944 3300025263 Bacteria 1249
54 Ga0209673_1000356 3300025273 Bacteria 82432
55 Ga0209673_1001242 3300025273 Bacteria 26534
56 Ga0209130_1000296 3300025284 Bacteria 60641
57 Ga0209130_1001104 3300025284 Bacteria 19948
58 Ga0209675_1013555 3300025291 Bacteria 2539
59 Ga0209676_1021511 3300025292 Bacteria 2163
60 Ga0209025_1034578 3300025294 Bacteria 2303
61 Ga0209564_1000847 3300025295 Bacteria 40940
62 Ga0209564_1014599 3300025295 Bacteria 3253
63 Ga0209758_1036868 3300025297 Bacteria 1900
64 Ga0209256_1000005 3300025299 Bacteria 1315082
65 Ga0209256_1000787 3300025299 Bacteria 40940
66 Ga0207426_1000683 3300025302 Bacteria 40932
67 Ga0209051_1056497 3300025303 Bacteria 1265
68 Ga0207647_10279834 3300025904 Bacteria 952
69 Ga0207705_10014048 3300025909 Bacteria 5770
70 Ga0207705_10791527 3300025909 Bacteria 736
71 Ga0207654_10027385 3300025911 Bacteria 3097
72 Ga0207660_10044463 3300025917 Bacteria 3125
73 Ga0207657_10345046 3300025919 Bacteria 1175
74 Ga0207694_10097446 3300025924 Bacteria 2327
75 Ga0207690_10001619 3300025932 Bacteria 14018
76 Ga0207690_10016643 3300025932 Bacteria 4480
77 Ga0207706_10223391 3300025933 Bacteria 1649
78 Ga0207661_10919818 3300025944 Bacteria 806
79 Ga0207679_10506113 3300025945 Bacteria 1078
80 Ga0207667_10052904 3300025949 Bacteria 4274
81 Ga0207667_10525432 3300025949 Bacteria 1199
82 Ga0207640_10066449 3300025981 Bacteria 2409
83 Ga0207702_10050522 3300026078 Bacteria 3511
84 Ga0207698_10364185 3300026142 Bacteria 1370
85 Ga0209282_1000002 3300027666 Bacteria 1067825
86 Ga0307515_10000471 3300028794 Bacteria 96225
87 Ga0307408_100000488 3300031548 Bacteria 34667
88 Ga0307514_10000420 3300031649 Bacteria 94078
89 Ga0307514_10000842 3300031649 Bacteria 49580
90 Ga0395899_0000715 3300037312 Bacteria 33273
91 Ga0395899_0034324 3300037312 Bacteria 3808
92 Ga0395899_0164004 3300037312 Bacteria 1568
93 Ga0395899_0338452 3300037312 Bacteria 1009
94 Ga0395900_0000298 3300037418 Bacteria 74295
95 Ga0395900_0000372 3300037418 Bacteria 64606
96 Ga0395900_0002819 3300037418 Bacteria 18975
97 Ga0395900_0069892 3300037418 Bacteria 3609
98 Ga0395900_0203257 3300037418 Bacteria 2003
99 Ga0395900_0244296 3300037418 Bacteria 1799
100 Ga0395900_0431720 3300037418 Bacteria 1276
101 Ga0395900_0445082 3300037418 Bacteria 1252
102 Ga0395900_0670340 3300037418 Bacteria 972
103 Ga0395898_0022854 3300037466 Bacteria 6325
104 Ga0395898_0034127 3300037466 Bacteria 5073
105 Ga0395898_0114084 3300037466 Bacteria 2589
106 Ga0395898_0190337 3300037466 Bacteria 1960
107 Ga0395898_0250961 3300037466 Bacteria 1687
108 Ga0395898_0353039 3300037466 Bacteria 1402
109 Ga0395898_0407475 3300037466 Bacteria 1296
110 Ga0395898_0506331 3300037466 Bacteria 1148
111 Ga0395898_0559173 3300037466 Bacteria 1086
112 Ga0395898_0605119 3300037466 Bacteria 1039
113 Ga0395905_0001525 3300037471 Bacteria 27709
114 Ga0395905_0057667 3300037471 Bacteria 3632
115 Ga0395905_0069536 3300037471 Bacteria 3297
116 Ga0395905_0096368 3300037471 Bacteria 2777
117 Ga0395905_0101127 3300037471 Bacteria 2706
118 Ga0395905_0318312 3300037471 Bacteria 1445
119 Ga0395901_0001123 3300038443 Bacteria 28428
120 Ga0395901_0004045 3300038443 Bacteria 14768
121 Ga0395901_0223314 3300038443 Bacteria 1968
122 Ga0395901_0269160 3300038443 Bacteria 1772
123 Ga0395901_0295721 3300038443 Bacteria 1679
124 Ga0395901_0328465 3300038443 Bacteria 1581
125 Ga0395901_0427381 3300038443 Bacteria 1357
126 Ga0395901_0443463 3300038443 Bacteria 1328
127 Ga0395901_1007703 3300038443 Bacteria 808
128 Ga0436361_0298962 3300039447 Bacteria 11732
129 Ga0436361_0310853 3300039447 Bacteria 19766
130 Ga0436361_0367502 3300039447 Bacteria 3371
131 Ga0436361_0709224 3300039447 Bacteria 2786
132 Ga0436361_0768142 3300039447 Bacteria 56393
133 Ga0436361_0856154 3300039447 Bacteria 13774
134 Ga0436361_0980094 3300039447 Bacteria 2153
135 Ga0439448_0006205 3300042005 Bacteria 3429
136 Ga0439450_103080 3300042008 Bacteria 725
