F450096

General Info

Members Datasets Scaffolds Average Seq Length
468 227 437 141

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_003399|Ga0495617_003399_1928_2410
Length 160
Sequence MLPISAARWFSVEEQSMSNFLKCGTQYSDIRVGDQIPLLQLPAINRTTLALYCGASGDHNPIHVDIDFARKARMPDVFAHGMLSAAYLGRLLTNWVPQRQIRSLSMRFTGITQLAHVPTCSGTIAEKFEVDGEQCVRIDITCSNQYGEEKLAGSAVVALA

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2511231012 Pseudomonas sp. GM33 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2842677519 Variovorax sp. R-72495 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
14 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
15 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
16 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
17 2922425934
18 2929520902 Variovorax beijingensis 502 Isolate Unclassified
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
21 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
22 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
23 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
115 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
116 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
223 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
224 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
225 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
226 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
227 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.15
Metatranscriptomes 0.43
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 4.49
Rhizoplane 2.35
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10009599 3300003187 Bacteria 4566
2 JGI25151J46595_10011923 3300003187 Bacteria 3972
3 Ga0055536_1001294 3300003781 Bacteria 15390
4 Ga0055540_1000345 3300003792 Bacteria 39481
5 Ga0058862_12569811 3300004803 Bacteria 719
6 Ga0065714_10198798 3300005288 Bacteria 902
7 Ga0070683_100098018 3300005329 Bacteria 2758
8 Ga0070660_100121923 3300005339 Bacteria 2081
9 Ga0070661_100075820 3300005344 Bacteria 2478
10 Ga0070688_100970854 3300005365 Bacteria 673
11 Ga0070714_100621841 3300005435 Bacteria 1038
12 Ga0070700_100484547 3300005441 Bacteria 948
13 Ga0070708_100274268 3300005445 Bacteria 1586
14 Ga0070698_101192508 3300005471 Unclassified 710
15 Ga0070679_101131959 3300005530 Bacteria 728
16 Ga0068853_100309315 3300005539 Bacteria 1462
17 Ga0070665_101305170 3300005548 Bacteria 736
18 Ga0070664_100609921 3300005564 Bacteria 1012
19 Ga0068857_100272123 3300005577 Bacteria 1557
20 Ga0068856_100333176 3300005614 Bacteria 1535
21 Ga0068858_100266709 3300005842 Bacteria 1628
22 Ga0068862_101887169 3300005844 Bacteria 607
23 Ga0081540_1225300 3300005983 Bacteria 665
24 Ga0075363_100104680 3300006048 Bacteria 1569
25 Ga0075364_10365582 3300006051 Bacteria 984
26 Ga0075432_10000214 3300006058 Bacteria 15312
27 Ga0075432_10001184 3300006058 Bacteria 8358
28 Ga0075432_10003756 3300006058 Bacteria 5170
29 Ga0075432_10095642 3300006058 Bacteria 1092
30 Ga0075432_10137387 3300006058 Bacteria 930
31 Ga0075362_10278573 3300006177 Bacteria 827
32 Ga0075367_10009763 3300006178 Bacteria 5027
33 Ga0075366_10034214 3300006195 Bacteria 2993
34 Ga0075370_10209801 3300006353 Bacteria 1150
35 Ga0075436_100044449 3300006914 Bacteria 3063
36 Ga0075436_100301186 3300006914 Bacteria 1149
37 Ga0099826_10000019 3300006948 Bacteria 188386
38 Ga0105251_10040646 3300009011 Bacteria 2267
39 Ga0105251_10062967 3300009011 Bacteria 1741
40 Ga0105238_10354286 3300009551 Bacteria 1457
41 Ga0105239_11839146 3300010375 Bacteria 702
42 Ga0157370_10029610 3300013104 Bacteria 5370
43 Ga0157370_10102314 3300013104 Bacteria 2682
44 Ga0157370_10131701 3300013104 Bacteria 2332
45 Ga0157369_10186018 3300013105 Bacteria 2184
46 Ga0163162_10679517 3300013306 Bacteria 1152
47 Ga0157372_10225490 3300013307 Bacteria 2172
48 Ga0157379_10520944 3300014968 Bacteria 1104
49 Ga0182005_1165969 3300015265 Bacteria 649
50 Ga0163161_10000380 3300017792 Bacteria 37264
51 Ga0163161_10000896 3300017792 Bacteria 23138
52 Ga0206356_10209771 3300020070 Bacteria 942
53 Ga0213872_10001554 3300021361 Bacteria 14701
54 Ga0213876_10002998 3300021384 Bacteria 9772
55 Ga0209676_1000340 3300025292 Bacteria 88869
56 Ga0209676_1001672 3300025292 Bacteria 19258
57 Ga0209025_1000113 3300025294 Bacteria 218943
58 Ga0209025_1001936 3300025294 Bacteria 23930
59 Ga0209050_1000708 3300025298 Bacteria 49399
60 Ga0209256_1094345 3300025299 Bacteria 630
61 Ga0209051_1000256 3300025303 Bacteria 88869
62 Ga0209051_1002086 3300025303 Bacteria 15073
63 Ga0209051_1041855 3300025303 Bacteria 1625
64 Ga0209257_1006802 3300025304 Bacteria 7192
65 Ga0207713_1033603 3300025735 Bacteria 2238
66 Ga0207682_10168214 3300025893 Bacteria 996
67 Ga0207692_10506347 3300025898 Bacteria 767
68 Ga0207671_10499401 3300025914 Bacteria 970
69 Ga0207652_10417393 3300025921 Bacteria 1210
70 Ga0207706_10074972 3300025933 Bacteria 2975
71 Ga0207667_10637485 3300025949 Bacteria 1072
72 Ga0207639_11061864 3300026041 Bacteria 759
73 Ga0207702_10081208 3300026078 Bacteria 2815
74 Ga0207674_10377654 3300026116 Bacteria 1370
75 Ga0207698_10349233 3300026142 Bacteria 1396
76 Ga0209282_1000089 3300027666 Bacteria 65948
77 Ga0207428_10004889 3300027907 Bacteria 12625
78 Ga0207428_10084579 3300027907 Bacteria 2472
79 Ga0207428_10095065 3300027907 Bacteria 2309
80 Ga0207428_10486003 3300027907 Bacteria 898
81 Ga0268266_10204160 3300028379 Bacteria 1810
82 Ga0316176_1061506 3300030732 Bacteria 1491
83 Ga0314311_1262448 3300030733 Bacteria 4221
84 Ga0265328_10098412 3300031239 Bacteria 1083
85 Ga0265327_10000049 3300031251 Bacteria 268046
86 Ga0307408_100001756 3300031548 Bacteria 15810
87 Ga0307408_100026766 3300031548 Bacteria 3966
88 Ga0265342_10298404 3300031712 Bacteria 849
89 Ga0307413_10104169 3300031824 Bacteria 1883
90 Ga0307410_10793098 3300031852 Bacteria 805
91 Ga0307412_10000544 3300031911 Bacteria 22438
92 Ga0307412_10079646 3300031911 Bacteria 2260
93 Ga0307412_10621879 3300031911 Bacteria 917
94 Ga0307412_11056225 3300031911 Bacteria 720
95 Ga0307416_100754471 3300032002 Bacteria 1066
96 Ga0307414_10027598 3300032004 Bacteria 3671
97 Ga0307411_10007321 3300032005 Bacteria 5607
98 Ga0307411_11746800 3300032005 Bacteria 577
99 Ga0307510_10370936 3300033180 Bacteria 878
100 Ga0373951_0028031 3300035091 Bacteria 1318
101 Ga0373952_0290728 3300035092 Bacteria 506
102 Ga0373942_0037292 3300035207 Bacteria 1313
103 Ga0373962_0226890 3300035242 Bacteria 641
104 Ga0373931_0181036 3300035691 Bacteria 1248
105 Ga0395899_0263437 3300037312 Bacteria 1178
