F450108

General Info

Members Datasets Scaffolds Average Seq Length
468 206 936 204

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0050207|Ga0495597_0050207_401_1099
Length 232
Sequence MDTRCHPNWVHFLPTEIVFSRSLYSVIRPLPPKSLCDLSELSDFSIRLTPAPEVWEWLQAEILADTGSIHNEDHAHLLDADIRVMWASSSFERQGRRVLGQAEQVAFRAGGWQKARMEQQMLDWFGDVPAFIITLVADYCSQCSDTDFCALVEHELYHLAHAKDKYGQPAFTKEGAPKIEMRGHDVEEFVGVVRRYGASPDVQELVDAANSPAEMGKLNISRACGTCLLKSA

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
68 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
76 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
77 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
83 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
84 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
85 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
86 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
87 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
90 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
160 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
161 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
162 2511231007 Pseudomonas sp. GM18 Isolate Nodule
163 2511231011 Pseudomonas sp. GM30 Isolate Nodule
164 2511231023 Pseudomonas sp. GM80 Isolate Nodule
165 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
166 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
167 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
168 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
169 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
170 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
171 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
172 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
173 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
174 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
175 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
176 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
177 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
178 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
179 2784132063 Pseudomonas sp. 424 Isolate Unclassified
180 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
181 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
182 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
183 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
184 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
185 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
186 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
187 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
188 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
189 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
190 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
191 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
192 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
193 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
194 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
195 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
196 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
197 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
198 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
199 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
200 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
201 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
202 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
203 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
204 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
205 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