137 Ga0439455_0001966 3300042012 Bacteria 3627
138 Ga0439458_0029107 3300042157 Bacteria 1309
139 Ga0450893_0001215 3300042532 Bacteria 3882
140 Ga0466969_0156856 3300044656 Bacteria 1047
141 Ga0466978_0065463 3300044671 Bacteria 2268
142 Ga0466965_0008829 3300044683 Bacteria 4674
143 Ga0466965_0012721 3300044683 Bacteria 3963
144 Ga0466965_0020221 3300044683 Bacteria 3198
145 Ga0466966_0175000 3300044684 Bacteria 1303
146 Ga0466961_0000656 3300044693 Bacteria 21722
147 Ga0466961_0076924 3300044693 Bacteria 2114
148 Ga0466961_0095070 3300044693 Bacteria 1880
149 Ga0466961_0104614 3300044693 Bacteria 1782
150 Ga0466961_0137729 3300044693 Bacteria 1529
151 Ga0466963_0454809 3300044694 Bacteria 903
152 Ga0466964_0002408 3300044706 Bacteria 6648
153 Ga0466964_0002452 3300044706 Bacteria 6595
154 Ga0466964_0026627 3300044706 Bacteria 2264
155 Ga0466964_0082701 3300044706 Bacteria 1381
156 Ga0466971_0235826 3300044719 Bacteria 869
157 Ga0466968_0003377 3300044735 Bacteria 5900
158 Ga0466968_0381498 3300044735 Bacteria 688
159 Ga0466970_0023276 3300044765 Bacteria 3235
160 Ga0466970_0043322 3300044765 Bacteria 2394
161 Ga0466970_0112789 3300044765 Bacteria 1485
162 Ga0466957_0011780 3300044842 Bacteria 5056
163 Ga0466957_0013067 3300044842 Bacteria 4810
164 Ga0466957_0016488 3300044842 Bacteria 4322
165 Ga0466957_0131043 3300044842 Bacteria 1606
166 Ga0466957_0169517 3300044842 Bacteria 1421
167 Ga0466959_0012554 3300045049 Bacteria 6126
168 Ga0466959_0016104 3300045049 Bacteria 5456
169 Ga0466959_0349310 3300045049 Bacteria 1008
170 Ga0466958_0036401 3300045836 Bacteria 2945
171 Ga0466958_0247105 3300045836 Bacteria 1141
172 Ga0466958_0256889 3300045836 Bacteria 1118
173 Ga0466967_0037103 3300045976 Bacteria 4167
174 Ga0466967_0038386 3300045976 Bacteria 4107
175 Ga0466967_0047699 3300045976 Bacteria 3735
176 Ga0466967_0106129 3300045976 Bacteria 2574
177 Ga0495617_000002 3300046452 Bacteria 710121
178 Ga0495627_000207 3300046453 Bacteria 63763
179 Ga0495627_016542 3300046453 Bacteria 2523
180 Ga0495603_0241892 3300046455 Bacteria 1039
181 Ga0495638_0023320 3300046460 Bacteria 4048
182 Ga0495653_0017874 3300046463 Bacteria 5764
183 Ga0495653_0027841 3300046463 Bacteria 4523
184 Ga0495650_0000124 3300046471 Bacteria 180310
185 Ga0495580_0055866 3300046472 Bacteria 2780
186 Ga0495582_0006734 3300046473 Bacteria 6390
187 Ga0495582_0029455 3300046473 Bacteria 3014
188 Ga0495582_0068834 3300046473 Bacteria 1956
189 Ga0495605_0000034 3300046474 Bacteria 208277
190 Ga0495605_0000293 3300046474 Bacteria 55067
191 Ga0495605_0022908 3300046474 Bacteria 3291
192 Ga0495605_0035996 3300046474 Bacteria 2498
193 Ga0495605_0057241 3300046474 Bacteria 1877
194 Ga0495584_0000255 3300046491 Bacteria 37941
195 Ga0495584_0002306 3300046491 Bacteria 10889
196 Ga0495584_0014023 3300046491 Bacteria 4082
197 Ga0495584_0023692 3300046491 Bacteria 3112
198 Ga0495584_0173965 3300046491 Bacteria 1094
199 Ga0495584_0222407 3300046491 Bacteria 959
200 Ga0495585_0000941 3300046492 Bacteria 24552
201 Ga0495585_0013154 3300046492 Bacteria 4849
202 Ga0495585_0032611 3300046492 Bacteria 2950
203 Ga0495585_0034948 3300046492 Bacteria 2841
204 Ga0495585_0281756 3300046492 Bacteria 821
205 Ga0495594_0004412 3300046499 Bacteria 7239
206 Ga0495594_0007895 3300046499 Bacteria 5470
207 Ga0495594_0018988 3300046499 Bacteria 3649
208 Ga0495594_0156727 3300046499 Bacteria 1293
209 Ga0495594_0376084 3300046499 Bacteria 808
210 Ga0495596_0002005 3300046500 Bacteria 11211
211 Ga0495596_0006431 3300046500 Bacteria 5405
212 Ga0495596_0017894 3300046500 Bacteria 2927
213 Ga0495596_0019506 3300046500 Bacteria 2784
214 Ga0495596_0020124 3300046500 Bacteria 2733
215 Ga0495596_0060516 3300046500 Bacteria 1475
216 Ga0495596_0079574 3300046500 Bacteria 1272
217 Ga0495607_0000398 3300046501 Bacteria 44114
218 Ga0495607_0003557 3300046501 Bacteria 11865
219 Ga0495607_0004032 3300046501 Bacteria 11012