106 Ga0395900_0067352 3300037418 Bacteria 3678
107 Ga0395901_0034150 3300038443 Bacteria 5252
108 Ga0395901_0817661 3300038443 Bacteria 919
109 Ga0436365_0411002 3300039437 Bacteria 12397
110 Ga0436361_0464788 3300039447 Bacteria 45703
111 Ga0439438_000023 3300041405 Bacteria 101913
112 Ga0439466_0218843 3300041411 Bacteria 578
113 Ga0451807_1368793 3300041486 Bacteria 596
114 Ga0450898_003935 3300042134 Bacteria 2167
115 Ga0450907_000002 3300042146 Bacteria 147876
116 Ga0450910_010284 3300042147 Bacteria 1330
117 Ga0450908_001036 3300042184 Bacteria 5388
118 Ga0466969_0075139 3300044656 Bacteria 1620
119 Ga0466966_0112459 3300044684 Bacteria 1678
120 Ga0466966_0745685 3300044684 Bacteria 590
121 Ga0453684_0301885 3300044712 Bacteria 1820
122 Ga0453684_1064932 3300044712 Bacteria 856
123 Ga0451576_0646634 3300045051 Bacteria 1111
124 Ga0495617_003399 3300046452 Bacteria 5998
125 Ga0495617_005320 3300046452 Bacteria 4581
126 Ga0495617_007139 3300046452 Bacteria 3893
127 Ga0495627_001125 3300046453 Bacteria 17345
128 Ga0495627_010097 3300046453 Bacteria 3448
129 Ga0495592_0122808 3300046454 Bacteria 1825
130 Ga0495592_0266133 3300046454 Bacteria 1127
131 Ga0495590_0005623 3300046457 Bacteria 4941
132 Ga0495590_0031606 3300046457 Bacteria 1853
133 Ga0495591_000005 3300046458 Bacteria 394092
134 Ga0495591_000008 3300046458 Bacteria 353558
135 Ga0495591_000295 3300046458 Bacteria 45438
136 Ga0495591_000696 3300046458 Bacteria 24525
137 Ga0495591_019320 3300046458 Bacteria 2284
138 Ga0495591_034732 3300046458 Bacteria 1481
139 Ga0495638_0001749 3300046460 Bacteria 19034
140 Ga0495638_0001830 3300046460 Bacteria 18455
141 Ga0495638_0002584 3300046460 Bacteria 14632
142 Ga0495638_0006732 3300046460 Bacteria 8325
143 Ga0495638_0009617 3300046460 Bacteria 6766
144 Ga0495638_0010021 3300046460 Bacteria 6606
145 Ga0495638_0020339 3300046460 Bacteria 4385
146 Ga0495638_0021079 3300046460 Bacteria 4298
147 Ga0495638_0125770 3300046460 Bacteria 1511
148 Ga0495638_0295962 3300046460 Bacteria 874
149 Ga0495651_0221996 3300046462 Bacteria 1307
150 Ga0495650_0001509 3300046471 Bacteria 22156
151 Ga0495650_0002107 3300046471 Bacteria 17066
152 Ga0495650_0003557 3300046471 Bacteria 11276
153 Ga0495650_0007468 3300046471 Bacteria 6561
154 Ga0495650_0047402 3300046471 Bacteria 1797
155 Ga0495650_0070265 3300046471 Bacteria 1375
156 Ga0495605_0000172 3300046474 Bacteria 81898
157 Ga0495605_0003016 3300046474 Bacteria 10159
158 Ga0495605_0012849 3300046474 Bacteria 4634
159 Ga0495605_0014491 3300046474 Bacteria 4317
160 Ga0495605_0017997 3300046474 Bacteria 3795
161 Ga0495664_0061531 3300046477 Bacteria 2235
162 Ga0495664_0124261 3300046477 Bacteria 1561
163 Ga0495584_0000292 3300046491 Bacteria 35381
164 Ga0495584_0001971 3300046491 Bacteria 11808
165 Ga0495584_0030834 3300046491 Bacteria 2715
166 Ga0495584_0072149 3300046491 Bacteria 1735
167 Ga0495584_0118718 3300046491 Bacteria 1339
168 Ga0495585_0000066 3300046492 Bacteria 108675
169 Ga0495585_0205715 3300046492 Bacteria 1000
170 Ga0495585_0233134 3300046492 Bacteria 924
171 Ga0495596_0000005 3300046500 Bacteria 163644
172 Ga0495596_0000121 3300046500 Bacteria 53954
173 Ga0495607_0001187 3300046501 Bacteria 23544
174 Ga0495607_0003750 3300046501 Bacteria 11495
175 Ga0495607_0004735 3300046501 Bacteria 9946
176 Ga0495607_0042776 3300046501 Bacteria 2683
177 Ga0495607_0110598 3300046501 Bacteria 1457
178 Ga0495607_0110700 3300046501 Bacteria 1456
179 Ga0495606_0000499 3300046507 Bacteria 64051
180 Ga0495606_0000653 3300046507 Bacteria 54596
181 Ga0495606_0001641 3300046507 Bacteria 29153
182 Ga0495606_0001766 3300046507 Bacteria 27713
183 Ga0495606_0030802 3300046507 Bacteria 3740
184 Ga0495606_0048287 3300046507 Bacteria 2801
185 Ga0495610_0000387 3300046512 Bacteria 45513
186 Ga0495610_0000831 3300046512 Bacteria 28892
187 Ga0495610_0002780 3300046512 Bacteria 14328
188 Ga0495610_0027401 3300046512 Bacteria 3028
189 Ga0495610_0054155 3300046512 Bacteria 1939
190 Ga0495610_0059592 3300046512 Bacteria 1821
191 Ga0495610_0060209 3300046512 Bacteria 1809
192 Ga0495610_0076070 3300046512 Bacteria 1553
193 Ga0495616_0000740 3300046513 Bacteria 23933
194 Ga0495616_0001812 3300046513 Bacteria 14475
195 Ga0495616_0002147 3300046513 Bacteria 13199
196 Ga0495616_0016627 3300046513 Bacteria 4068
197 Ga0495616_0017749 3300046513 Bacteria 3920
198 Ga0495616_0021295 3300046513 Bacteria 3511
199 Ga0495616_0082343 3300046513 Bacteria 1537
200 Ga0495620_0000179 3300046515 Bacteria 49534
201 Ga0495620_0001153 3300046515 Bacteria 16183
202 Ga0495620_0003660 3300046515 Bacteria 8773
203 Ga0495620_0241052 3300046515 Bacteria 690
204 Ga0495628_0406504 3300046516 Bacteria 994
205 Ga0495631_0009572 3300046518 Bacteria 4836
206 Ga0495631_0012015 3300046518 Bacteria 4243
207 Ga0495631_0455929 3300046518 Bacteria 544
208 Ga0495632_0000816 3300046519 Bacteria 27536
209 Ga0495632_0001038 3300046519 Bacteria 23967
210 Ga0495632_0002339 3300046519 Bacteria 14538
211 Ga0495632_0002393 3300046519 Bacteria 14306
212 Ga0495632_0002403 3300046519 Bacteria 14272
213 Ga0495632_0003324 3300046519 Bacteria 11468
214 Ga0495632_0003434 3300046519 Bacteria 11246
215 Ga0495632_0004837 3300046519 Bacteria 9045
216 Ga0495632_0012693 3300046519 Bacteria 4844
217 Ga0495632_0017172 3300046519 Bacteria 4003
218 Ga0495632_0022756 3300046519 Bacteria 3355
219 Ga0495632_0027631 3300046519 Bacteria 2970
220 Ga0495632_0034588 3300046519 Bacteria 2584
221 Ga0495632_0044971 3300046519 Bacteria 2201
222 Ga0495632_0053271 3300046519 Bacteria 1987
223 Ga0495632_0136780 3300046519 Bacteria 1138
224 Ga0495637_0000272 3300046520 Bacteria 40775
225 Ga0495637_0000274 3300046520 Bacteria 40500
226 Ga0495637_0000316 3300046520 Bacteria 37501
227 Ga0495637_0000512 3300046520 Bacteria 28203
228 Ga0495637_0000707 3300046520 Bacteria 22862
229 Ga0495637_0001329 3300046520 Bacteria 14824
230 Ga0495637_0003120 3300046520 Bacteria 8842
231 Ga0495637_0004388 3300046520 Bacteria 7318
232 Ga0495637_0015421 3300046520 Bacteria 3582
233 Ga0495637_0027120 3300046520 Bacteria 2565
234 Ga0495637_0044766 3300046520 Bacteria 1882
235 Ga0495643_0036032 3300046522 Bacteria 2720
236 Ga0495643_0044708 3300046522 Bacteria 2405
237 Ga0495643_0095023 3300046522 Bacteria 1533
238 Ga0495643_0112871 3300046522 Bacteria 1380
239 Ga0495643_0145242 3300046522 Bacteria 1179
240 Ga0495644_0000996 3300046523 Bacteria 11795
241 Ga0495644_0003975 3300046523 Bacteria 5811
242 Ga0495648_0011512 3300046524 Bacteria 6654
243 Ga0495648_0012357 3300046524 Bacteria 6378
244 Ga0495648_0095186 3300046524 Bacteria 1657
