F450097

General Info

Members Datasets Scaffolds Average Seq Length
468 210 936 181

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0011366|Ga0495590_0011366_2066_2650
Length 194
Sequence MKKLLLSAVLALGFTGIAVAEKADSYKPMEIKFDNLEVDDVKQQRIATGNVILTRGTLTMKAARAVVSQTPEGFQHVVLTGGGGKATFRQKRDGEGDQWVEGEAERIEYDENVELVKMFSKAKIKRLEGAKPSDEVEGEFISYDSRKEFFSVKNTTTGESKPGGGRGTMVIQPTRTAPPATXXXXTNPTPAAGK

Samples

Sample ID Description Type Environment
1 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
185 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
188 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
192 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
193 2643221645 Massilia sp. Root351 Isolate Unclassified
194 2643221664 Massilia sp. Root418 Isolate Unclassified
195 2738541280 Massilia sp. GV090 Isolate Unclassified
196 2738541297 Duganella sp. GV083 Isolate Unclassified
197 2738541300 Massilia sp. GV016 Isolate Unclassified
198 2738541357 Duganella sp. GV053 Isolate Unclassified
199 2738543003 Duganella sp. GV066 Isolate Unclassified
200 2738543018 Massilia sp. GV045 Isolate Unclassified
201 2738543026 Duganella sp. GV089 Isolate Unclassified
202 2738543029 Duganella sp. GV039 Isolate Unclassified
203 2738543030 Massilia sp. GV097 Isolate Unclassified
204 2821131069 Duganella sp. 1224 Isolate Unclassified
205 2842711865 Duganella sp. R-73148 Isolate Unclassified
206 2857553236 Duganella sp. R-74557 Isolate Unclassified
207 2857558681 Duganella sp. R-74565 Isolate Unclassified
208 2857564685 Duganella sp. R-74599 Isolate Unclassified
209 2904424332 Duganella sp. 1411 Isolate Rhizosphere
210 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0.21
Isolates 4.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 0.64
Rhizoplane 3.85
Rhizosphere 76.28
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495590_0011366 3300046457 Bacteria 3331
2 JGI25158J39367_1001466 3300002739 Bacteria 4123
3 JGI25150J39212_1001314 3300002774 Bacteria 7066
4 JGI25150J39212_1003851 3300002774 Bacteria 3446
5 JGI25159J45721_1004172 3300002987 Bacteria 4887
6 JGI25151J46595_10073400 3300003187 Bacteria 1024
7 JGI25153J46596_10051978 3300003215 Bacteria 1169
8 rootL2_10107754 3300003322 Bacteria 2415
9 rootH1_10212637 3300003323 Bacteria 2084
10 rootH1_10272748 3300003323 Bacteria 1431
11 JGI25160J50197_1002425 3300003354 Bacteria 8693
12 JGI25161J50226_1001720 3300003374 Bacteria 6225
13 Ga0007409J51694_1055849 3300003575 Bacteria 1466
14 Ga0055525_1000018 3300003759 Bacteria 393974
15 Ga0055529_1000079 3300003763 Bacteria 149370
16 Ga0055526_1000211 3300003771 Bacteria 50334
17 Ga0055526_1004432 3300003771 Bacteria 8438
18 Ga0055526_1013585 3300003771 Bacteria 3429
19 Ga0055524_1000024 3300003775 Bacteria 217953
20 Ga0055524_1002758 3300003775 Bacteria 8832
21 Ga0055524_1010733 3300003775 Bacteria 3627
22 Ga0055534_1000893 3300003784 Bacteria 13525
23 Ga0055534_1007654 3300003784 Bacteria 2542
24 Ga0055528_1002464 3300003790 Bacteria 9901
25 Ga0055530_10006433 3300003791 Bacteria 5250
26 Ga0055530_10010403 3300003791 Bacteria 3441
27 Ga0055530_10010491 3300003791 Bacteria 3420
28 Ga0055531_10009994 3300003794 Bacteria 4782
29 Ga0055531_10014997 3300003794 Bacteria 3447
30 Ga0065165_1000379 3300005262 Bacteria 72513
31 Ga0065165_1000936 3300005262 Bacteria 37330
32 Ga0070658_10091484 3300005327 Bacteria 2507
33 Ga0070680_100098630 3300005336 Bacteria 2424
34 Ga0070660_100074499 3300005339 Bacteria 2656
35 Ga0070660_100127255 3300005339 Bacteria 2036
36 Ga0070660_100292380 3300005339 Bacteria 1334
37 Ga0070661_100092452 3300005344 Bacteria 2241
38 Ga0070659_100064087 3300005366 Bacteria 2908
39 Ga0070659_100244331 3300005366 Bacteria 1486
40 Ga0070659_100619342 3300005366 Bacteria 931
41 Ga0070662_100248291 3300005457 Bacteria 1430
42 Ga0068867_100535089 3300005459 Bacteria 1012
43 Ga0068853_101168502 3300005539 Bacteria 743
44 Ga0068853_101448556 3300005539 Bacteria 665
45 Ga0070672_100286868 3300005543 Bacteria 1393
46 Ga0068855_101132600 3300005563 Bacteria 816
47 Ga0070664_100214044 3300005564 Bacteria 1722
48 Ga0068871_100098847 3300006358 Bacteria 2442
49 Ga0079104_1002533 3300006946 Bacteria 9653
50 Ga0099826_10000010 3300006948 Bacteria 314346
51 Ga0105244_10000158 3300009036 Bacteria 70253
52 Ga0105244_10000402 3300009036 Bacteria 40241
53 Ga0105242_10086742 3300009176 Bacteria 2627
54 Ga0105239_10279952 3300010375 Bacteria 1878
55 Ga0105239_10695243 3300010375 Bacteria 1163
56 Ga0157370_10844247 3300013104 Bacteria 832