220 Ga0495607_0023486 3300046501 Bacteria 3859
221 Ga0495607_0040201 3300046501 Bacteria 2786
222 Ga0495607_0073512 3300046501 Bacteria 1900
223 Ga0495607_0136454 3300046501 Bacteria 1270
224 Ga0495607_0139572 3300046501 Bacteria 1251
225 Ga0495607_0264365 3300046501 Bacteria 822
226 Ga0495583_0007672 3300046506 Bacteria 6725
227 Ga0495583_0040281 3300046506 Bacteria 2196
228 Ga0495583_0081981 3300046506 Bacteria 1400
229 Ga0495606_0003064 3300046507 Bacteria 18209
230 Ga0495606_0004415 3300046507 Bacteria 14071
231 Ga0495606_0018764 3300046507 Bacteria 5174
232 Ga0495606_0034865 3300046507 Bacteria 3448
233 Ga0495606_0055167 3300046507 Bacteria 2571
234 Ga0495606_0128817 3300046507 Bacteria 1506
235 Ga0495616_0000207 3300046513 Bacteria 48768
236 Ga0495616_0027210 3300046513 Bacteria 3036
237 Ga0495616_0038566 3300046513 Bacteria 2452
238 Ga0495616_0052803 3300046513 Bacteria 2022
239 Ga0495616_0060290 3300046513 Bacteria 1864
240 Ga0495616_0100557 3300046513 Bacteria 1356
241 Ga0495630_0023901 3300046517 Bacteria 4518
242 Ga0495630_0087913 3300046517 Bacteria 2347
243 Ga0495631_0001464 3300046518 Bacteria 14314
244 Ga0495631_0009529 3300046518 Bacteria 4848
245 Ga0495631_0013714 3300046518 Bacteria 3926
246 Ga0495631_0014136 3300046518 Bacteria 3857
247 Ga0495631_0014203 3300046518 Bacteria 3848
248 Ga0495631_0033002 3300046518 Bacteria 2328
249 Ga0495632_0000077 3300046519 Bacteria 100834
250 Ga0495632_0000129 3300046519 Bacteria 77134
251 Ga0495632_0000296 3300046519 Bacteria 48157
252 Ga0495632_0000375 3300046519 Bacteria 42575
253 Ga0495632_0016131 3300046519 Bacteria 4165
254 Ga0495637_0046850 3300046520 Bacteria 1827
255 Ga0495643_0000567 3300046522 Bacteria 45722
256 Ga0495643_0001819 3300046522 Bacteria 18186
257 Ga0495643_0007860 3300046522 Bacteria 6817
258 Ga0495643_0139465 3300046522 Bacteria 1210
259 Ga0495644_0016214 3300046523 Bacteria 2853
260 Ga0495644_0018036 3300046523 Bacteria 2695
261 Ga0495644_0052731 3300046523 Bacteria 1527
262 Ga0495648_0001105 3300046524 Bacteria 27423
263 Ga0495648_0004314 3300046524 Bacteria 12185
264 Ga0495648_0055635 3300046524 Bacteria 2384
265 Ga0495666_0011477 3300046526 Bacteria 4416
266 Ga0495666_0021155 3300046526 Bacteria 3220
267 Ga0495666_0023273 3300046526 Bacteria 3063
268 Ga0495642_0000085 3300046528 Bacteria 54372
269 Ga0495642_0000285 3300046528 Bacteria 28471
270 Ga0495642_0001143 3300046528 Bacteria 12193
271 Ga0495642_0008629 3300046528 Bacteria 3896
272 Ga0495642_0008644 3300046528 Bacteria 3892
273 Ga0495642_0011900 3300046528 Bacteria 3351
274 Ga0495642_0024816 3300046528 Bacteria 2373
275 Ga0495642_0056789 3300046528 Bacteria 1617
276 Ga0495642_0080114 3300046528 Bacteria 1374
277 Ga0495642_0109457 3300046528 Bacteria 1180
278 Ga0495652_0004715 3300046529 Bacteria 12985
279 Ga0495654_0001914 3300046530 Bacteria 13821
280 Ga0495654_0008948 3300046530 Bacteria 5501
281 Ga0495654_0062803 3300046530 Bacteria 1780
282 Ga0495665_0018035 3300046531 Bacteria 3794
283 Ga0495586_0005557 3300046535 Bacteria 6743
284 Ga0495586_0082910 3300046535 Bacteria 1763
285 Ga0495587_0013636 3300046536 Bacteria 5105
286 Ga0495609_0000002 3300046538 Bacteria 739816
287 Ga0495609_0001432 3300046538 Bacteria 15888
288 Ga0495609_0003372 3300046538 Bacteria 9189
289 Ga0495609_0029292 3300046538 Bacteria 2507
290 Ga0495597_0000226 3300046542 Bacteria 51108
291 Ga0495597_0000958 3300046542 Bacteria 22301
292 Ga0495597_0001519 3300046542 Bacteria 16517
293 Ga0495597_0002642 3300046542 Bacteria 11115
294 Ga0495645_0204452 3300046543 Bacteria 1337
295 Ga0495622_0027202 3300046557 Bacteria 2669
296 Ga0495633_0023706 3300046558 Bacteria 3038
297 Ga0495633_0083478 3300046558 Bacteria 1486
298 Ga0495656_0022620 3300046615 Bacteria 2464
299 Ga0495656_0155360 3300046615 Bacteria 1108
300 Ga0495668_0000274 3300046616 Bacteria 72330
301 Ga0495668_0000544 3300046616 Bacteria 46835
302 Ga0495668_0000941 3300046616 Bacteria 32463