245 Ga0495648_0103284 3300046524 Bacteria 1568
246 Ga0495648_0130436 3300046524 Bacteria 1337
247 Ga0495652_0202197 3300046529 Bacteria 1507
248 Ga0495654_0000188 3300046530 Bacteria 60499
249 Ga0495654_0000594 3300046530 Bacteria 28944
250 Ga0495654_0001247 3300046530 Bacteria 17980
251 Ga0495654_0003593 3300046530 Bacteria 9440
252 Ga0495654_0007877 3300046530 Bacteria 5924
253 Ga0495654_0008246 3300046530 Bacteria 5765
254 Ga0495654_0011224 3300046530 Bacteria 4858
255 Ga0495654_0026722 3300046530 Bacteria 2965
256 Ga0495654_0099276 3300046530 Bacteria 1342
257 Ga0495665_0320357 3300046531 Bacteria 792
258 Ga0495586_0127143 3300046535 Bacteria 1426
259 Ga0495609_0002196 3300046538 Bacteria 12247
260 Ga0495597_0002541 3300046542 Bacteria 11447
261 Ga0495597_0003005 3300046542 Bacteria 10177
262 Ga0495597_0006945 3300046542 Bacteria 5803
263 Ga0495597_0009802 3300046542 Bacteria 4714
264 Ga0495597_0011533 3300046542 Bacteria 4282
265 Ga0495597_0024974 3300046542 Bacteria 2754
266 Ga0495597_0034609 3300046542 Bacteria 2282
267 Ga0495597_0060793 3300046542 Bacteria 1647
268 Ga0495597_0157084 3300046542 Bacteria 930
269 Ga0495597_0199671 3300046542 Bacteria 801
270 Ga0495597_0248502 3300046542 Bacteria 699
271 Ga0495645_0027537 3300046543 Bacteria 4130
272 Ga0495622_0028545 3300046557 Bacteria 2606
273 Ga0495633_0000200 3300046558 Bacteria 76743
274 Ga0495633_0014618 3300046558 Bacteria 4095
275 Ga0495633_0358404 3300046558 Bacteria 660
276 Ga0495656_0113384 3300046615 Bacteria 1271
277 Ga0495656_0122924 3300046615 Bacteria 1227
278 Ga0495656_0808745 3300046615 Bacteria 507
279 Ga0495668_0000747 3300046616 Bacteria 38584
280 Ga0495625_0001493 3300046660 Bacteria 28141
281 Ga0495625_0004937 3300046660 Bacteria 12403
282 Ga0495625_0008118 3300046660 Bacteria 8996
283 Ga0495625_0011124 3300046660 Bacteria 7367
284 Ga0495625_0046831 3300046660 Bacteria 3118
285 Ga0495625_0083297 3300046660 Bacteria 2223
286 Ga0495625_0583880 3300046660 Bacteria 673
287 Ga0495659_0548253 3300046664 Bacteria 510
288 Ga0495661_0005395 3300046665 Bacteria 9089
289 Ga0495661_0008842 3300046665 Bacteria 6944
290 Ga0495661_0009271 3300046665 Bacteria 6760
291 Ga0495661_0012634 3300046665 Bacteria 5699
292 Ga0495661_0013878 3300046665 Bacteria 5405
293 Ga0495661_0026163 3300046665 Bacteria 3760
294 Ga0495661_0086421 3300046665 Bacteria 1795
295 Ga0495661_0190787 3300046665 Bacteria 1079
296 Ga0495599_0014722 3300046678 Bacteria 4844
297 Ga0495670_0001203 3300046691 Bacteria 12580
298 Ga0495670_0012449 3300046691 Bacteria 4183
299 Ga0495670_0034441 3300046691 Bacteria 2522
300 Ga0495670_0341503 3300046691 Bacteria 805
301 Ga0495671_0000968 3300046692 Bacteria 20106
302 Ga0495671_0006856 3300046692 Bacteria 6545
303 Ga0495671_0007557 3300046692 Bacteria 6183
304 Ga0495671_0010048 3300046692 Bacteria 5263
305 Ga0495671_0032657 3300046692 Bacteria 2656
306 Ga0495671_0037228 3300046692 Bacteria 2461
307 Ga0495671_0042864 3300046692 Bacteria 2273
308 Ga0495671_0081501 3300046692 Bacteria 1585
309 Ga0495671_0198870 3300046692 Bacteria 972
310 Ga0495671_0503192 3300046692 Bacteria 578
311 Ga0495649_0000039 3300046694 Bacteria 126399
312 Ga0495649_0000509 3300046694 Bacteria 33271
313 Ga0495649_0001319 3300046694 Bacteria 18924
314 Ga0495649_0001708 3300046694 Bacteria 16282
315 Ga0495649_0005218 3300046694 Bacteria 8314
316 Ga0495649_0030991 3300046694 Bacteria 2950
317 Ga0495649_0052648 3300046694 Bacteria 2205
318 Ga0495649_0064188 3300046694 Bacteria 1972
319 Ga0495649_0083687 3300046694 Bacteria 1704
320 Ga0495649_0207967 3300046694 Bacteria 1014
321 Ga0495589_0002194 3300046794 Bacteria 10983
322 Ga0495589_0020339 3300046794 Bacteria 3395
323 Ga0495589_0092412 3300046794 Bacteria 1469
324 Ga0495589_0111929 3300046794 Bacteria 1317
325 Ga0495589_0140059 3300046794 Bacteria 1159
326 Ga0495589_0454154 3300046794 Bacteria 586
327 Ga0495660_0001386 3300046810 Bacteria 16654
328 Ga0495660_0002375 3300046810 Bacteria 12032
329 Ga0495660_0004394 3300046810 Bacteria 8538
330 Ga0495660_0014734 3300046810 Bacteria 4522
331 Ga0495660_0060867 3300046810 Bacteria 2026
332 Ga0495660_0176297 3300046810 Bacteria 1037
333 Ga0495636_0000803 3300047318 Bacteria 11559
334 Ga0495672_0000746 3300047320 Bacteria 35662
335 Ga0495672_0011215 3300047320 Bacteria 6335
336 Ga0495672_0018258 3300047320 Bacteria 4666
337 Ga0495672_0286945 3300047320 Bacteria 784
338 Ga0495680_0777872 3300047322 Bacteria 627
339 Ga0495683_0000065 3300047323 Bacteria 112239
340 Ga0495683_0009899 3300047323 Bacteria 5063
341 Ga0495683_0034413 3300047323 Bacteria 2576
342 Ga0495687_001323 3300047443 Bacteria 23117
343 Ga0495677_0137455 3300047445 Bacteria 937
344 Ga0495679_000408 3300047446 Bacteria 32211
345 Ga0495679_000534 3300047446 Bacteria 26701
346 Ga0495679_002876 3300047446 Bacteria 8529
347 Ga0495685_013445 3300047447 Bacteria 2779
348 Ga0495673_0000145 3300047469 Bacteria 127538
349 Ga0495673_0000315 3300047469 Bacteria 62914
350 Ga0495673_0000452 3300047469 Bacteria 44965
351 Ga0495673_0002936 3300047469 Bacteria 11512
352 Ga0495673_0027366 3300047469 Bacteria 2715
353 Ga0495673_0035483 3300047469 Bacteria 2297
354 Ga0495673_0125307 3300047469 Bacteria 1013
355 Ga0495681_0000150 3300047470 Bacteria 58890
356 Ga0495681_0000314 3300047470 Bacteria 38680
357 Ga0495681_0000502 3300047470 Bacteria 29944
358 Ga0495681_0000701 3300047470 Bacteria 25593
359 Ga0495681_0004176 3300047470 Bacteria 9920
360 Ga0495681_0005453 3300047470 Bacteria 8506
361 Ga0495681_0005941 3300047470 Bacteria 8098
362 Ga0495681_0007237 3300047470 Bacteria 7133
363 Ga0495681_0020320 3300047470 Bacteria 3606
364 Ga0495681_0020872 3300047470 Bacteria 3543
365 Ga0495681_0027780 3300047470 Bacteria 2922
366 Ga0495681_0027894 3300047470 Bacteria 2915
367 Ga0495681_0058853 3300047470 Bacteria 1778
368 Ga0495681_0148691 3300047470 Bacteria 984
369 Ga0495686_0000925 3300047472 Bacteria 36616
370 Ga0495686_0001289 3300047472 Bacteria 28262
371 Ga0495686_0005785 3300047472 Bacteria 9650
372 Ga0495686_0008100 3300047472 Bacteria 7771
373 Ga0495686_0228251 3300047472 Bacteria 1056
374 Ga0495686_0565635 3300047472 Bacteria 592
375 Ga0495626_0000100 3300048091 Bacteria 110337
376 Ga0495626_0000275 3300048091 Bacteria 56570
377 Ga0495626_0000472 3300048091 Bacteria 40984
378 Ga0495626_0000505 3300048091 Bacteria 39189
379 Ga0495626_0002983 3300048091 Bacteria 11213
380 Ga0495626_0021944 3300048091 Bacteria 3159
381 Ga0495626_0105867 3300048091 Bacteria 1222
382 Ga0496101_0348873 3300048904 Bacteria 1163
383 Ga0496102_0195274 3300048905 Bacteria 1907