57 Ga0157370_11045353 3300013104 Bacteria 739
58 Ga0163162_11235728 3300013306 Bacteria 848
59 Ga0157372_10599150 3300013307 Bacteria 1284
60 Ga0182006_1000141 3300015261 Bacteria 77478
61 Ga0182006_1056325 3300015261 Bacteria 1498
62 Ga0182007_10181607 3300015262 Bacteria 728
63 Ga0182005_1000016 3300015265 Bacteria 346889
64 Ga0163161_10115624 3300017792 Bacteria 2011
65 Ga0213872_10000005 3300021361 Bacteria 290165
66 Ga0209436_102087 3300025208 Bacteria 6267
67 Ga0209563_100011 3300025230 Bacteria 1187808
68 Ga0207425_1000537 3300025245 Bacteria 22836
69 Ga0207425_1001616 3300025245 Bacteria 9092
70 Ga0209677_102498 3300025253 Bacteria 6865
71 Ga0209129_1012066 3300025258 Bacteria 2014
72 Ga0209565_1002327 3300025263 Bacteria 6960
73 Ga0209565_1004481 3300025263 Bacteria 4228
74 Ga0209455_1000070 3300025272 Bacteria 307867
75 Ga0209673_1004967 3300025273 Bacteria 6900
76 Ga0209130_1000589 3300025284 Bacteria 35424
77 Ga0209130_1002435 3300025284 Bacteria 9332
78 Ga0209130_1003248 3300025284 Bacteria 7128
79 Ga0209675_1002849 3300025291 Bacteria 8597
80 Ga0209675_1010989 3300025291 Bacteria 3041
81 Ga0209025_1004179 3300025294 Bacteria 12761
82 Ga0209564_1000027 3300025295 Bacteria 518458
83 Ga0209564_1000063 3300025295 Bacteria 318515
84 Ga0209564_1005608 3300025295 Bacteria 7070
85 Ga0209564_1026845 3300025295 Bacteria 1889
86 Ga0209758_1000322 3300025297 Bacteria 92458
87 Ga0209050_1000050 3300025298 Bacteria 362578
88 Ga0209050_1001394 3300025298 Bacteria 26226
89 Ga0209050_1014177 3300025298 Bacteria 3460
90 Ga0209256_1000054 3300025299 Bacteria 298431
91 Ga0209256_1001035 3300025299 Bacteria 32598
92 Ga0209256_1001215 3300025299 Bacteria 28711
93 Ga0209256_1006664 3300025299 Bacteria 6004
94 Ga0207426_1003614 3300025302 Bacteria 8201
95 Ga0207426_1087340 3300025302 Bacteria 832
96 Ga0209257_1000075 3300025304 Bacteria 324855
97 Ga0209257_1015089 3300025304 Bacteria 3250
98 Ga0207655_1008552 3300025728 Bacteria 6477
99 Ga0207655_1010967 3300025728 Bacteria 5443
100 Ga0207705_10001882 3300025909 Bacteria 16468
101 Ga0207654_10109668 3300025911 Bacteria 1715
102 Ga0207660_10165547 3300025917 Bacteria 1709
103 Ga0207657_10074275 3300025919 Bacteria 2871
104 Ga0207657_10137967 3300025919 Bacteria 1994
105 Ga0207657_10319019 3300025919 Bacteria 1229
106 Ga0207649_10029056 3300025920 Bacteria 3262
107 Ga0207690_10115599 3300025932 Bacteria 1939
108 Ga0207690_10345890 3300025932 Bacteria 1175
109 Ga0207690_10385101 3300025932 Bacteria 1115
110 Ga0207679_10088783 3300025945 Bacteria 2384
111 Ga0207667_10015412 3300025949 Bacteria 8687
112 Ga0207639_10770465 3300026041 Bacteria 895
113 Ga0207648_10047744 3300026089 Bacteria 3751
114 Ga0207674_10047425 3300026116 Bacteria 4404
115 Ga0209282_1000009 3300027666 Bacteria 233366
116 Ga0307515_10186357 3300028794 Bacteria 2003
117 Ga0307408_100001150 3300031548 Bacteria 20100
118 Ga0307408_100002743 3300031548 Bacteria 12225
119 Ga0307408_100031490 3300031548 Bacteria 3693
120 Ga0307408_100048577 3300031548 Bacteria 3044
121 Ga0307408_100049031 3300031548 Bacteria 3031
122 Ga0307408_101186331 3300031548 Bacteria 712
123 Ga0265314_10037192 3300031711 Bacteria 3530
124 Ga0307518_10133778 3300031838 Bacteria 1739
125 Ga0307412_10960080 3300031911 Bacteria 753
126 Ga0307412_11335727 3300031911 Bacteria 647
127 Ga0307416_100012949 3300032002 Bacteria 5646
128 Ga0307411_10346231 3300032005 Bacteria 1210
129 Ga0307415_101027394 3300032126 Bacteria 768
130 Ga0395899_0063930 3300037312 Bacteria 2706
131 Ga0395899_0121393 3300037312 Bacteria 1871
132 Ga0395899_0405361 3300037312 Bacteria 901
133 Ga0395900_0002597 3300037418 Bacteria 19748
134 Ga0395900_0039197 3300037418 Bacteria 4881
135 Ga0395900_0099288 3300037418 Bacteria 2990
136 Ga0395900_0159315 3300037418 Bacteria 2303
137 Ga0395900_0436221 3300037418 Bacteria 1268
138 Ga0395898_0106539 3300037466 Bacteria 2688
139 Ga0395898_0629455 3300037466 Bacteria 1015
140 Ga0395898_0802335 3300037466 Bacteria 881
141 Ga0395905_0017406 3300037471 Bacteria 6823
142 Ga0395905_0163335 3300037471 Bacteria 2093
143 Ga0395905_0198691 3300037471 Bacteria 1880
144 Ga0395905_0201389 3300037471 Bacteria 1866
145 Ga0395905_0245847 3300037471 Bacteria 1671
146 Ga0395905_0310876 3300037471 Bacteria 1464
147 Ga0395905_0378380 3300037471 Bacteria 1309
148 Ga0395905_0672411 3300037471 Bacteria 938
149 Ga0395901_0001076 3300038443 Bacteria 29192
150 Ga0395901_0544721 3300038443 Bacteria 1176
151 Ga0436361_0126888 3300039447 Bacteria 24870