303 Ga0495668_0007379 3300046616 Bacteria 7039
304 Ga0495668_0020194 3300046616 Bacteria 3832
305 Ga0495668_0039940 3300046616 Bacteria 2619
306 Ga0495668_0155468 3300046616 Bacteria 1252
307 Ga0495634_0004059 3300046642 Bacteria 11593
308 Ga0495611_0004463 3300046648 Bacteria 6058
309 Ga0495611_0091057 3300046648 Bacteria 1409
310 Ga0495611_0136390 3300046648 Bacteria 1146
311 Ga0495625_0015455 3300046660 Bacteria 6047
312 Ga0495625_0082309 3300046660 Bacteria 2239
313 Ga0495625_0087684 3300046660 Bacteria 2157
314 Ga0495625_0096763 3300046660 Bacteria 2033
315 Ga0495635_0007996 3300046663 Bacteria 7389
316 Ga0495661_0000281 3300046665 Bacteria 57922
317 Ga0495661_0000980 3300046665 Bacteria 25764
318 Ga0495661_0001170 3300046665 Bacteria 22890
319 Ga0495661_0011134 3300046665 Bacteria 6107
320 Ga0495661_0017463 3300046665 Bacteria 4737
321 Ga0495661_0025498 3300046665 Bacteria 3817
322 Ga0495661_0028318 3300046665 Bacteria 3587
323 Ga0495661_0031180 3300046665 Bacteria 3386
324 Ga0495661_0057392 3300046665 Bacteria 2324
325 Ga0495661_0196891 3300046665 Bacteria 1057
326 Ga0495588_0000177 3300046674 Bacteria 78598
327 Ga0495588_0192769 3300046674 Bacteria 1076
328 Ga0495588_0227369 3300046674 Bacteria 984
329 Ga0495623_0148735 3300046679 Bacteria 1386
330 Ga0495646_0409921 3300046680 Bacteria 704
331 Ga0495669_0000092 3300046684 Bacteria 59765
332 Ga0495669_0011936 3300046684 Bacteria 3695
333 Ga0495669_0028401 3300046684 Bacteria 2450
334 Ga0495613_0198299 3300046689 Bacteria 1416
335 Ga0495670_0000312 3300046691 Bacteria 23108
336 Ga0495670_0006596 3300046691 Bacteria 5705
337 Ga0495670_0170798 3300046691 Bacteria 1145
338 Ga0495671_0003576 3300046692 Bacteria 9494
339 Ga0495671_0058089 3300046692 Bacteria 1914
340 Ga0495649_0013521 3300046694 Bacteria 4707
341 Ga0495649_0015559 3300046694 Bacteria 4328
342 Ga0495589_0000128 3300046794 Bacteria 69997
343 Ga0495589_0000230 3300046794 Bacteria 47199
344 Ga0495589_0004614 3300046794 Bacteria 7322
345 Ga0495600_0365675 3300046809 Bacteria 902
346 Ga0495660_0000026 3300046810 Bacteria 256223
347 Ga0495660_0007209 3300046810 Bacteria 6544
348 Ga0495660_0013746 3300046810 Bacteria 4691
349 Ga0495660_0023409 3300046810 Bacteria 3522
350 Ga0495660_0224563 3300046810 Bacteria 883
351 Ga0495581_0012247 3300047315 Bacteria 4967
352 Ga0495581_0209799 3300047315 Bacteria 1139
353 Ga0495604_0022685 3300047317 Bacteria 5011
354 Ga0495604_0042475 3300047317 Bacteria 3562
355 Ga0495604_0228572 3300047317 Bacteria 1277
356 Ga0495672_0001178 3300047320 Bacteria 26523
357 Ga0495672_0001659 3300047320 Bacteria 21644
358 Ga0495672_0007797 3300047320 Bacteria 8005
359 Ga0495672_0008194 3300047320 Bacteria 7751
360 Ga0495676_0013666 3300047321 Bacteria 7286
361 Ga0495680_0012771 3300047322 Bacteria 7365
362 Ga0495680_0302837 3300047322 Bacteria 1122
363 Ga0495683_0006353 3300047323 Bacteria 6456
364 Ga0495683_0018861 3300047323 Bacteria 3562
365 Ga0495683_0155670 3300047323 Bacteria 1060
366 Ga0495687_000013 3300047443 Bacteria 371058
367 Ga0495687_000280 3300047443 Bacteria 67023
368 Ga0495687_000337 3300047443 Bacteria 60197
369 Ga0495675_0001600 3300047444 Bacteria 13611
370 Ga0495675_0058743 3300047444 Bacteria 2438
371 Ga0495675_0129774 3300047444 Bacteria 1567
372 Ga0495675_0136480 3300047444 Bacteria 1522
373 Ga0495675_0149395 3300047444 Bacteria 1444
374 Ga0495675_0176069 3300047444 Bacteria 1312
375 Ga0495677_0000041 3300047445 Bacteria 75366
376 Ga0495677_0000104 3300047445 Bacteria 41829
377 Ga0495677_0000925 3300047445 Bacteria 11857
378 Ga0495677_0004477 3300047445 Bacteria 5360
379 Ga0495677_0005455 3300047445 Bacteria 4823
380 Ga0495677_0022940 3300047445 Bacteria 2265
381 Ga0495679_030828 3300047446 Bacteria 1736
382 Ga0495685_007067 3300047447 Bacteria 3697
383 Ga0495681_0000667 3300047470 Bacteria 26095
384 Ga0495681_0000815 3300047470 Bacteria 23974
385 Ga0495681_0029032 3300047470 Bacteria 2836