384 Ga0496104_0421855 3300048907 Bacteria 1246
385 Ga0496105_1115604 3300048908 Bacteria 585
386 Ga0496108_0099993 3300048911 Bacteria 2473
387 Ga0496109_1194418 3300048912 Bacteria 697
388 Ga0496110_0038911 3300048913 Bacteria 4140
389 Ga0496111_0058195 3300048914 Bacteria 2798
390 Ga0496113_0946974 3300048916 Bacteria 680
391 Ga0496116_0010412 3300048919 Bacteria 7793
392 Ga0496116_0013799 3300048919 Bacteria 6488
393 Ga0496117_0318335 3300048920 Bacteria 816
394 Ga0496118_0124093 3300048921 Bacteria 1676
395 Ga0496121_0001338 3300048924 Bacteria 42197
396 Ga0496121_0108100 3300048924 Bacteria 2128
397 Ga0496122_0000224 3300048925 Bacteria 126514
398 Ga0496122_0000930 3300048925 Bacteria 53414
399 Ga0496123_0000187 3300048926 Bacteria 125396
400 Ga0496123_0000369 3300048926 Bacteria 84409
401 Ga0496124_0006699 3300048927 Bacteria 12470
402 Ga0496124_0192613 3300048927 Bacteria 1558
403 Ga0496124_0473602 3300048927 Bacteria 847
404 Ga0496125_0036161 3300048928 Bacteria 4317
405 Ga0496125_0093898 3300048928 Bacteria 2237
406 Ga0496126_0079746 3300048929 Bacteria 2898
407 Ga0495678_000173 3300049459 Bacteria 74788
408 Ga0495678_000417 3300049459 Bacteria 42853
409 Ga0495678_025599 3300049459 Bacteria 2531
410 Ga0495678_051577 3300049459 Bacteria 1589
411 Ga0495678_067284 3300049459 Bacteria 1324
412 Ga0495682_0061716 3300049460 Bacteria 1353
413 Ga0501033_0453072 3300049570 Bacteria 891
414 Ga0501034_0010940 3300049571 Bacteria 9428
415 Ga0501038_0443849 3300049574 Bacteria 999
416 Ga0501039_0330008 3300049575 Bacteria 1199
417 Ga0501043_0371549 3300049579 Bacteria 1084
418 Ga0501047_0912429 3300049581 Bacteria 692
419 Ga0501207_014895 3300049654 Bacteria 1192
420 Ga0501225_0136526 3300049705 Bacteria 738
421 Ga0501225_0305829 3300049705 Bacteria 539
422 Ga0501044_0330139 3300049823 Bacteria 1448
423 nmdc:mga03683_85061_c1 3300050489 Bacteria 1371
424 nmdc:mga03n38_13658_c1 3300050490 Bacteria 3091
425 nmdc:mga0k408_38291_c1 3300050493 Bacteria 2752
426 nmdc:mga06z11_1035_c1 3300050494 Bacteria 10129
427 nmdc:mga04h51_111751_c1 3300050495 Bacteria 1008
428 nmdc:mga07m45_11567_c1 3300050496 Bacteria 768
429 nmdc:mga07m45_9844_c1 3300050496 Bacteria 4973
430 nmdc:mga0qj67_110156_c1 3300050509 Bacteria 2222
431 nmdc:mga0n895_1135331_c1 3300050512 Bacteria 757
432 nmdc:mga08x19_109423_c1 3300050514 Bacteria 1842
433 Ga0495612_0391583 3300053078 Bacteria 631
434 Ga0500610_0207758 3300053079 Bacteria 938
435 Ga0500658_0124302 3300053134 Bacteria 1146
436 Ga0500568_0044227 3300053139 Bacteria 1777
437 Ga0590075_040983 3300059424 Bacteria 1184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0503192 Ga0495671_0503192_26_397 123
2 3300048928 Ga0496125_0093898 Ga0496125_0093898_16_465 127
3 iso_pu_bacteria 2513237137 2513855489 130
4 iso_pu_bacteria 2517572143 2517892037 130
5 iso_pu_bacteria 2667528175 2671121925 130
6 iso_pu_bacteria 2903748898 2903753787 130
7 iso_pu_bacteria 2906635258 2906639226 130
8 iso_pu_bacteria 2906660503 2906662425 130
9 iso_pu_bacteria 3005474847 3005480584 130
10 3300048904 Ga0496101_0348873 Ga0496101_0348873_701_1150 131
11 3300048925 Ga0496122_0000224 Ga0496122_0000224_85933_86382 131
12 3300048926 Ga0496123_0000187 Ga0496123_0000187_15625_16074 131
13 iso_pu_bacteria 2513237145 2513918789 131
14 iso_pu_bacteria 2728368998 2728753024 131
15 iso_pu_bacteria 2791355197 2793068888 131
16 iso_pu_bacteria 2922425934 2922430673 131
17 iso_pu_bacteria 2935630451 2935636382 131
18 iso_pu_bacteria 2941507105 2941509908 131
19 iso_pu_bacteria 2941515067 2941520848 131
20 iso_pu_bacteria 2941523033 2941525307 131
21 iso_pu_bacteria 8006933436 8006940190 131
22 iso_pu_bacteria 8006973647 8006979971 131
23 iso_pu_bacteria 8019555841 8019556166 131
24 iso_pu_bacteria 8019565922 8019569140 131
25 3300005441 Ga0070700_100484547 Ga0070700_1004845472 132
26 3300005548 Ga0070665_101305170 Ga0070665_1013051702 132
27 3300005983 Ga0081540_1225300 Ga0081540_12253002 132
28 3300006048 Ga0075363_100104680 Ga0075363_1001046802 132
29 3300006178 Ga0075367_10009763 Ga0075367_100097632 132
30 3300006353 Ga0075370_10209801 Ga0075370_102098013 132
31 3300028379 Ga0268266_10204160 Ga0268266_102041603 132
32 3300033180 Ga0307510_10370936 Ga0307510_103709362 132
33 3300046460 Ga0495638_0125770 Ga0495638_0125770_819_1217 132
34 3300047472 Ga0495686_0228251 Ga0495686_0228251_111_509 132
35 3300050490 nmdc:mga03n38_13658_c1 nmdc:mga03n38_13658_c1_330_728 132
36 3300050494 nmdc:mga06z11_1035_c1 nmdc:mga06z11_1035_c1_3851_4249 132
37 3300050495 nmdc:mga04h51_111751_c1 nmdc:mga04h51_111751_c1_283_681 132
38 3300050496 nmdc:mga07m45_11567_c1 nmdc:mga07m45_11567_c1_172_570 132
39 3300053079 Ga0500610_0207758 Ga0500610_0207758_15_413 132
40 iso_pu_bacteria 2929520902 2929524168 133
41 3300045051 Ga0451576_0646634 Ga0451576_0646634_616_1029 134
42 3300046660 Ga0495625_0001493 Ga0495625_0001493_3174_3581 134
43 3300046694 Ga0495649_0000039 Ga0495649_0000039_49402_49809 134
44 3300048919 Ga0496116_0010412 Ga0496116_0010412_2336_2740 134
45 3300048921 Ga0496118_0124093 Ga0496118_0124093_563_970 134
46 3300048927 Ga0496124_0192613 Ga0496124_0192613_104_508 134
47 3300048928 Ga0496125_0036161 Ga0496125_0036161_3835_4284 134
48 3300005844 Ga0068862_101887169 Ga0068862_1018871692 135
49 iso_pu_bacteria 2511231012 2511303462 135
50 iso_pu_bacteria 2511231021 2511353752 135
51 iso_pu_bacteria 2511231021 2511357360 135
52 iso_pu_bacteria 2858950400 2858954068 135
53 iso_pu_bacteria 2904550169 2904550176 135
54 iso_pu_bacteria 2919704043 2919708764 135
55 iso_pu_bacteria 8011350971 8011353663 135
56 3300031548 Ga0307408_100001756 Ga0307408_1000017565 136
57 3300031548 Ga0307408_100026766 Ga0307408_1000267663 136
58 3300031824 Ga0307413_10104169 Ga0307413_101041693 136
59 3300031911 Ga0307412_10079646 Ga0307412_100796463 136
60 3300031911 Ga0307412_10621879 Ga0307412_106218792 136
61 3300032002 Ga0307416_100754471 Ga0307416_1007544712 136
62 3300032004 Ga0307414_10027598 Ga0307414_100275984 136
63 3300032005 Ga0307411_10007321 Ga0307411_100073213 136
64 3300037312 Ga0395899_0263437 Ga0395899_0263437_59_469 136
65 3300038443 Ga0395901_0817661 Ga0395901_0817661_161_571 136
66 3300042134 Ga0450898_003935 Ga0450898_003935_786_1196 136
67 3300046542 Ga0495597_0011533 Ga0495597_0011533_2277_2687 136
68 3300046615 Ga0495656_0808745 Ga0495656_0808745_49_459 136
69 3300047443 Ga0495687_001323 Ga0495687_001323_14108_14518 136
70 3300048091 Ga0495626_0105867 Ga0495626_0105867_560_970 136
71 3300049654 Ga0501207_014895 Ga0501207_014895_308_718 136