152 Ga0450904_000164 3300042139 Bacteria 14610
153 Ga0439458_0005599 3300042157 Bacteria 2822
154 Ga0466972_0062329 3300044658 Bacteria 1787
155 Ga0466965_0021005 3300044683 Bacteria 3140
156 Ga0466965_0054518 3300044683 Bacteria 1988
157 Ga0466966_0118286 3300044684 Bacteria 1629
158 Ga0466966_0159291 3300044684 Bacteria 1374
159 Ga0466963_0150187 3300044694 Bacteria 1617
160 Ga0466964_0001019 3300044706 Bacteria 9316
161 Ga0466968_0001262 3300044735 Bacteria 9004
162 Ga0466970_0057046 3300044765 Bacteria 2087
163 Ga0466957_0161027 3300044842 Bacteria 1457
164 Ga0466960_0054080 3300044901 Bacteria 1948
165 Ga0466959_0124826 3300045049 Bacteria 1827
166 Ga0466958_0092383 3300045836 Bacteria 1873
167 Ga0466967_0025158 3300045976 Bacteria 4905
168 Ga0466967_0186168 3300045976 Bacteria 1960
169 Ga0495617_003529 3300046452 Bacteria 5853
170 Ga0495617_058564 3300046452 Bacteria 1276
171 Ga0495627_000011 3300046453 Bacteria 354522
172 Ga0495590_0035383 3300046457 Bacteria 1744
173 Ga0495590_0048121 3300046457 Bacteria 1487
174 Ga0495590_0166896 3300046457 Bacteria 801
175 Ga0495591_041838 3300046458 Bacteria 1298
176 Ga0495638_0001941 3300046460 Bacteria 17738
177 Ga0495638_0061088 3300046460 Bacteria 2329
178 Ga0495638_0171806 3300046460 Bacteria 1243
179 Ga0495638_0343021 3300046460 Bacteria 791
180 Ga0495638_0423969 3300046460 Bacteria 685
181 Ga0495653_0025873 3300046463 Bacteria 4708
182 Ga0495650_0000431 3300046471 Bacteria 67716
183 Ga0495650_0000485 3300046471 Bacteria 60761
184 Ga0495650_0001065 3300046471 Bacteria 30418
185 Ga0495650_0001516 3300046471 Bacteria 22098
186 Ga0495650_0009179 3300046471 Bacteria 5662
187 Ga0495605_0000061 3300046474 Bacteria 145286
188 Ga0495605_0000641 3300046474 Bacteria 26838
189 Ga0495605_0020640 3300046474 Bacteria 3499
190 Ga0495605_0021349 3300046474 Bacteria 3430
191 Ga0495605_0035618 3300046474 Bacteria 2514
192 Ga0495605_0056179 3300046474 Bacteria 1899
193 Ga0495584_0001109 3300046491 Bacteria 16710
194 Ga0495584_0001470 3300046491 Bacteria 14140
195 Ga0495584_0026770 3300046491 Bacteria 2922
196 Ga0495584_0061582 3300046491 Bacteria 1886
197 Ga0495584_0062957 3300046491 Bacteria 1864
198 Ga0495584_0136331 3300046491 Bacteria 1246
199 Ga0495584_0144695 3300046491 Bacteria 1207
200 Ga0495585_0006816 3300046492 Bacteria 7048
201 Ga0495585_0008237 3300046492 Bacteria 6328
202 Ga0495585_0012462 3300046492 Bacteria 5009
203 Ga0495585_0066993 3300046492 Bacteria 1965
204 Ga0495585_0089000 3300046492 Bacteria 1664
205 Ga0495585_0116368 3300046492 Bacteria 1417
206 Ga0495596_0007284 3300046500 Bacteria 5002
207 Ga0495596_0104439 3300046500 Bacteria 1100
208 Ga0495607_0002410 3300046501 Bacteria 15261
209 Ga0495607_0004458 3300046501 Bacteria 10274
210 Ga0495607_0006913 3300046501 Bacteria 7910
211 Ga0495607_0013095 3300046501 Bacteria 5447
212 Ga0495607_0112948 3300046501 Bacteria 1437
213 Ga0495607_0155840 3300046501 Bacteria 1165
214 Ga0495583_0000947 3300046506 Bacteria 33746
215 Ga0495583_0002934 3300046506 Bacteria 13746
216 Ga0495583_0003787 3300046506 Bacteria 11232
217 Ga0495583_0004595 3300046506 Bacteria 9786
218 Ga0495583_0013027 3300046506 Bacteria 4667
219 Ga0495583_0043161 3300046506 Bacteria 2101
220 Ga0495606_0000120 3300046507 Bacteria 133907
221 Ga0495606_0003134 3300046507 Bacteria 17935
222 Ga0495606_0006009 3300046507 Bacteria 11375
223 Ga0495606_0006559 3300046507 Bacteria 10699
224 Ga0495606_0022485 3300046507 Bacteria 4593
225 Ga0495606_0028793 3300046507 Bacteria 3911
226 Ga0495606_0061007 3300046507 Bacteria 2413
227 Ga0495610_0001967 3300046512 Bacteria 17647
228 Ga0495610_0019707 3300046512 Bacteria 3764
229 Ga0495610_0035711 3300046512 Bacteria 2548
230 Ga0495616_0000570 3300046513 Bacteria 27850
231 Ga0495616_0002996 3300046513 Bacteria 10961
232 Ga0495616_0003871 3300046513 Bacteria 9539
233 Ga0495616_0004627 3300046513 Bacteria 8635
234 Ga0495616_0010983 3300046513 Bacteria 5212
235 Ga0495616_0015793 3300046513 Bacteria 4190
236 Ga0495616_0128540 3300046513 Bacteria 1163
237 Ga0495616_0207081 3300046513 Bacteria 859
238 Ga0495631_0001600 3300046518 Bacteria 13546
239 Ga0495631_0004324 3300046518 Bacteria 7576
240 Ga0495631_0010049 3300046518 Bacteria 4701
241 Ga0495631_0128436 3300046518 Bacteria 1089
242 Ga0495632_0001178 3300046519 Bacteria 22245
243 Ga0495632_0001980 3300046519 Bacteria 16262
244 Ga0495637_0001342 3300046520 Bacteria 14760
245 Ga0495637_0018645 3300046520 Bacteria 3216
246 Ga0495637_0120095 3300046520 Bacteria 1012