386 Ga0495686_0000656 3300047472 Bacteria 47216
387 Ga0495593_0012889 3300047673 Bacteria 4776
388 Ga0495593_0032009 3300047673 Bacteria 2869
389 Ga0495593_0041624 3300047673 Bacteria 2469
390 Ga0495602_0008084 3300048088 Bacteria 10992
391 Ga0495602_0087835 3300048088 Bacteria 2590
392 Ga0495602_0145995 3300048088 Bacteria 1866
393 Ga0495614_0013115 3300048089 Bacteria 3635
394 Ga0495614_0031697 3300048089 Bacteria 2276
395 Ga0495626_0000003 3300048091 Bacteria 427774
396 Ga0495626_0000383 3300048091 Bacteria 45903
397 Ga0495626_0000478 3300048091 Bacteria 40390
398 Ga0495626_0003588 3300048091 Bacteria 9874
399 Ga0495626_0004649 3300048091 Bacteria 8338
400 Ga0495626_0005710 3300048091 Bacteria 7195
401 Ga0495626_0006035 3300048091 Bacteria 6964
402 Ga0495626_0007698 3300048091 Bacteria 5969
403 Ga0495626_0029701 3300048091 Bacteria 2643
404 Ga0496100_0394876 3300048903 Bacteria 1052
405 Ga0496101_0128191 3300048904 Bacteria 1924
406 Ga0496101_0357714 3300048904 Bacteria 1148
407 Ga0496102_0120884 3300048905 Bacteria 2446
408 Ga0496103_0337555 3300048906 Bacteria 969
409 Ga0496104_0525833 3300048907 Bacteria 1094
410 Ga0496105_0174773 3300048908 Bacteria 1760
411 Ga0496106_0009983 3300048909 Bacteria 7011
412 Ga0496106_0369326 3300048909 Bacteria 1153
413 Ga0496107_0566928 3300048910 Bacteria 840
414 Ga0496107_0575200 3300048910 Bacteria 834
415 Ga0496109_0009157 3300048912 Bacteria 8432
416 Ga0496109_0356571 3300048912 Bacteria 1382
417 Ga0496110_0000068 3300048913 Bacteria 51803
418 Ga0496110_0150029 3300048913 Bacteria 2110
419 Ga0496110_0299972 3300048913 Bacteria 1463
420 Ga0496111_0009513 3300048914 Bacteria 6493
421 Ga0496113_0006466 3300048916 Bacteria 7432
422 Ga0496113_0146283 3300048916 Bacteria 1862
423 Ga0496114_0038094 3300048917 Bacteria 3978
424 Ga0496115_0138120 3300048918 Bacteria 2010
425 Ga0496115_0319771 3300048918 Bacteria 1269
426 Ga0496122_0000445 3300048925 Bacteria 86566
427 Ga0496122_0001558 3300048925 Bacteria 36307
428 Ga0496122_0023667 3300048925 Bacteria 5401
429 Ga0496122_0100999 3300048925 Bacteria 1928
430 Ga0496123_0001531 3300048926 Bacteria 31933
431 Ga0496123_0020515 3300048926 Bacteria 5166
432 Ga0496123_0170610 3300048926 Bacteria 1148
433 Ga0496124_0012065 3300048927 Bacteria 8577
434 Ga0496124_0018475 3300048927 Bacteria 6528
435 Ga0496124_0031219 3300048927 Bacteria 4719
436 Ga0496124_0194656 3300048927 Bacteria 1548
437 Ga0496124_0216952 3300048927 Bacteria 1442
438 Ga0496124_0422873 3300048927 Bacteria 917
439 Ga0496125_0002859 3300048928 Bacteria 21722
440 Ga0496125_0093728 3300048928 Bacteria 2240
441 Ga0496126_0084087 3300048929 Bacteria 2807
442 Ga0495678_000316 3300049459 Bacteria 51625
443 Ga0495678_001703 3300049459 Bacteria 16504
444 Ga0495678_050832 3300049459 Bacteria 1604
445 Ga0495682_0000107 3300049460 Bacteria 73486
446 Ga0501035_0003556 3300049822 Bacteria 14885
447 Ga0466962_0010024 3300061719 Bacteria 4547
448 2597032385 2596583598 Bacteria 5251611
449 2599621544 2599185214 Bacteria 8209958
450 2599670772 2599185226 Bacteria 8233575
451 2599679262 2599185227 Bacteria 8246414
452 2599691055 2599185229 Bacteria 8216126
453 2643798107 2643221556 Bacteria 7251154
454 2644358200 2643221664 Bacteria 7272945
455 2644473285 2643221684 Bacteria 7145183
456 2738883535 2738541307 Bacteria 8606193
457 2809144570 2808606418 Bacteria 6724496
458 2838058149 2838054893 Bacteria 7451788
459 2858691479 2858688981 Bacteria 8184122
460 2885268790 2885266251 Bacteria 4796748
461 2899929139 2899924645 Bacteria 7487985
462 2919706771 2919704043 Bacteria 5560311
463 2928040426 2928037797 Bacteria 7273642
464 2928046825 2928044640 Bacteria 7271509
465 2928057987 2928051484 Bacteria 7773759
466 2928067673 2928064002 Bacteria 7419480
467 2928072206 2928070936 Bacteria 8062541
468 8047678121 8047673197 Bacteria 7395230
469 Ga0466957_0004412
470 JGI25159J45721_1001038
471 JGI25159J45721_1023191