72 3300049705 Ga0501225_0136526 Ga0501225_0136526_170_580 136
73 3300050496 nmdc:mga07m45_9844_c1 nmdc:mga07m45_9844_c1_3915_4325 136
74 3300044712 Ga0453684_1064932 Ga0453684_1064932_127_540 137
75 3300048929 Ga0496126_0079746 Ga0496126_0079746_2168_2602 137
76 3300059424 Ga0590075_040983 Ga0590075_040983_228_644 137
77 iso_pu_bacteria 2511231008 2511275530 137
78 iso_pu_bacteria 2842677519 2842680416 137
79 iso_pu_bacteria 8056177738 8056178227 137
80 3300006051 Ga0075364_10365582 Ga0075364_103655822 138
81 3300006177 Ga0075362_10278573 Ga0075362_102785732 138
82 3300013104 Ga0157370_10029610 Ga0157370_100296102 138
83 3300013306 Ga0163162_10679517 Ga0163162_106795172 138
84 3300017792 Ga0163161_10000896 Ga0163161_100008964 138
85 3300021384 Ga0213876_10002998 Ga0213876_100029985 138
86 3300025299 Ga0209256_1094345 Ga0209256_10943451 138
87 3300031239 Ga0265328_10098412 Ga0265328_100984121 138
88 3300031251 Ga0265327_10000049 Ga0265327_1000004954 138
89 3300035092 Ga0373952_0290728 Ga0373952_0290728_10_426 138
90 3300039437 Ga0436365_0411002 Ga0436365_0411002_4517_4939 138
91 3300044712 Ga0453684_0301885 Ga0453684_0301885_529_963 138
92 3300046452 Ga0495617_005320 Ga0495617_005320_19_492 138
93 3300046457 Ga0495590_0005623 Ga0495590_0005623_1343_1759 138
94 3300046458 Ga0495591_000005 Ga0495591_000005_234597_235013 138
95 3300046458 Ga0495591_000696 Ga0495591_000696_4885_5301 138
96 3300046458 Ga0495591_034732 Ga0495591_034732_919_1335 138
97 3300046460 Ga0495638_0001830 Ga0495638_0001830_5726_6142 138
98 3300046460 Ga0495638_0006732 Ga0495638_0006732_5580_5996 138
99 3300046460 Ga0495638_0010021 Ga0495638_0010021_3295_3711 138
100 3300046471 Ga0495650_0002107 Ga0495650_0002107_623_1039 138
101 3300046471 Ga0495650_0007468 Ga0495650_0007468_1415_1831 138
102 3300046471 Ga0495650_0070265 Ga0495650_0070265_534_950 138
103 3300046474 Ga0495605_0000172 Ga0495605_0000172_65975_66391 138
104 3300046474 Ga0495605_0017997 Ga0495605_0017997_843_1259 138
105 3300046491 Ga0495584_0030834 Ga0495584_0030834_387_803 138
106 3300046491 Ga0495584_0118718 Ga0495584_0118718_387_803 138
107 3300046492 Ga0495585_0233134 Ga0495585_0233134_147_563 138
108 3300046501 Ga0495607_0003750 Ga0495607_0003750_6238_6654 138
109 3300046501 Ga0495607_0042776 Ga0495607_0042776_1111_1527 138
110 3300046507 Ga0495606_0000653 Ga0495606_0000653_42506_42922 138
111 3300046507 Ga0495606_0001641 Ga0495606_0001641_23882_24298 138
112 3300046507 Ga0495606_0001766 Ga0495606_0001766_19_492 138
113 3300046512 Ga0495610_0059592 Ga0495610_0059592_669_1085 138
114 3300046512 Ga0495610_0060209 Ga0495610_0060209_1073_1489 138
115 3300046513 Ga0495616_0017749 Ga0495616_0017749_3044_3460 138
116 3300046513 Ga0495616_0082343 Ga0495616_0082343_882_1298 138
117 3300046515 Ga0495620_0000179 Ga0495620_0000179_33546_33962 138
118 3300046515 Ga0495620_0001153 Ga0495620_0001153_15125_15541 138
119 3300046518 Ga0495631_0009572 Ga0495631_0009572_1985_2401 138
120 3300046518 Ga0495631_0455929 Ga0495631_0455929_107_523 138
121 3300046519 Ga0495632_0001038 Ga0495632_0001038_5223_5639 138
122 3300046519 Ga0495632_0002339 Ga0495632_0002339_9924_10340 138
123 3300046519 Ga0495632_0003434 Ga0495632_0003434_4973_5389 138
124 3300046519 Ga0495632_0012693 Ga0495632_0012693_3311_3727 138
125 3300046519 Ga0495632_0017172 Ga0495632_0017172_581_997 138
126 3300046519 Ga0495632_0053271 Ga0495632_0053271_1559_1975 138
127 3300046520 Ga0495637_0000316 Ga0495637_0000316_21557_21973 138
128 3300046520 Ga0495637_0001329 Ga0495637_0001329_7402_7818 138
129 3300046520 Ga0495637_0004388 Ga0495637_0004388_5345_5761 138
130 3300046520 Ga0495637_0044766 Ga0495637_0044766_819_1235 138
131 3300046523 Ga0495644_0003975 Ga0495644_0003975_4380_4796 138
132 3300046524 Ga0495648_0011512 Ga0495648_0011512_1884_2300 138
133 3300046530 Ga0495654_0000188 Ga0495654_0000188_37857_38273 138
134 3300046530 Ga0495654_0003593 Ga0495654_0003593_8402_8818 138
135 3300046530 Ga0495654_0007877 Ga0495654_0007877_48_464 138
136 3300046542 Ga0495597_0002541 Ga0495597_0002541_2781_3197 138
137 3300046542 Ga0495597_0034609 Ga0495597_0034609_1658_2074 138
138 3300046542 Ga0495597_0060793 Ga0495597_0060793_725_1141 138
139 3300046558 Ga0495633_0014618 Ga0495633_0014618_1085_1501 138
140 3300046660 Ga0495625_0004937 Ga0495625_0004937_6751_7167 138
141 3300046660 Ga0495625_0046831 Ga0495625_0046831_2565_3038 138
142 3300046660 Ga0495625_0083297 Ga0495625_0083297_1599_2015 138
143 3300046660 Ga0495625_0583880 Ga0495625_0583880_239_655 138
144 3300046665 Ga0495661_0008842 Ga0495661_0008842_4958_5374 138
145 3300046665 Ga0495661_0013878 Ga0495661_0013878_4499_4915 138
146 3300046665 Ga0495661_0026163 Ga0495661_0026163_1046_1462 138
147 3300046665 Ga0495661_0190787 Ga0495661_0190787_356_772 138
148 3300046691 Ga0495670_0001203 Ga0495670_0001203_1110_1526 138
149 3300046692 Ga0495671_0006856 Ga0495671_0006856_5394_5810 138
150 3300046692 Ga0495671_0032657 Ga0495671_0032657_1732_2148 138
151 3300046692 Ga0495671_0081501 Ga0495671_0081501_19_492 138
152 3300046692 Ga0495671_0198870 Ga0495671_0198870_461_877 138
153 3300046694 Ga0495649_0000509 Ga0495649_0000509_14393_14809 138
154 3300046694 Ga0495649_0001708 Ga0495649_0001708_229_645 138
155 3300046694 Ga0495649_0083687 Ga0495649_0083687_539_955 138
156 3300046794 Ga0495589_0140059 Ga0495589_0140059_505_921 138
157 3300046794 Ga0495589_0454154 Ga0495589_0454154_18_491 138
158 3300046810 Ga0495660_0001386 Ga0495660_0001386_10022_10438 138
159 3300046810 Ga0495660_0002375 Ga0495660_0002375_5516_5932 138
160 3300046810 Ga0495660_0004394 Ga0495660_0004394_7347_7763 138
161 3300047320 Ga0495672_0000746 Ga0495672_0000746_16624_17040 138
162 3300047323 Ga0495683_0000065 Ga0495683_0000065_82973_83389 138
163 3300047446 Ga0495679_000408 Ga0495679_000408_14745_15161 138
164 3300047446 Ga0495679_002876 Ga0495679_002876_596_1012 138
165 3300047469 Ga0495673_0000315 Ga0495673_0000315_34314_34730 138
166 3300047469 Ga0495673_0035483 Ga0495673_0035483_122_538 138
167 3300047469 Ga0495673_0125307 Ga0495673_0125307_145_561 138
168 3300047470 Ga0495681_0000150 Ga0495681_0000150_15735_16151 138
169 3300047470 Ga0495681_0000701 Ga0495681_0000701_7643_8059 138
170 3300047470 Ga0495681_0004176 Ga0495681_0004176_3387_3803 138
171 3300047470 Ga0495681_0020320 Ga0495681_0020320_2419_2835 138
172 3300047470 Ga0495681_0058853 Ga0495681_0058853_623_1039 138
173 3300047470 Ga0495681_0148691 Ga0495681_0148691_275_691 138
174 3300047472 Ga0495686_0000925 Ga0495686_0000925_30972_31388 138
175 3300047472 Ga0495686_0005785 Ga0495686_0005785_5716_6132 138