247 Ga0495643_0000455 3300046522 Bacteria 52002
248 Ga0495643_0000759 3300046522 Bacteria 36249
249 Ga0495643_0003928 3300046522 Bacteria 10651
250 Ga0495643_0005232 3300046522 Bacteria 8828
251 Ga0495643_0019848 3300046522 Bacteria 3885
252 Ga0495643_0062224 3300046522 Bacteria 1976
253 Ga0495643_0064153 3300046522 Bacteria 1941
254 Ga0495643_0075349 3300046522 Bacteria 1765
255 Ga0495644_0003729 3300046523 Bacteria 5997
256 Ga0495644_0016264 3300046523 Bacteria 2848
257 Ga0495648_0005858 3300046524 Bacteria 10113
258 Ga0495648_0026099 3300046524 Bacteria 3939
259 Ga0495648_0027822 3300046524 Bacteria 3777
260 Ga0495648_0040572 3300046524 Bacteria 2950
261 Ga0495648_0093913 3300046524 Bacteria 1672
262 Ga0495648_0167398 3300046524 Bacteria 1130
263 Ga0495663_0150027 3300046525 Bacteria 795
264 Ga0495642_0001360 3300046528 Bacteria 10926
265 Ga0495642_0002790 3300046528 Bacteria 6992
266 Ga0495642_0007892 3300046528 Bacteria 4077
267 Ga0495642_0026595 3300046528 Bacteria 2299
268 Ga0495642_0036440 3300046528 Bacteria 1988
269 Ga0495642_0079201 3300046528 Bacteria 1381
270 Ga0495642_0159283 3300046528 Bacteria 978
271 Ga0495654_0000060 3300046530 Bacteria 134307
272 Ga0495654_0013481 3300046530 Bacteria 4373
273 Ga0495654_0022962 3300046530 Bacteria 3233
274 Ga0495654_0063796 3300046530 Bacteria 1763
275 Ga0495586_0012830 3300046535 Bacteria 4441
276 Ga0495586_0030539 3300046535 Bacteria 2883
277 Ga0495609_0000007 3300046538 Bacteria 398812
278 Ga0495609_0000314 3300046538 Bacteria 43536
279 Ga0495609_0001024 3300046538 Bacteria 19749
280 Ga0495609_0003230 3300046538 Bacteria 9449
281 Ga0495609_0007604 3300046538 Bacteria 5387
282 Ga0495609_0023991 3300046538 Bacteria 2800
283 Ga0495609_0050843 3300046538 Bacteria 1846
284 Ga0495609_0087037 3300046538 Bacteria 1361
285 Ga0495621_0003674 3300046539 Bacteria 4244
286 Ga0495597_0001361 3300046542 Bacteria 17716
287 Ga0495597_0010558 3300046542 Bacteria 4506
288 Ga0495597_0018903 3300046542 Bacteria 3228
289 Ga0495597_0023145 3300046542 Bacteria 2875
290 Ga0495597_0039850 3300046542 Bacteria 2101
291 Ga0495597_0101632 3300046542 Bacteria 1212
292 Ga0495622_0001345 3300046557 Bacteria 12548
293 Ga0495622_0131427 3300046557 Bacteria 1140
294 Ga0495633_0000537 3300046558 Bacteria 37833
295 Ga0495633_0001086 3300046558 Bacteria 21974
296 Ga0495633_0002449 3300046558 Bacteria 13105
297 Ga0495633_0008912 3300046558 Bacteria 5593
298 Ga0495633_0011756 3300046558 Bacteria 4699
299 Ga0495633_0021099 3300046558 Bacteria 3262
300 Ga0495656_0018221 3300046615 Bacteria 2692
301 Ga0495656_0183696 3300046615 Bacteria 1029
302 Ga0495656_0226824 3300046615 Bacteria 936
303 Ga0495656_0239455 3300046615 Bacteria 913
304 Ga0495668_0000162 3300046616 Bacteria 101114
305 Ga0495668_0000343 3300046616 Bacteria 61962
306 Ga0495668_0000962 3300046616 Bacteria 32005
307 Ga0495668_0003586 3300046616 Bacteria 11517
308 Ga0495668_0041299 3300046616 Bacteria 2569
309 Ga0495668_0049698 3300046616 Bacteria 2325
310 Ga0495668_0102627 3300046616 Bacteria 1564
311 Ga0495668_0118307 3300046616 Bacteria 1449
312 Ga0495611_0255127 3300046648 Bacteria 812
313 Ga0495625_0001374 3300046660 Bacteria 29921
314 Ga0495625_0002210 3300046660 Bacteria 21514
315 Ga0495625_0005443 3300046660 Bacteria 11608
316 Ga0495625_0010651 3300046660 Bacteria 7579
317 Ga0495625_0023402 3300046660 Bacteria 4719
318 Ga0495625_0029959 3300046660 Bacteria 4064
319 Ga0495625_0108728 3300046660 Bacteria 1897
320 Ga0495625_0297096 3300046660 Bacteria 1034
321 Ga0495625_0405642 3300046660 Bacteria 850
322 Ga0495635_0005841 3300046663 Bacteria 8576
323 Ga0495659_0000127 3300046664 Bacteria 33507
324 Ga0495659_0003238 3300046664 Bacteria 5219
325 Ga0495661_0000549 3300046665 Bacteria 38859
326 Ga0495661_0000776 3300046665 Bacteria 30561
327 Ga0495661_0008659 3300046665 Bacteria 7030
328 Ga0495661_0017352 3300046665 Bacteria 4755
329 Ga0495661_0025119 3300046665 Bacteria 3852
330 Ga0495661_0043918 3300046665 Bacteria 2743
331 Ga0495661_0061188 3300046665 Bacteria 2235
332 Ga0495661_0097529 3300046665 Bacteria 1660
333 Ga0495661_0110527 3300046665 Bacteria 1532
334 Ga0495588_0213768 3300046674 Bacteria 1018
335 Ga0495669_0000791 3300046684 Bacteria 13518
336 Ga0495613_0043544 3300046689 Bacteria 3321
337 Ga0495670_0002459 3300046691 Bacteria 9144
338 Ga0495670_0016970 3300046691 Bacteria 3579
339 Ga0495670_0069138 3300046691 Bacteria 1785
340 Ga0495670_0082971 3300046691 Bacteria 1634
341 Ga0495670_0190606 3300046691 Bacteria 1084