206 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 2.56
Rhizoplane 1.92
Rhizosphere 76.28
Stem 0
Stem Tuber 0.21
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0050207 3300046542 Bacteria 1842
2 MRS1b_contig_8706904 2162886011 Bacteria 826
3 JGI25154J39366_1003733 3300002738 Bacteria 3039
4 rootL2_10000530 3300003322 Bacteria 100270
5 Ga0055539_1000348 3300003752 Bacteria 20503
6 Ga0055533_1000340 3300003756 Bacteria 20503
7 Ga0055532_1000419 3300003758 Bacteria 20503
8 Ga0055525_1000490 3300003759 Bacteria 20503
9 Ga0055535_1006581 3300003761 Bacteria 2329
10 Ga0055534_1018171 3300003784 Bacteria 1228
11 Ga0055530_10000703 3300003791 Bacteria 28254
12 Ga0055540_1000623 3300003792 Bacteria 25198
13 Ga0055540_1000743 3300003792 Bacteria 22104
14 Ga0055541_1000240 3300003841 Bacteria 20503
15 Ga0065714_10007046 3300005288 Bacteria 3303
16 Ga0065714_10009840 3300005288 Bacteria 3411
17 Ga0065714_10011990 3300005288 Bacteria 2000
18 Ga0065714_10064791 3300005288 Bacteria 18761
19 Ga0065714_10077089 3300005288 Bacteria 2723
20 Ga0065714_10147193 3300005288 Bacteria 1126
21 Ga0065714_10212418 3300005288 Bacteria 861
22 Ga0065704_10090511 3300005289 Bacteria 2775
23 Ga0065712_10005942 3300005290 Bacteria 4550
24 Ga0065712_10084107 3300005290 Bacteria 2789
25 Ga0065712_10100648 3300005290 Bacteria 2037
26 Ga0070670_100000636 3300005331 Bacteria 27291
27 Ga0070662_100005392 3300005457 Bacteria 8167
28 Ga0070664_100000201 3300005564 Bacteria 42562
29 Ga0068851_10003434 3300005834 Bacteria 7050
30 Ga0075432_10004265 3300006058 Bacteria 4870
31 Ga0079104_1000730 3300006946 Bacteria 29122
32 Ga0079104_1000878 3300006946 Bacteria 24679
33 Ga0079104_1013641 3300006946 Bacteria 2493
34 Ga0079104_1014902 3300006946 Bacteria 2327
35 Ga0105251_10041288 3300009011 Bacteria 2246
36 Ga0105251_10048598 3300009011 Bacteria 2033
37 Ga0105244_10007470 3300009036 Bacteria 6943
38 Ga0105244_10036755 3300009036 Bacteria 2563
39 Ga0105244_10059827 3300009036 Bacteria 1920
40 Ga0105250_10021250 3300009092 Bacteria 2620
41 Ga0105237_10000413 3300009545 Bacteria 60829
42 Ga0105246_10002457 3300011119 Bacteria 11187
43 Ga0105246_10005408 3300011119 Bacteria 7777
44 Ga0157373_10000594 3300013100 Bacteria 28114
45 Ga0157373_10002562 3300013100 Bacteria 13813
46 Ga0157373_10008095 3300013100 Bacteria 7813
47 Ga0157373_10014454 3300013100 Bacteria 5785
48 Ga0157373_10019046 3300013100 Bacteria 4996
49 Ga0157373_10032327 3300013100 Bacteria 3766
50 Ga0157371_10000515 3300013102 Bacteria 46443
51 Ga0157371_10002800 3300013102 Bacteria 16347
52 Ga0157371_10020270 3300013102 Bacteria 4894
53 Ga0157371_10023457 3300013102 Bacteria 4512
54 Ga0157371_10048472 3300013102 Bacteria 3020
55 Ga0157371_10059478 3300013102 Bacteria 2708
56 Ga0157370_10006088 3300013104 Bacteria 13392
57 Ga0157370_10007330 3300013104 Bacteria 12038
58 Ga0157370_10019115 3300013104 Bacteria 6887
59 Ga0157370_10021368 3300013104 Bacteria 6449
60 Ga0157370_10027526 3300013104 Bacteria 5605
61 Ga0157370_10135427 3300013104 Bacteria 2296
62 Ga0157370_10288558 3300013104 Bacteria 1516
63 Ga0157370_10819374 3300013104 Bacteria 846
64 Ga0157369_10001400 3300013105 Bacteria 29608
65 Ga0157369_10006462 3300013105 Bacteria 13589
66 Ga0157369_10053904 3300013105 Bacteria 4344
67 Ga0157369_10089925 3300013105 Bacteria 3278
68 Ga0157369_10174112 3300013105 Bacteria 2266
69 Ga0163162_10095904 3300013306 Bacteria 3054
70 Ga0163162_10099451 3300013306 Bacteria 2999
71 Ga0157372_10000261 3300013307 Bacteria 58448
72 Ga0157372_10400492 3300013307 Bacteria 1599
73 Ga0157375_10000471 3300013308 Bacteria 36699
74 Ga0157375_10020355 3300013308 Bacteria 6059
75 Ga0157375_10046943 3300013308 Bacteria 4214