472 JGI25151J46595_10023679
473 JGI25153J46596_10018252
474 rootH1_10021326
475 Ga0055526_1023180
476 Ga0055524_1000015
477 Ga0055543_1012304
478 Ga0055543_1019108
479 Ga0055543_1024313
480 Ga0065165_1000455
481 Ga0065165_1001096
482 Ga0065165_1014936
483 Ga0070658_10169217
484 Ga0070680_100058181
485 Ga0070659_100095367
486 Ga0070659_100373820
487 Ga0070665_100467762
488 Ga0068855_100046129
489 Ga0068855_100258502
490 Ga0068855_100450962
491 Ga0068855_100654863
492 Ga0070664_100322601
493 Ga0068856_100423869
494 Ga0068852_100028411
495 Ga0099826_10000003
496 Ga0105244_10025698
497 Ga0105240_10223997
498 Ga0105245_10185822
499 Ga0105242_10063790
500 Ga0105237_10019084
501 Ga0105238_10107863
502 Ga0105239_10318971
503 Ga0157370_10876985
504 Ga0157372_10390962
505 Ga0157372_10988102
506 Ga0182008_10060582
507 Ga0182006_1012197
508 Ga0182007_10024021
509 Ga0213872_10000763
510 Ga0213872_10001321
511 Ga0213872_10006091
512 Ga0213872_10056960
513 Ga0213872_10076865
514 Ga0209672_100962
515 Ga0209147_101143
516 Ga0209563_100015
517 Ga0209258_100015
518 Ga0207425_1004478
519 Ga0209677_104059
520 Ga0209148_1000028
521 Ga0209565_1023944
522 Ga0209673_1000356
523 Ga0209673_1001242
524 Ga0209130_1000296
525 Ga0209130_1001104
526 Ga0209675_1013555
527 Ga0209676_1021511
528 Ga0209025_1034578
529 Ga0209564_1000847
530 Ga0209564_1014599
531 Ga0209758_1036868
532 Ga0209256_1000005
533 Ga0209256_1000787
534 Ga0207426_1000683
535 Ga0209051_1056497
536 Ga0207647_10279834
537 Ga0207705_10014048
538 Ga0207705_10791527
539 Ga0207654_10027385
540 Ga0207660_10044463
541 Ga0207657_10345046
542 Ga0207694_10097446
543 Ga0207690_10001619
544 Ga0207690_10016643
545 Ga0207706_10223391
546 Ga0207661_10919818
547 Ga0207679_10506113
548 Ga0207667_10052904
549 Ga0207667_10525432
550 Ga0207640_10066449
551 Ga0207702_10050522
552 Ga0207698_10364185
553 Ga0209282_1000002
554 Ga0307515_10000471
555 Ga0307408_100000488
556 Ga0307514_10000420
557 Ga0307514_10000842
558 Ga0395899_0000715
559 Ga0395899_0034324
560 Ga0395899_0164004
561 Ga0395899_0338452
562 Ga0395900_0000298
563 Ga0395900_0000372
564 Ga0395900_0002819
565 Ga0395900_0069892
566 Ga0395900_0203257
567 Ga0395900_0244296
568 Ga0395900_0431720
569 Ga0395900_0445082
570 Ga0395900_0670340
571 Ga0395898_0022854
572 Ga0395898_0034127
573 Ga0395898_0114084
574 Ga0395898_0190337
575 Ga0395898_0250961
576 Ga0395898_0353039
577 Ga0395898_0407475
578 Ga0395898_0506331
579 Ga0395898_0559173
580 Ga0395898_0605119
581 Ga0395905_0001525
582 Ga0395905_0057667
583 Ga0395905_0069536
584 Ga0395905_0096368
585 Ga0395905_0101127
586 Ga0395905_0318312
587 Ga0395901_0001123
588 Ga0395901_0004045
589 Ga0395901_0223314
590 Ga0395901_0269160
591 Ga0395901_0295721
592 Ga0395901_0328465
593 Ga0395901_0427381
594 Ga0395901_0443463
595 Ga0395901_1007703
596 Ga0436361_0298962
597 Ga0436361_0310853
598 Ga0436361_0367502
599 Ga0436361_0709224
600 Ga0436361_0768142
601 Ga0436361_0856154
602 Ga0436361_0980094
603 Ga0439448_0006205
604 Ga0439450_103080
605 Ga0439455_0001966
606 Ga0439458_0029107
607 Ga0450893_0001215
608 Ga0466969_0156856
609 Ga0466978_0065463
610 Ga0466965_0008829
611 Ga0466965_0012721
612 Ga0466965_0020221
613 Ga0466966_0175000
614 Ga0466961_0000656
615 Ga0466961_0076924
616 Ga0466961_0095070
617 Ga0466961_0104614
618 Ga0466961_0137729
619 Ga0466963_0454809
620 Ga0466964_0002408
621 Ga0466964_0002452
622 Ga0466964_0026627
623 Ga0466964_0082701
624 Ga0466971_0235826
625 Ga0466968_0003377
626 Ga0466968_0381498
627 Ga0466970_0023276
628 Ga0466970_0043322
629 Ga0466970_0112789
630 Ga0466957_0011780
631 Ga0466957_0013067
632 Ga0466957_0016488
633 Ga0466957_0131043
634 Ga0466957_0169517
635 Ga0466959_0012554
636 Ga0466959_0016104
637 Ga0466959_0349310
638 Ga0466958_0036401
639 Ga0466958_0247105
640 Ga0466958_0256889
641 Ga0466967_0037103
642 Ga0466967_0038386
643 Ga0466967_0047699
644 Ga0466967_0106129
645 Ga0495617_000002
646 Ga0495627_000207