342 Ga0495671_0000266 3300046692 Bacteria 44137
343 Ga0495671_0027831 3300046692 Bacteria 2915
344 Ga0495671_0039703 3300046692 Bacteria 2375
345 Ga0495649_0009645 3300046694 Bacteria 5723
346 Ga0495649_0009889 3300046694 Bacteria 5643
347 Ga0495649_0016333 3300046694 Bacteria 4207
348 Ga0495649_0023317 3300046694 Bacteria 3459
349 Ga0495649_0025560 3300046694 Bacteria 3289
350 Ga0495649_0261804 3300046694 Bacteria 886
351 Ga0495589_0000081 3300046794 Bacteria 88067
352 Ga0495589_0002218 3300046794 Bacteria 10925
353 Ga0495589_0007240 3300046794 Bacteria 5812
354 Ga0495660_0001122 3300046810 Bacteria 19111
355 Ga0495660_0001641 3300046810 Bacteria 15009
356 Ga0495660_0003018 3300046810 Bacteria 10501
357 Ga0495660_0003901 3300046810 Bacteria 9114
358 Ga0495660_0075701 3300046810 Bacteria 1775
359 Ga0495660_0175400 3300046810 Bacteria 1041
360 Ga0495660_0223158 3300046810 Bacteria 887
361 Ga0495604_0071080 3300047317 Bacteria 2633
362 Ga0495636_0005873 3300047318 Bacteria 4815
363 Ga0495636_0035219 3300047318 Bacteria 2062
364 Ga0495672_0000297 3300047320 Bacteria 68017
365 Ga0495672_0000847 3300047320 Bacteria 32544
366 Ga0495672_0276935 3300047320 Bacteria 803
367 Ga0495680_0032272 3300047322 Bacteria 4252
368 Ga0495683_0001476 3300047323 Bacteria 15354
369 Ga0495683_0007113 3300047323 Bacteria 6072
370 Ga0495683_0032704 3300047323 Bacteria 2649
371 Ga0495683_0036383 3300047323 Bacteria 2499
372 Ga0495687_000030 3300047443 Bacteria 279992
373 Ga0495687_000120 3300047443 Bacteria 120987
374 Ga0495687_000374 3300047443 Bacteria 55800
375 Ga0495687_000814 3300047443 Bacteria 33460
376 Ga0495687_005336 3300047443 Bacteria 8232
377 Ga0495687_008018 3300047443 Bacteria 6110
378 Ga0495675_0028627 3300047444 Bacteria 3552
379 Ga0495677_0000045 3300047445 Bacteria 73995
380 Ga0495677_0001504 3300047445 Bacteria 9372
381 Ga0495677_0003277 3300047445 Bacteria 6310
382 Ga0495677_0010359 3300047445 Bacteria 3425
383 Ga0495677_0011757 3300047445 Bacteria 3199
384 Ga0495677_0015843 3300047445 Bacteria 2737
385 Ga0495679_005794 3300047446 Bacteria 5438
386 Ga0495679_008295 3300047446 Bacteria 4240
387 Ga0495679_018010 3300047446 Bacteria 2516
388 Ga0495685_000125 3300047447 Bacteria 26465
389 Ga0495685_262308 3300047447 Bacteria 547
390 Ga0495673_0000391 3300047469 Bacteria 51513
391 Ga0495673_0020688 3300047469 Bacteria 3271
392 Ga0495681_0001259 3300047470 Bacteria 19226
393 Ga0495681_0001523 3300047470 Bacteria 17287
394 Ga0495681_0005040 3300047470 Bacteria 8903
395 Ga0495681_0034447 3300047470 Bacteria 2523
396 Ga0495681_0040480 3300047470 Bacteria 2268
397 Ga0495681_0069965 3300047470 Bacteria 1593
398 Ga0495681_0078481 3300047470 Bacteria 1479
399 Ga0495681_0133394 3300047470 Bacteria 1055
400 Ga0495686_0002181 3300047472 Bacteria 19042
401 Ga0495686_0021171 3300047472 Bacteria 4324
402 Ga0495686_0040167 3300047472 Bacteria 2985
403 Ga0495593_0007740 3300047673 Bacteria 6265
404 Ga0495626_0001251 3300048091 Bacteria 20847
405 Ga0495626_0009393 3300048091 Bacteria 5287
406 Ga0495626_0014390 3300048091 Bacteria 4083
407 Ga0495626_0022201 3300048091 Bacteria 3136
408 Ga0495626_0034106 3300048091 Bacteria 2436
409 Ga0495626_0044201 3300048091 Bacteria 2086
410 Ga0496100_0248560 3300048903 Bacteria 1315
411 Ga0496100_0338383 3300048903 Bacteria 1134
412 Ga0496101_0248987 3300048904 Bacteria 1384
413 Ga0496102_0043475 3300048905 Bacteria 4074
414 Ga0496103_0005598 3300048906 Bacteria 7515
415 Ga0496103_0018515 3300048906 Bacteria 4178
416 Ga0496104_0416575 3300048907 Bacteria 1256
417 Ga0496107_0135742 3300048910 Bacteria 1817
418 Ga0496107_0802108 3300048910 Unclassified 689
419 Ga0496108_0193585 3300048911 Bacteria 1763
420 Ga0496109_0562191 3300048912 Bacteria 1076
421 Ga0496110_0052780 3300048913 Bacteria 3572
422 Ga0496110_0783836 3300048913 Bacteria 857
423 Ga0496111_0307022 3300048914 Bacteria 1176
424 Ga0496112_0256759 3300048915 Bacteria 1698
425 Ga0496113_0013871 3300048916 Bacteria 5477
426 Ga0496114_0299840 3300048917 Bacteria 1419
427 Ga0496115_0393733 3300048918 Bacteria 1125
428 Ga0496116_0128644 3300048919 Bacteria 1448
429 Ga0496122_0008754 3300048925 Bacteria 10828
430 Ga0496123_0095665 3300048926 Bacteria 1746
431 Ga0496124_0106458 3300048927 Bacteria 2264
432 Ga0496124_0140388 3300048927 Bacteria 1907
433 Ga0495678_000010 3300049459 Bacteria 357896
434 Ga0495678_000190 3300049459 Bacteria 71878
435 Ga0495678_001091 3300049459 Bacteria 22890
436 Ga0495678_004786 3300049459 Bacteria 7704