176 3300048091 Ga0495626_0000275 Ga0495626_0000275_38622_39038 138
177 3300048091 Ga0495626_0000472 Ga0495626_0000472_22106_22522 138
178 3300049459 Ga0495678_025599 Ga0495678_025599_1642_2058 138
179 3300049459 Ga0495678_051577 Ga0495678_051577_159_575 138
180 3300049570 Ga0501033_0453072 Ga0501033_0453072_352_768 138
181 3300049574 Ga0501038_0443849 Ga0501038_0443849_123_539 138
182 3300049575 Ga0501039_0330008 Ga0501039_0330008_740_1156 138
183 3300049579 Ga0501043_0371549 Ga0501043_0371549_116_532 138
184 3300049581 Ga0501047_0912429 Ga0501047_0912429_144_560 138
185 3300049823 Ga0501044_0330139 Ga0501044_0330139_274_690 138
186 3300053134 Ga0500658_0124302 Ga0500658_0124302_672_1094 138
187 3300053139 Ga0500568_0044227 Ga0500568_0044227_86_508 138
188 3300003187 JGI25151J46595_10009599 JGI25151J46595_100095992 139
189 3300003187 JGI25151J46595_10011923 JGI25151J46595_100119237 139
190 3300003781 Ga0055536_1001294 Ga0055536_100129410 139
191 3300003792 Ga0055540_1000345 Ga0055540_100034514 139
192 3300004803 Ga0058862_12569811 Ga0058862_125698112 139
193 3300005288 Ga0065714_10198798 Ga0065714_101987982 139
194 3300005329 Ga0070683_100098018 Ga0070683_1000980182 139
195 3300005339 Ga0070660_100121923 Ga0070660_1001219233 139
196 3300005344 Ga0070661_100075820 Ga0070661_1000758203 139
197 3300005365 Ga0070688_100970854 Ga0070688_1009708541 139
198 3300005435 Ga0070714_100621841 Ga0070714_1006218412 139
199 3300005445 Ga0070708_100274268 Ga0070708_1002742683 139
200 3300005471 Ga0070698_101192508 Ga0070698_1011925081 139
201 3300005530 Ga0070679_101131959 Ga0070679_1011319591 139
202 3300005539 Ga0068853_100309315 Ga0068853_1003093152 139
203 3300005564 Ga0070664_100609921 Ga0070664_1006099211 139
204 3300005577 Ga0068857_100272123 Ga0068857_1002721232 139
205 3300005614 Ga0068856_100333176 Ga0068856_1003331763 139
206 3300005842 Ga0068858_100266709 Ga0068858_1002667092 139
207 3300006058 Ga0075432_10000214 Ga0075432_100002147 139
208 3300006058 Ga0075432_10001184 Ga0075432_100011846 139
209 3300006058 Ga0075432_10003756 Ga0075432_100037564 139
210 3300006058 Ga0075432_10095642 Ga0075432_100956422 139
211 3300006058 Ga0075432_10137387 Ga0075432_101373872 139
212 3300006195 Ga0075366_10034214 Ga0075366_100342143 139
213 3300006914 Ga0075436_100044449 Ga0075436_1000444493 139
214 3300006914 Ga0075436_100301186 Ga0075436_1003011862 139
215 3300006948 Ga0099826_10000019 Ga0099826_10000019149 139
216 3300009011 Ga0105251_10040646 Ga0105251_100406463 139
217 3300009011 Ga0105251_10062967 Ga0105251_100629673 139
218 3300009551 Ga0105238_10354286 Ga0105238_103542863 139
219 3300010375 Ga0105239_11839146 Ga0105239_118391461 139
220 3300013104 Ga0157370_10102314 Ga0157370_101023141 139
221 3300013104 Ga0157370_10131701 Ga0157370_101317012 139
222 3300013105 Ga0157369_10186018 Ga0157369_101860181 139
223 3300013307 Ga0157372_10225490 Ga0157372_102254903 139
224 3300014968 Ga0157379_10520944 Ga0157379_105209442 139
225 3300015265 Ga0182005_1165969 Ga0182005_11659692 139
226 3300017792 Ga0163161_10000380 Ga0163161_1000038019 139
227 3300020070 Ga0206356_10209771 Ga0206356_102097712 139
228 3300021361 Ga0213872_10001554 Ga0213872_100015546 139
229 3300025292 Ga0209676_1000340 Ga0209676_100034052 139
230 3300025292 Ga0209676_1001672 Ga0209676_10016728 139
231 3300025294 Ga0209025_1000113 Ga0209025_100011345 139
232 3300025294 Ga0209025_1001936 Ga0209025_100193623 139
233 3300025298 Ga0209050_1000708 Ga0209050_100070830 139
234 3300025303 Ga0209051_1000256 Ga0209051_100025652 139
235 3300025303 Ga0209051_1002086 Ga0209051_10020869 139
236 3300025303 Ga0209051_1041855 Ga0209051_10418552 139
237 3300025304 Ga0209257_1006802 Ga0209257_10068027 139
238 3300025735 Ga0207713_1033603 Ga0207713_10336033 139
239 3300025893 Ga0207682_10168214 Ga0207682_101682142 139
240 3300025898 Ga0207692_10506347 Ga0207692_105063471 139
241 3300025914 Ga0207671_10499401 Ga0207671_104994012 139
242 3300025921 Ga0207652_10417393 Ga0207652_104173931 139
243 3300025933 Ga0207706_10074972 Ga0207706_100749722 139
244 3300025949 Ga0207667_10637485 Ga0207667_106374851 139
245 3300026041 Ga0207639_11061864 Ga0207639_110618642 139
246 3300026078 Ga0207702_10081208 Ga0207702_100812083 139
247 3300026116 Ga0207674_10377654 Ga0207674_103776542 139
248 3300026142 Ga0207698_10349233 Ga0207698_103492332 139
249 3300027666 Ga0209282_1000089 Ga0209282_100008935 139
250 3300027907 Ga0207428_10004889 Ga0207428_1000488911 139
251 3300027907 Ga0207428_10084579 Ga0207428_100845793 139
252 3300027907 Ga0207428_10095065 Ga0207428_100950653 139
253 3300027907 Ga0207428_10486003 Ga0207428_104860032 139
254 3300030732 Ga0316176_1061506 Ga0316176_10615061 139
255 3300030733 Ga0314311_1262448 Ga0314311_12624485 139
256 3300031712 Ga0265342_10298404 Ga0265342_102984041 139
257 3300031852 Ga0307410_10793098 Ga0307410_107930982 139
258 3300031911 Ga0307412_10000544 Ga0307412_1000054410 139
259 3300031911 Ga0307412_11056225 Ga0307412_110562252 139
260 3300032005 Ga0307411_11746800 Ga0307411_117468001 139
261 3300035091 Ga0373951_0028031 Ga0373951_0028031_370_795 139
262 3300035207 Ga0373942_0037292 Ga0373942_0037292_559_984 139
263 3300035242 Ga0373962_0226890 Ga0373962_0226890_77_502 139
264 3300035691 Ga0373931_0181036 Ga0373931_0181036_306_740 139
265 3300037418 Ga0395900_0067352 Ga0395900_0067352_2986_3408 139
266 3300038443 Ga0395901_0034150 Ga0395901_0034150_1747_2169 139
267 3300039447 Ga0436361_0464788 Ga0436361_0464788_6381_6815 139
268 3300041405 Ga0439438_000023 Ga0439438_000023_78005_78445 139
269 3300041411 Ga0439466_0218843 Ga0439466_0218843_40_459 139
270 3300041486 Ga0451807_1368793 Ga0451807_1368793_19_438 139
271 3300042146 Ga0450907_000002 Ga0450907_000002_124156_124596 139
272 3300042147 Ga0450910_010284 Ga0450910_010284_244_684 139
273 3300042184 Ga0450908_001036 Ga0450908_001036_2047_2487 139
274 3300044656 Ga0466969_0075139 Ga0466969_0075139_900_1355 139
275 3300044684 Ga0466966_0112459 Ga0466966_0112459_1126_1545 139
276 3300044684 Ga0466966_0745685 Ga0466966_0745685_104_559 139
277 3300046452 Ga0495617_003399 Ga0495617_003399_1928_2410 139
278 3300046452 Ga0495617_007139 Ga0495617_007139_3147_3587 139
279 3300046453 Ga0495627_001125 Ga0495627_001125_6637_7077 139
280 3300046453 Ga0495627_010097 Ga0495627_010097_384_818 139
281 3300046454 Ga0495592_0122808 Ga0495592_0122808_946_1365 139
282 3300046454 Ga0495592_0266133 Ga0495592_0266133_341_760 139
283 3300046457 Ga0495590_0031606 Ga0495590_0031606_978_1460 139
284 3300046458 Ga0495591_000008 Ga0495591_000008_108656_109096 139