647 Ga0495627_016542
648 Ga0495603_0241892
649 Ga0495638_0023320
650 Ga0495653_0017874
651 Ga0495653_0027841
652 Ga0495650_0000124
653 Ga0495580_0055866
654 Ga0495582_0006734
655 Ga0495582_0029455
656 Ga0495582_0068834
657 Ga0495605_0000034
658 Ga0495605_0000293
659 Ga0495605_0022908
660 Ga0495605_0035996
661 Ga0495605_0057241
662 Ga0495584_0000255
663 Ga0495584_0002306
664 Ga0495584_0014023
665 Ga0495584_0023692
666 Ga0495584_0173965
667 Ga0495584_0222407
668 Ga0495585_0000941
669 Ga0495585_0013154
670 Ga0495585_0032611
671 Ga0495585_0034948
672 Ga0495585_0281756
673 Ga0495594_0004412
674 Ga0495594_0007895
675 Ga0495594_0018988
676 Ga0495594_0156727
677 Ga0495594_0376084
678 Ga0495596_0002005
679 Ga0495596_0006431
680 Ga0495596_0017894
681 Ga0495596_0019506
682 Ga0495596_0020124
683 Ga0495596_0060516
684 Ga0495596_0079574
685 Ga0495607_0000398
686 Ga0495607_0003557
687 Ga0495607_0004032
688 Ga0495607_0023486
689 Ga0495607_0040201
690 Ga0495607_0073512
691 Ga0495607_0136454
692 Ga0495607_0139572
693 Ga0495607_0264365
694 Ga0495583_0007672
695 Ga0495583_0040281
696 Ga0495583_0081981
697 Ga0495606_0003064
698 Ga0495606_0004415
699 Ga0495606_0018764
700 Ga0495606_0034865
701 Ga0495606_0055167
702 Ga0495606_0128817
703 Ga0495616_0000207
704 Ga0495616_0027210
705 Ga0495616_0038566
706 Ga0495616_0052803
707 Ga0495616_0060290
708 Ga0495616_0100557
709 Ga0495630_0023901
710 Ga0495630_0087913
711 Ga0495631_0001464
712 Ga0495631_0009529
713 Ga0495631_0013714
714 Ga0495631_0014136
715 Ga0495631_0014203
716 Ga0495631_0033002
717 Ga0495632_0000077
718 Ga0495632_0000129
719 Ga0495632_0000296
720 Ga0495632_0000375
721 Ga0495632_0016131
722 Ga0495637_0046850
723 Ga0495643_0000567
724 Ga0495643_0001819
725 Ga0495643_0007860
726 Ga0495643_0139465
727 Ga0495644_0016214
728 Ga0495644_0018036
729 Ga0495644_0052731
730 Ga0495648_0001105
731 Ga0495648_0004314
732 Ga0495648_0055635
733 Ga0495666_0011477
734 Ga0495666_0021155
735 Ga0495666_0023273
736 Ga0495642_0000085
737 Ga0495642_0000285
738 Ga0495642_0001143
739 Ga0495642_0008629
740 Ga0495642_0008644
741 Ga0495642_0011900
742 Ga0495642_0024816
743 Ga0495642_0056789
744 Ga0495642_0080114
745 Ga0495642_0109457
746 Ga0495652_0004715
747 Ga0495654_0001914
748 Ga0495654_0008948
749 Ga0495654_0062803
750 Ga0495665_0018035
751 Ga0495586_0005557
752 Ga0495586_0082910
753 Ga0495587_0013636
754 Ga0495609_0000002
755 Ga0495609_0001432
756 Ga0495609_0003372
757 Ga0495609_0029292
758 Ga0495597_0000226
759 Ga0495597_0000958
760 Ga0495597_0001519
761 Ga0495597_0002642
762 Ga0495645_0204452
763 Ga0495622_0027202
764 Ga0495633_0023706
765 Ga0495633_0083478
766 Ga0495656_0022620
767 Ga0495656_0155360
768 Ga0495668_0000274
769 Ga0495668_0000544
770 Ga0495668_0000941
771 Ga0495668_0007379
772 Ga0495668_0020194
773 Ga0495668_0039940
774 Ga0495668_0155468
775 Ga0495634_0004059
776 Ga0495611_0004463
777 Ga0495611_0091057
778 Ga0495611_0136390
779 Ga0495625_0015455
780 Ga0495625_0082309
781 Ga0495625_0087684
782 Ga0495625_0096763
783 Ga0495635_0007996
784 Ga0495661_0000281
785 Ga0495661_0000980
786 Ga0495661_0001170
787 Ga0495661_0011134
788 Ga0495661_0017463
789 Ga0495661_0025498
790 Ga0495661_0028318
791 Ga0495661_0031180
792 Ga0495661_0057392
793 Ga0495661_0196891
794 Ga0495588_0000177
795 Ga0495588_0192769
796 Ga0495588_0227369
797 Ga0495623_0148735
798 Ga0495646_0409921
799 Ga0495669_0000092
800 Ga0495669_0011936
801 Ga0495669_0028401
802 Ga0495613_0198299
803 Ga0495670_0000312
804 Ga0495670_0006596
805 Ga0495670_0170798
806 Ga0495671_0003576
807 Ga0495671_0058089
808 Ga0495649_0013521
809 Ga0495649_0015559
810 Ga0495589_0000128
811 Ga0495589_0000230
812 Ga0495589_0004614
813 Ga0495600_0365675
814 Ga0495660_0000026
815 Ga0495660_0007209
816 Ga0495660_0013746
817 Ga0495660_0023409
818 Ga0495660_0224563
819 Ga0495581_0012247
820 Ga0495581_0209799
821 Ga0495604_0022685
822 Ga0495604_0042475
823 Ga0495604_0228572
824 Ga0495672_0001178