437 Ga0495678_004860 3300049459 Bacteria 7612
438 Ga0495678_009080 3300049459 Bacteria 4960
439 Ga0495678_071675 3300049459 Bacteria 1268
440 Ga0495682_0000380 3300049460 Bacteria 32186
441 Ga0501214_039372 3300049659 Bacteria 681
442 Ga0501238_007967 3300049671 Bacteria 1385
443 Ga0501249_010146 3300049679 Bacteria 1966
444 Ga0501269_000199 3300049766 Bacteria 18071
445 Ga0501279_002690 3300049775 Bacteria 2322
446 Ga0500594_0001066 3300053118 Bacteria 5868
447 Ga0500618_000364 3300053125 Bacteria 31481
448 Ga0500618_026403 3300053125 Bacteria 1387
449 Ga0500586_104606 3300053145 Bacteria 990
450 2643792005 2643221554 Bacteria 6603920
451 2644254742 2643221645 Bacteria 7207331
452 2644360296 2643221664 Bacteria 7272945
453 2738738051 2738541280 Bacteria 6630198
454 2738826853 2738541297 Bacteria 6549566
455 2738843159 2738541300 Bacteria 6675882
456 2739150650 2738541357 Bacteria 6549408
457 2739192569 2738543003 Bacteria 6549560
458 2739273910 2738543018 Bacteria 6718814
459 2739319046 2738543026 Bacteria 6549408
460 2739337287 2738543029 Bacteria 6549249
461 2739342954 2738543030 Bacteria 6719714
462 2821135813 2821131069 Bacteria 6108407
463 2842712275 2842711865 Bacteria 7155354
464 2857556212 2857553236 Bacteria 6166726
465 2857560866 2857558681 Bacteria 6617694
466 2857568064 2857564685 Bacteria 6290584
467 2904428795 2904424332 Bacteria 7633521
468 2919477032 2919476304 Bacteria 5888696
469 Ga0495590_0011366
470 JGI25158J39367_1001466
471 JGI25150J39212_1001314
472 JGI25150J39212_1003851
473 JGI25159J45721_1004172
474 JGI25151J46595_10073400
475 JGI25153J46596_10051978
476 rootL2_10107754
477 rootH1_10212637
478 rootH1_10272748
479 JGI25160J50197_1002425
480 JGI25161J50226_1001720
481 Ga0007409J51694_1055849
482 Ga0055525_1000018
483 Ga0055529_1000079
484 Ga0055526_1000211
485 Ga0055526_1004432
486 Ga0055526_1013585
487 Ga0055524_1000024
488 Ga0055524_1002758
489 Ga0055524_1010733
490 Ga0055534_1000893
491 Ga0055534_1007654
492 Ga0055528_1002464
493 Ga0055530_10006433
494 Ga0055530_10010403
495 Ga0055530_10010491
496 Ga0055531_10009994
497 Ga0055531_10014997
498 Ga0065165_1000379
499 Ga0065165_1000936
500 Ga0070658_10091484
501 Ga0070680_100098630
502 Ga0070660_100074499
503 Ga0070660_100127255
504 Ga0070660_100292380
505 Ga0070661_100092452
506 Ga0070659_100064087
507 Ga0070659_100244331
508 Ga0070659_100619342
509 Ga0070662_100248291
510 Ga0068867_100535089
511 Ga0068853_101168502
512 Ga0068853_101448556
513 Ga0070672_100286868
514 Ga0068855_101132600
515 Ga0070664_100214044
516 Ga0068871_100098847
517 Ga0079104_1002533
518 Ga0099826_10000010
519 Ga0105244_10000158
520 Ga0105244_10000402
521 Ga0105242_10086742
522 Ga0105239_10279952
523 Ga0105239_10695243
524 Ga0157370_10844247
525 Ga0157370_11045353
526 Ga0163162_11235728
527 Ga0157372_10599150
528 Ga0182006_1000141
529 Ga0182006_1056325
530 Ga0182007_10181607
531 Ga0182005_1000016
532 Ga0163161_10115624
533 Ga0213872_10000005
534 Ga0209436_102087
535 Ga0209563_100011
536 Ga0207425_1000537
537 Ga0207425_1001616
538 Ga0209677_102498
539 Ga0209129_1012066
540 Ga0209565_1002327
541 Ga0209565_1004481
542 Ga0209455_1000070
543 Ga0209673_1004967
544 Ga0209130_1000589
545 Ga0209130_1002435
546 Ga0209130_1003248
547 Ga0209675_1002849
548 Ga0209675_1010989
549 Ga0209025_1004179
550 Ga0209564_1000027
551 Ga0209564_1000063
552 Ga0209564_1005608
553 Ga0209564_1026845
554 Ga0209758_1000322
555 Ga0209050_1000050
556 Ga0209050_1001394
557 Ga0209050_1014177
558 Ga0209256_1000054
559 Ga0209256_1001035
560 Ga0209256_1001215
561 Ga0209256_1006664
562 Ga0207426_1003614
563 Ga0207426_1087340
564 Ga0209257_1000075
565 Ga0209257_1015089
566 Ga0207655_1008552
567 Ga0207655_1010967
568 Ga0207705_10001882
569 Ga0207654_10109668
570 Ga0207660_10165547
571 Ga0207657_10074275
572 Ga0207657_10137967
573 Ga0207657_10319019
574 Ga0207649_10029056
575 Ga0207690_10115599
576 Ga0207690_10345890
577 Ga0207690_10385101
578 Ga0207679_10088783
579 Ga0207667_10015412
580 Ga0207639_10770465
581 Ga0207648_10047744
582 Ga0207674_10047425
583 Ga0209282_1000009
584 Ga0307515_10186357
585 Ga0307408_100001150
586 Ga0307408_100002743
587 Ga0307408_100031490
588 Ga0307408_100048577
589 Ga0307408_100049031
590 Ga0307408_101186331
591 Ga0265314_10037192
592 Ga0307518_10133778
593 Ga0307412_10960080
594 Ga0307412_11335727
595 Ga0307416_100012949
596 Ga0307411_10346231
597 Ga0307415_101027394
598 Ga0395899_0063930
599 Ga0395899_0121393
600 Ga0395899_0405361
601 Ga0395900_0002597
602 Ga0395900_0039197