285 3300046458 Ga0495591_000295 Ga0495591_000295_34835_35317 139
286 3300046458 Ga0495591_019320 Ga0495591_019320_108_548 139
287 3300046460 Ga0495638_0001749 Ga0495638_0001749_2153_2593 139
288 3300046460 Ga0495638_0002584 Ga0495638_0002584_10046_10480 139
289 3300046460 Ga0495638_0009617 Ga0495638_0009617_1863_2303 139
290 3300046460 Ga0495638_0020339 Ga0495638_0020339_1280_1762 139
291 3300046460 Ga0495638_0021079 Ga0495638_0021079_2072_2512 139
292 3300046460 Ga0495638_0295962 Ga0495638_0295962_103_522 139
293 3300046462 Ga0495651_0221996 Ga0495651_0221996_767_1207 139
294 3300046471 Ga0495650_0001509 Ga0495650_0001509_19338_19778 139
295 3300046471 Ga0495650_0003557 Ga0495650_0003557_465_947 139
296 3300046471 Ga0495650_0047402 Ga0495650_0047402_1229_1663 139
297 3300046474 Ga0495605_0003016 Ga0495605_0003016_7548_7967 139
298 3300046474 Ga0495605_0012849 Ga0495605_0012849_1787_2227 139
299 3300046474 Ga0495605_0014491 Ga0495605_0014491_2068_2508 139
300 3300046477 Ga0495664_0061531 Ga0495664_0061531_681_1100 139
301 3300046477 Ga0495664_0124261 Ga0495664_0124261_777_1196 139
302 3300046491 Ga0495584_0000292 Ga0495584_0000292_22851_23291 139
303 3300046491 Ga0495584_0001971 Ga0495584_0001971_8941_9381 139
304 3300046491 Ga0495584_0072149 Ga0495584_0072149_778_1197 139
305 3300046492 Ga0495585_0000066 Ga0495585_0000066_61336_61776 139
306 3300046492 Ga0495585_0205715 Ga0495585_0205715_393_833 139
307 3300046500 Ga0495596_0000005 Ga0495596_0000005_19388_19828 139
308 3300046500 Ga0495596_0000121 Ga0495596_0000121_34622_35041 139
309 3300046501 Ga0495607_0001187 Ga0495607_0001187_5476_5895 139
310 3300046501 Ga0495607_0004735 Ga0495607_0004735_1058_1498 139
311 3300046501 Ga0495607_0110598 Ga0495607_0110598_455_895 139
312 3300046501 Ga0495607_0110700 Ga0495607_0110700_224_643 139
313 3300046507 Ga0495606_0000499 Ga0495606_0000499_21954_22394 139
314 3300046507 Ga0495606_0030802 Ga0495606_0030802_306_746 139
315 3300046507 Ga0495606_0048287 Ga0495606_0048287_1435_1875 139
316 3300046512 Ga0495610_0000387 Ga0495610_0000387_34556_34975 139
317 3300046512 Ga0495610_0000831 Ga0495610_0000831_26254_26736 139
318 3300046512 Ga0495610_0002780 Ga0495610_0002780_1656_2096 139
319 3300046512 Ga0495610_0027401 Ga0495610_0027401_899_1339 139
320 3300046512 Ga0495610_0054155 Ga0495610_0054155_271_705 139
321 3300046512 Ga0495610_0076070 Ga0495610_0076070_678_1118 139
322 3300046513 Ga0495616_0000740 Ga0495616_0000740_23031_23471 139
323 3300046513 Ga0495616_0001812 Ga0495616_0001812_10295_10777 139
324 3300046513 Ga0495616_0002147 Ga0495616_0002147_1604_2023 139
325 3300046513 Ga0495616_0016627 Ga0495616_0016627_3211_3651 139
326 3300046513 Ga0495616_0021295 Ga0495616_0021295_1452_1892 139
327 3300046515 Ga0495620_0003660 Ga0495620_0003660_6515_6955 139
328 3300046515 Ga0495620_0241052 Ga0495620_0241052_28_447 139
329 3300046516 Ga0495628_0406504 Ga0495628_0406504_278_697 139
330 3300046518 Ga0495631_0012015 Ga0495631_0012015_325_765 139
331 3300046519 Ga0495632_0000816 Ga0495632_0000816_3669_4088 139
332 3300046519 Ga0495632_0002393 Ga0495632_0002393_2096_2536 139
333 3300046519 Ga0495632_0002403 Ga0495632_0002403_2140_2580 139
334 3300046519 Ga0495632_0003324 Ga0495632_0003324_8444_8884 139
335 3300046519 Ga0495632_0004837 Ga0495632_0004837_2624_3106 139
336 3300046519 Ga0495632_0022756 Ga0495632_0022756_1887_2306 139
337 3300046519 Ga0495632_0027631 Ga0495632_0027631_2267_2749 139
338 3300046519 Ga0495632_0034588 Ga0495632_0034588_1382_1822 139
339 3300046519 Ga0495632_0044971 Ga0495632_0044971_1021_1461 139
340 3300046519 Ga0495632_0136780 Ga0495632_0136780_12_452 139
341 3300046520 Ga0495637_0000272 Ga0495637_0000272_22128_22568 139
342 3300046520 Ga0495637_0000274 Ga0495637_0000274_13997_14479 139
343 3300046520 Ga0495637_0000512 Ga0495637_0000512_1915_2355 139
344 3300046520 Ga0495637_0000707 Ga0495637_0000707_6453_6935 139
345 3300046520 Ga0495637_0003120 Ga0495637_0003120_1851_2291 139
346 3300046520 Ga0495637_0015421 Ga0495637_0015421_1783_2223 139
347 3300046520 Ga0495637_0027120 Ga0495637_0027120_1947_2387 139
348 3300046522 Ga0495643_0036032 Ga0495643_0036032_2247_2687 139
349 3300046522 Ga0495643_0044708 Ga0495643_0044708_1511_1951 139
350 3300046522 Ga0495643_0095023 Ga0495643_0095023_1057_1497 139
351 3300046522 Ga0495643_0112871 Ga0495643_0112871_615_1034 139
352 3300046522 Ga0495643_0145242 Ga0495643_0145242_572_1012 139
353 3300046523 Ga0495644_0000996 Ga0495644_0000996_4262_4702 139
354 3300046524 Ga0495648_0012357 Ga0495648_0012357_4268_4708 139
355 3300046524 Ga0495648_0095186 Ga0495648_0095186_832_1272 139
356 3300046524 Ga0495648_0103284 Ga0495648_0103284_98_538 139
357 3300046524 Ga0495648_0130436 Ga0495648_0130436_601_1020 139
358 3300046529 Ga0495652_0202197 Ga0495652_0202197_441_908 139
359 3300046530 Ga0495654_0000594 Ga0495654_0000594_10370_10810 139
360 3300046530 Ga0495654_0001247 Ga0495654_0001247_10130_10612 139
361 3300046530 Ga0495654_0008246 Ga0495654_0008246_3687_4127 139
362 3300046530 Ga0495654_0011224 Ga0495654_0011224_1787_2227 139
363 3300046530 Ga0495654_0026722 Ga0495654_0026722_1096_1536 139
364 3300046530 Ga0495654_0099276 Ga0495654_0099276_831_1271 139
365 3300046531 Ga0495665_0320357 Ga0495665_0320357_354_773 139
366 3300046535 Ga0495586_0127143 Ga0495586_0127143_886_1305 139
367 3300046538 Ga0495609_0002196 Ga0495609_0002196_3732_4151 139
368 3300046542 Ga0495597_0003005 Ga0495597_0003005_7178_7618 139
369 3300046542 Ga0495597_0006945 Ga0495597_0006945_3460_3900 139
370 3300046542 Ga0495597_0009802 Ga0495597_0009802_260_742 139
371 3300046542 Ga0495597_0024974 Ga0495597_0024974_1406_1846 139
372 3300046542 Ga0495597_0157084 Ga0495597_0157084_447_881 139
373 3300046542 Ga0495597_0199671 Ga0495597_0199671_250_684 139
374 3300046542 Ga0495597_0248502 Ga0495597_0248502_62_502 139
375 3300046543 Ga0495645_0027537 Ga0495645_0027537_1915_2334 139
376 3300046557 Ga0495622_0028545 Ga0495622_0028545_1762_2196 139
377 3300046558 Ga0495633_0000200 Ga0495633_0000200_33178_33618 139
378 3300046558 Ga0495633_0358404 Ga0495633_0358404_105_524 139
379 3300046615 Ga0495656_0113384 Ga0495656_0113384_383_823 139
380 3300046615 Ga0495656_0122924 Ga0495656_0122924_34_474 139
381 3300046616 Ga0495668_0000747 Ga0495668_0000747_5701_6141 139
382 3300046660 Ga0495625_0008118 Ga0495625_0008118_2397_2837 139
383 3300046660 Ga0495625_0011124 Ga0495625_0011124_2443_2883 139
384 3300046664 Ga0495659_0548253 Ga0495659_0548253_34_453 139
385 3300046665 Ga0495661_0005395 Ga0495661_0005395_606_1046 139