825 Ga0495672_0001659
826 Ga0495672_0007797
827 Ga0495672_0008194
828 Ga0495676_0013666
829 Ga0495680_0012771
830 Ga0495680_0302837
831 Ga0495683_0006353
832 Ga0495683_0018861
833 Ga0495683_0155670
834 Ga0495687_000013
835 Ga0495687_000280
836 Ga0495687_000337
837 Ga0495675_0001600
838 Ga0495675_0058743
839 Ga0495675_0129774
840 Ga0495675_0136480
841 Ga0495675_0149395
842 Ga0495675_0176069
843 Ga0495677_0000041
844 Ga0495677_0000104
845 Ga0495677_0000925
846 Ga0495677_0004477
847 Ga0495677_0005455
848 Ga0495677_0022940
849 Ga0495679_030828
850 Ga0495685_007067
851 Ga0495681_0000667
852 Ga0495681_0000815
853 Ga0495681_0029032
854 Ga0495686_0000656
855 Ga0495593_0012889
856 Ga0495593_0032009
857 Ga0495593_0041624
858 Ga0495602_0008084
859 Ga0495602_0087835
860 Ga0495602_0145995
861 Ga0495614_0013115
862 Ga0495614_0031697
863 Ga0495626_0000003
864 Ga0495626_0000383
865 Ga0495626_0000478
866 Ga0495626_0003588
867 Ga0495626_0004649
868 Ga0495626_0005710
869 Ga0495626_0006035
870 Ga0495626_0007698
871 Ga0495626_0029701
872 Ga0496100_0394876
873 Ga0496101_0128191
874 Ga0496101_0357714
875 Ga0496102_0120884
876 Ga0496103_0337555
877 Ga0496104_0525833
878 Ga0496105_0174773
879 Ga0496106_0009983
880 Ga0496106_0369326
881 Ga0496107_0566928
882 Ga0496107_0575200
883 Ga0496109_0009157
884 Ga0496109_0356571
885 Ga0496110_0000068
886 Ga0496110_0150029
887 Ga0496110_0299972
888 Ga0496111_0009513
889 Ga0496113_0006466
890 Ga0496113_0146283
891 Ga0496114_0038094
892 Ga0496115_0138120
893 Ga0496115_0319771
894 Ga0496122_0000445
895 Ga0496122_0001558
896 Ga0496122_0023667
897 Ga0496122_0100999
898 Ga0496123_0001531
899 Ga0496123_0020515
900 Ga0496123_0170610
901 Ga0496124_0012065
902 Ga0496124_0018475
903 Ga0496124_0031219
904 Ga0496124_0194656
905 Ga0496124_0216952
906 Ga0496124_0422873
907 Ga0496125_0002859
908 Ga0496125_0093728
909 Ga0496126_0084087
910 Ga0495678_000316
911 Ga0495678_001703
912 Ga0495678_050832
913 Ga0495682_0000107
914 Ga0501035_0003556
915 Ga0466962_0010024
916 2597032385
917 2599621544
918 2599670772
919 2599679262
920 2599691055
921 2643798107
922 2644358200
923 2644473285
924 2738883535
925 2809144570
926 2838058149
927 2858691479
928 2885268790
929 2899929139
930 2919706771
931 2928040426
932 2928046825
933 2928057987
934 2928067673
935 2928072206
936 8047678121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09186

DUF1949

Domain of unknown function (DUF1949)

170

225

0.98

PF01205

UPF0029

Uncharacterized protein family UPF0029

52

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.9139 3 193
2cve-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein tt1547 from thermus thermophilus hb8 0.9049 3 193
7oya-assembly1.cif.gz_v2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.8704 131 193
4wk3-assembly1.cif.gz_A structure of staphyloccus aureus psta 0.8447 129 193
4ro5-assembly1.cif.gz_A crystal structure of the sat domain from the non-reducing fungal polyketide synthase cazm 0.8254 129 193
ID Description Score Start End Superfamily
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9433 1 124 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9416 3 126 3.30.230.30
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9358 1 125 3.30.230.30
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.927 3 126 3.30.230.30
2wbmB03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9262 128 193 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A4Y6KQ28-F1-model_v4 IMPACT family protein 0.9725 1 194 GO:0005737
GO:0006446
GO:0017111
AF-C9YG92-F1-model_v4 IMPACT family member YigZ 0.9711 1 201 GO:0005737
GO:0006446
GO:0016805
GO:0017111
AF-B2JNM8-F1-model_v4 Impact N-terminal domain-containing protein 0.9626 2 195 GO:0005737
GO:0006446
GO:0017111
AF-C9YG92-F1-model_v4 IMPACT family member YigZ 0.9617 1 201 GO:0005737
GO:0006446
GO:0016805
GO:0017111
AF-A0A7C6L6S6-F1-model_v4 YigZ family protein 0.957 2 124 GO:0005737
GO:0006446

Map