603 Ga0395900_0099288
604 Ga0395900_0159315
605 Ga0395900_0436221
606 Ga0395898_0106539
607 Ga0395898_0629455
608 Ga0395898_0802335
609 Ga0395905_0017406
610 Ga0395905_0163335
611 Ga0395905_0198691
612 Ga0395905_0201389
613 Ga0395905_0245847
614 Ga0395905_0310876
615 Ga0395905_0378380
616 Ga0395905_0672411
617 Ga0395901_0001076
618 Ga0395901_0544721
619 Ga0436361_0126888
620 Ga0450904_000164
621 Ga0439458_0005599
622 Ga0466972_0062329
623 Ga0466965_0021005
624 Ga0466965_0054518
625 Ga0466966_0118286
626 Ga0466966_0159291
627 Ga0466963_0150187
628 Ga0466964_0001019
629 Ga0466968_0001262
630 Ga0466970_0057046
631 Ga0466957_0161027
632 Ga0466960_0054080
633 Ga0466959_0124826
634 Ga0466958_0092383
635 Ga0466967_0025158
636 Ga0466967_0186168
637 Ga0495617_003529
638 Ga0495617_058564
639 Ga0495627_000011
640 Ga0495590_0035383
641 Ga0495590_0048121
642 Ga0495590_0166896
643 Ga0495591_041838
644 Ga0495638_0001941
645 Ga0495638_0061088
646 Ga0495638_0171806
647 Ga0495638_0343021
648 Ga0495638_0423969
649 Ga0495653_0025873
650 Ga0495650_0000431
651 Ga0495650_0000485
652 Ga0495650_0001065
653 Ga0495650_0001516
654 Ga0495650_0009179
655 Ga0495605_0000061
656 Ga0495605_0000641
657 Ga0495605_0020640
658 Ga0495605_0021349
659 Ga0495605_0035618
660 Ga0495605_0056179
661 Ga0495584_0001109
662 Ga0495584_0001470
663 Ga0495584_0026770
664 Ga0495584_0061582
665 Ga0495584_0062957
666 Ga0495584_0136331
667 Ga0495584_0144695
668 Ga0495585_0006816
669 Ga0495585_0008237
670 Ga0495585_0012462
671 Ga0495585_0066993
672 Ga0495585_0089000
673 Ga0495585_0116368
674 Ga0495596_0007284
675 Ga0495596_0104439
676 Ga0495607_0002410
677 Ga0495607_0004458
678 Ga0495607_0006913
679 Ga0495607_0013095
680 Ga0495607_0112948
681 Ga0495607_0155840
682 Ga0495583_0000947
683 Ga0495583_0002934
684 Ga0495583_0003787
685 Ga0495583_0004595
686 Ga0495583_0013027
687 Ga0495583_0043161
688 Ga0495606_0000120
689 Ga0495606_0003134
690 Ga0495606_0006009
691 Ga0495606_0006559
692 Ga0495606_0022485
693 Ga0495606_0028793
694 Ga0495606_0061007
695 Ga0495610_0001967
696 Ga0495610_0019707
697 Ga0495610_0035711
698 Ga0495616_0000570
699 Ga0495616_0002996
700 Ga0495616_0003871
701 Ga0495616_0004627
702 Ga0495616_0010983
703 Ga0495616_0015793
704 Ga0495616_0128540
705 Ga0495616_0207081
706 Ga0495631_0001600
707 Ga0495631_0004324
708 Ga0495631_0010049
709 Ga0495631_0128436
710 Ga0495632_0001178
711 Ga0495632_0001980
712 Ga0495637_0001342
713 Ga0495637_0018645
714 Ga0495637_0120095
715 Ga0495643_0000455
716 Ga0495643_0000759
717 Ga0495643_0003928
718 Ga0495643_0005232
719 Ga0495643_0019848
720 Ga0495643_0062224
721 Ga0495643_0064153
722 Ga0495643_0075349
723 Ga0495644_0003729
724 Ga0495644_0016264
725 Ga0495648_0005858
726 Ga0495648_0026099
727 Ga0495648_0027822
728 Ga0495648_0040572
729 Ga0495648_0093913
730 Ga0495648_0167398
731 Ga0495663_0150027
732 Ga0495642_0001360
733 Ga0495642_0002790
734 Ga0495642_0007892
735 Ga0495642_0026595
736 Ga0495642_0036440
737 Ga0495642_0079201
738 Ga0495642_0159283
739 Ga0495654_0000060
740 Ga0495654_0013481
741 Ga0495654_0022962
742 Ga0495654_0063796
743 Ga0495586_0012830
744 Ga0495586_0030539
745 Ga0495609_0000007
746 Ga0495609_0000314
747 Ga0495609_0001024
748 Ga0495609_0003230
749 Ga0495609_0007604
750 Ga0495609_0023991
751 Ga0495609_0050843
752 Ga0495609_0087037
753 Ga0495621_0003674
754 Ga0495597_0001361
755 Ga0495597_0010558
756 Ga0495597_0018903
757 Ga0495597_0023145
758 Ga0495597_0039850
759 Ga0495597_0101632
760 Ga0495622_0001345
761 Ga0495622_0131427
762 Ga0495633_0000537
763 Ga0495633_0001086
764 Ga0495633_0002449
765 Ga0495633_0008912
766 Ga0495633_0011756
767 Ga0495633_0021099
768 Ga0495656_0018221
769 Ga0495656_0183696
770 Ga0495656_0226824
771 Ga0495656_0239455
772 Ga0495668_0000162
773 Ga0495668_0000343
774 Ga0495668_0000962
775 Ga0495668_0003586
776 Ga0495668_0041299
777 Ga0495668_0049698
778 Ga0495668_0102627
779 Ga0495668_0118307
780 Ga0495611_0255127
781 Ga0495625_0001374
782 Ga0495625_0002210
783 Ga0495625_0005443
784 Ga0495625_0010651
785 Ga0495625_0023402
786 Ga0495625_0029959
787 Ga0495625_0108728
788 Ga0495625_0297096
789 Ga0495625_0405642
790 Ga0495635_0005841
791 Ga0495659_0000127
792 Ga0495659_0003238
793 Ga0495661_0000549
794 Ga0495661_0000776
795 Ga0495661_0008659
796 Ga0495661_0017352
797 Ga0495661_0025119
798 Ga0495661_0043918
799 Ga0495661_0061188
800 Ga0495661_0097529
801 Ga0495661_0110527
802 Ga0495588_0213768
803 Ga0495669_0000791
804 Ga0495613_0043544
805 Ga0495670_0002459
806 Ga0495670_0016970