386 3300046665 Ga0495661_0009271 Ga0495661_0009271_2819_3259 139
387 3300046665 Ga0495661_0012634 Ga0495661_0012634_829_1248 139
388 3300046665 Ga0495661_0086421 Ga0495661_0086421_26_466 139
389 3300046678 Ga0495599_0014722 Ga0495599_0014722_3743_4162 139
390 3300046691 Ga0495670_0012449 Ga0495670_0012449_52_492 139
391 3300046691 Ga0495670_0034441 Ga0495670_0034441_950_1390 139
392 3300046691 Ga0495670_0341503 Ga0495670_0341503_17_436 139
393 3300046692 Ga0495671_0000968 Ga0495671_0000968_4206_4625 139
394 3300046692 Ga0495671_0007557 Ga0495671_0007557_4070_4489 139
395 3300046692 Ga0495671_0010048 Ga0495671_0010048_1287_1769 139
396 3300046692 Ga0495671_0037228 Ga0495671_0037228_1904_2344 139
397 3300046692 Ga0495671_0042864 Ga0495671_0042864_650_1069 139
398 3300046694 Ga0495649_0001319 Ga0495649_0001319_14811_15230 139
399 3300046694 Ga0495649_0005218 Ga0495649_0005218_1768_2187 139
400 3300046694 Ga0495649_0030991 Ga0495649_0030991_1949_2389 139
401 3300046694 Ga0495649_0052648 Ga0495649_0052648_162_602 139
402 3300046694 Ga0495649_0064188 Ga0495649_0064188_569_1009 139
403 3300046694 Ga0495649_0207967 Ga0495649_0207967_149_589 139
404 3300046794 Ga0495589_0002194 Ga0495589_0002194_8659_9099 139
405 3300046794 Ga0495589_0020339 Ga0495589_0020339_228_668 139
406 3300046794 Ga0495589_0092412 Ga0495589_0092412_278_697 139
407 3300046794 Ga0495589_0111929 Ga0495589_0111929_832_1272 139
408 3300046810 Ga0495660_0014734 Ga0495660_0014734_1397_1837 139
409 3300046810 Ga0495660_0060867 Ga0495660_0060867_198_638 139
410 3300046810 Ga0495660_0176297 Ga0495660_0176297_53_535 139
411 3300047318 Ga0495636_0000803 Ga0495636_0000803_6342_6761 139
412 3300047320 Ga0495672_0011215 Ga0495672_0011215_2028_2468 139
413 3300047320 Ga0495672_0018258 Ga0495672_0018258_212_631 139
414 3300047320 Ga0495672_0286945 Ga0495672_0286945_88_528 139
415 3300047322 Ga0495680_0777872 Ga0495680_0777872_97_516 139
416 3300047323 Ga0495683_0009899 Ga0495683_0009899_2947_3387 139
417 3300047323 Ga0495683_0034413 Ga0495683_0034413_1920_2360 139
418 3300047445 Ga0495677_0137455 Ga0495677_0137455_48_467 139
419 3300047446 Ga0495679_000534 Ga0495679_000534_12425_12844 139
420 3300047447 Ga0495685_013445 Ga0495685_013445_1937_2356 139
421 3300047469 Ga0495673_0000145 Ga0495673_0000145_58634_59053 139
422 3300047469 Ga0495673_0000452 Ga0495673_0000452_22039_22479 139
423 3300047469 Ga0495673_0002936 Ga0495673_0002936_9869_10351 139
424 3300047469 Ga0495673_0027366 Ga0495673_0027366_1346_1786 139
425 3300047470 Ga0495681_0000314 Ga0495681_0000314_16639_17079 139
426 3300047470 Ga0495681_0000502 Ga0495681_0000502_26297_26737 139
427 3300047470 Ga0495681_0005453 Ga0495681_0005453_1730_2164 139
428 3300047470 Ga0495681_0005941 Ga0495681_0005941_4298_4738 139
429 3300047470 Ga0495681_0007237 Ga0495681_0007237_2615_3049 139
430 3300047470 Ga0495681_0020872 Ga0495681_0020872_1167_1607 139
431 3300047470 Ga0495681_0027780 Ga0495681_0027780_516_998 139
432 3300047470 Ga0495681_0027894 Ga0495681_0027894_2010_2450 139
433 3300047472 Ga0495686_0001289 Ga0495686_0001289_15352_15792 139
434 3300047472 Ga0495686_0008100 Ga0495686_0008100_2554_3036 139
435 3300047472 Ga0495686_0565635 Ga0495686_0565635_144_563 139
436 3300048091 Ga0495626_0000100 Ga0495626_0000100_68822_69241 139
437 3300048091 Ga0495626_0000505 Ga0495626_0000505_18492_18926 139
438 3300048091 Ga0495626_0002983 Ga0495626_0002983_2140_2580 139
439 3300048091 Ga0495626_0021944 Ga0495626_0021944_2379_2861 139
440 3300048905 Ga0496102_0195274 Ga0496102_0195274_857_1276 139
441 3300048907 Ga0496104_0421855 Ga0496104_0421855_651_1070 139
442 3300048908 Ga0496105_1115604 Ga0496105_1115604_59_478 139
443 3300048911 Ga0496108_0099993 Ga0496108_0099993_2021_2440 139
444 3300048912 Ga0496109_1194418 Ga0496109_1194418_127_546 139
445 3300048913 Ga0496110_0038911 Ga0496110_0038911_801_1220 139
446 3300048914 Ga0496111_0058195 Ga0496111_0058195_349_768 139
447 3300048916 Ga0496113_0946974 Ga0496113_0946974_226_648 139
448 3300048919 Ga0496116_0013799 Ga0496116_0013799_498_917 139
449 3300048920 Ga0496117_0318335 Ga0496117_0318335_91_510 139
450 3300048924 Ga0496121_0001338 Ga0496121_0001338_33646_34065 139
451 3300048924 Ga0496121_0108100 Ga0496121_0108100_1229_1678 139
452 3300048925 Ga0496122_0000930 Ga0496122_0000930_32371_32790 139
453 3300048926 Ga0496123_0000369 Ga0496123_0000369_34612_35031 139
454 3300048927 Ga0496124_0006699 Ga0496124_0006699_4125_4544 139
455 3300048927 Ga0496124_0473602 Ga0496124_0473602_342_791 139
456 3300049459 Ga0495678_000173 Ga0495678_000173_31245_31664 139
457 3300049459 Ga0495678_000417 Ga0495678_000417_26592_27074 139
458 3300049459 Ga0495678_067284 Ga0495678_067284_120_560 139
459 3300049460 Ga0495682_0061716 Ga0495682_0061716_519_1001 139
460 3300049571 Ga0501034_0010940 Ga0501034_0010940_351_779 139
461 3300049705 Ga0501225_0305829 Ga0501225_0305829_58_513 139
462 3300050489 nmdc:mga03683_85061_c1 nmdc:mga03683_85061_c1_791_1216 139
463 3300050493 nmdc:mga0k408_38291_c1 nmdc:mga0k408_38291_c1_2301_2720 139
464 3300050509 nmdc:mga0qj67_110156_c1 nmdc:mga0qj67_110156_c1_1038_1460 139
465 3300050512 nmdc:mga0n895_1135331_c1 nmdc:mga0n895_1135331_c1_219_644 139
466 3300050514 nmdc:mga08x19_109423_c1 nmdc:mga08x19_109423_c1_1183_1602 139
467 3300053078 Ga0495612_0391583 Ga0495612_0391583_25_450 139
468 iso_pu_bacteria 2511231021 2511356858 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

31

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8912 3 139
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8844 10 139
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.878 3 139
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8762 5 139
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8731 3 139
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8976 3 139 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8844 10 139 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8793 3 139 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8762 5 139 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8729 7 139 3.10.129.10
ID Description Score Start End GO Terms
AF-E3HMM7-F1-model_v4 MaoC like domain protein 14 0.9979 1 139
AF-A0A158AP83-F1-model_v4 Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase 0.997 4 138
AF-A0A257JA85-F1-model_v4 Dehydratase 0.9929 56 139
AF-J0KD66-F1-model_v4 Acyl dehydratase 0.9921 3 139
AF-A0A0D4BZE1-F1-model_v4 Dehydratase 0.9911 8 138

Feature Viewer

pLDDT pTM Quality
94.66 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map