807 Ga0495670_0069138
808 Ga0495670_0082971
809 Ga0495670_0190606
810 Ga0495671_0000266
811 Ga0495671_0027831
812 Ga0495671_0039703
813 Ga0495649_0009645
814 Ga0495649_0009889
815 Ga0495649_0016333
816 Ga0495649_0023317
817 Ga0495649_0025560
818 Ga0495649_0261804
819 Ga0495589_0000081
820 Ga0495589_0002218
821 Ga0495589_0007240
822 Ga0495660_0001122
823 Ga0495660_0001641
824 Ga0495660_0003018
825 Ga0495660_0003901
826 Ga0495660_0075701
827 Ga0495660_0175400
828 Ga0495660_0223158
829 Ga0495604_0071080
830 Ga0495636_0005873
831 Ga0495636_0035219
832 Ga0495672_0000297
833 Ga0495672_0000847
834 Ga0495672_0276935
835 Ga0495680_0032272
836 Ga0495683_0001476
837 Ga0495683_0007113
838 Ga0495683_0032704
839 Ga0495683_0036383
840 Ga0495687_000030
841 Ga0495687_000120
842 Ga0495687_000374
843 Ga0495687_000814
844 Ga0495687_005336
845 Ga0495687_008018
846 Ga0495675_0028627
847 Ga0495677_0000045
848 Ga0495677_0001504
849 Ga0495677_0003277
850 Ga0495677_0010359
851 Ga0495677_0011757
852 Ga0495677_0015843
853 Ga0495679_005794
854 Ga0495679_008295
855 Ga0495679_018010
856 Ga0495685_000125
857 Ga0495685_262308
858 Ga0495673_0000391
859 Ga0495673_0020688
860 Ga0495681_0001259
861 Ga0495681_0001523
862 Ga0495681_0005040
863 Ga0495681_0034447
864 Ga0495681_0040480
865 Ga0495681_0069965
866 Ga0495681_0078481
867 Ga0495681_0133394
868 Ga0495686_0002181
869 Ga0495686_0021171
870 Ga0495686_0040167
871 Ga0495593_0007740
872 Ga0495626_0001251
873 Ga0495626_0009393
874 Ga0495626_0014390
875 Ga0495626_0022201
876 Ga0495626_0034106
877 Ga0495626_0044201
878 Ga0496100_0248560
879 Ga0496100_0338383
880 Ga0496101_0248987
881 Ga0496102_0043475
882 Ga0496103_0005598
883 Ga0496103_0018515
884 Ga0496104_0416575
885 Ga0496107_0135742
886 Ga0496107_0802108
887 Ga0496108_0193585
888 Ga0496109_0562191
889 Ga0496110_0052780
890 Ga0496110_0783836
891 Ga0496111_0307022
892 Ga0496112_0256759
893 Ga0496113_0013871
894 Ga0496114_0299840
895 Ga0496115_0393733
896 Ga0496116_0128644
897 Ga0496122_0008754
898 Ga0496123_0095665
899 Ga0496124_0106458
900 Ga0496124_0140388
901 Ga0495678_000010
902 Ga0495678_000190
903 Ga0495678_001091
904 Ga0495678_004786
905 Ga0495678_004860
906 Ga0495678_009080
907 Ga0495678_071675
908 Ga0495682_0000380
909 Ga0501214_039372
910 Ga0501238_007967
911 Ga0501249_010146
912 Ga0501269_000199
913 Ga0501279_002690
914 Ga0500594_0001066
915 Ga0500618_000364
916 Ga0500618_026403
917 Ga0500586_104606
918 2643792005
919 2644254742
920 2644360296
921 2738738051
922 2738826853
923 2738843159
924 2739150650
925 2739192569
926 2739273910
927 2739319046
928 2739337287
929 2739342954
930 2821135813
931 2842712275
932 2857556212
933 2857560866
934 2857568064
935 2904428795
936 2919477032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03968

LptD_N

LptA/(LptD N-terminal domain) LPS transport protein

30

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1a-assembly2.cif.gz_E crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.9104 24 155
2r1a-assembly2.cif.gz_G crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8875 24 159
2r1a-assembly1.cif.gz_A crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8839 23 159
2r1a-assembly2.cif.gz_H crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8691 23 159
2r1a-assembly1.cif.gz_B crystal structure of the periplasmic lipopolysaccharide transport protein lpta (yhbn), trigonal form 0.8637 24 159
ID Description Score Start End Superfamily
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8691 23 159 2.60.450.10
2r1aH00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8198 23 159 2.60.450.10
4uu4A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.8108 24 173 2.60.450.10
3my2A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.7954 28 153 2.60.450.10
4uu4A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.7948 24 173 2.60.450.10
ID Description Score Start End GO Terms
AF-A0A2D9EQG1-F1-model_v4 deleted 0.9037 27 152
AF-A0A2C8CXN7-F1-model_v4 Lipopolysaccharide export system protein LptA 0.8994 16 159 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288
GO:0043165
AF-A0A257QKA6-F1-model_v4 Lipopolysaccharide transport periplasmic protein LptA 0.899 30 152 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288
AF-A0A838F103-F1-model_v4 Organic solvent tolerance-like N-terminal domain-containing protein 0.8856 27 153
AF-A0A3D2PWV4-F1-model_v4 Lipopolysaccharide transport periplasmic protein LptA 0.8761 23 158 GO:0001530
GO:0009279
GO:0015920
GO:0017089
GO:0030288

Map