76 Ga0182008_10001776 3300014497 Bacteria 14126
77 Ga0182008_10006137 3300014497 Bacteria 6754
78 Ga0182008_10006568 3300014497 Bacteria 6492
79 Ga0182008_10070304 3300014497 Bacteria 1722
80 Ga0182008_10088765 3300014497 Bacteria 1523
81 Ga0182008_10109219 3300014497 Bacteria 1370
82 Ga0182008_10311129 3300014497 Bacteria 827
83 Ga0182006_1001203 3300015261 Bacteria 16166
84 Ga0182006_1001761 3300015261 Bacteria 12555
85 Ga0182006_1001798 3300015261 Bacteria 12356
86 Ga0182006_1013203 3300015261 Bacteria 3589
87 Ga0182006_1025294 3300015261 Bacteria 2440
88 Ga0182007_10000115 3300015262 Bacteria 54892
89 Ga0182007_10000242 3300015262 Bacteria 36731
90 Ga0182007_10007640 3300015262 Bacteria 4510
91 Ga0182007_10018447 3300015262 Bacteria 2527
92 Ga0182007_10039466 3300015262 Bacteria 1580
93 Ga0182007_10079356 3300015262 Bacteria 1076
94 Ga0182005_1000452 3300015265 Bacteria 21756
95 Ga0182005_1002004 3300015265 Bacteria 7644
96 Ga0182005_1002751 3300015265 Bacteria 6136
97 Ga0182005_1007085 3300015265 Bacteria 3384
98 Ga0182005_1010172 3300015265 Bacteria 2712
99 Ga0163161_10356261 3300017792 Bacteria 1164
100 Ga0209784_100368 3300025224 Bacteria 21333
101 Ga0209566_100664 3300025225 Bacteria 20588
102 Ga0209674_100420 3300025226 Bacteria 20588
103 Ga0209147_100549 3300025229 Bacteria 21319
104 Ga0209563_100296 3300025230 Bacteria 20588
105 Ga0209437_101174 3300025233 Bacteria 7759
106 Ga0209258_100754 3300025242 Bacteria 20482
107 Ga0209646_1000464 3300025246 Bacteria 20587
108 Ga0209026_1026571 3300025250 Bacteria 869
109 Ga0209677_100561 3300025253 Bacteria 20588
110 Ga0209675_1008531 3300025291 Bacteria 3751
111 Ga0209676_1000003 3300025292 Bacteria 1454178
112 Ga0209050_1000004 3300025298 Bacteria 1600040
113 Ga0209050_1000079 3300025298 Bacteria 277803
114 Ga0209050_1007915 3300025298 Bacteria 5825
115 Ga0209256_1001780 3300025299 Bacteria 20409
116 Ga0209051_1000006 3300025303 Bacteria 1015785
117 Ga0209051_1000054 3300025303 Bacteria 280804
118 Ga0209257_1008525 3300025304 Bacteria 5794
119 Ga0207656_10021279 3300025321 Bacteria 2590
120 Ga0207696_1000045 3300025711 Bacteria 296484
121 Ga0207655_1007431 3300025728 Bacteria 7106
122 Ga0207655_1010548 3300025728 Bacteria 5590
123 Ga0207655_1104446 3300025728 Bacteria 969
124 Ga0207713_1000259 3300025735 Bacteria 65068
125 Ga0207713_1033267 3300025735 Bacteria 2254
126 Ga0207713_1038157 3300025735 Bacteria 2041
127 Ga0207671_10001061 3300025914 Bacteria 33340
128 Ga0207649_10000183 3300025920 Bacteria 51125
129 Ga0207650_10000369 3300025925 Bacteria 42709
130 Ga0207706_10039996 3300025933 Bacteria 4156
131 Ga0207679_10000016 3300025945 Bacteria 253494
132 Ga0209281_1000015 3300027111 Bacteria 590084
133 Ga0209281_1000018 3300027111 Bacteria 579091
134 Ga0209281_1000450 3300027111 Bacteria 58787
135 Ga0209281_1014078 3300027111 Bacteria 1703
136 Ga0209281_1017263 3300027111 Bacteria 1467
137 Ga0207428_10001296 3300027907 Bacteria 26642
138 Ga0316179_1012668 3300030734 Bacteria 1427
139 Ga0316178_1002000 3300030735 Bacteria 20253
140 Ga0316183_1036010 3300030742 Bacteria 1605
141 Ga0307408_100100959 3300031548 Bacteria 2198
142 Ga0307408_101028850 3300031548 Bacteria 760
143 Ga0307405_10000596 3300031731 Bacteria 13860
144 Ga0307405_10000806 3300031731 Bacteria 12319
145 Ga0307405_10002850 3300031731 Bacteria 7771
146 Ga0307406_10026453 3300031901 Bacteria 3485
147 Ga0307412_10057345 3300031911 Bacteria 2599
148 Ga0307412_10521816 3300031911 Bacteria 992
149 Ga0307414_10037503 3300032004 Bacteria 3246
150 Ga0237819_00264 3300038705 Bacteria 19208
151 Ga0439438_000107 3300041405 Bacteria 38582
152 Ga0439438_001162 3300041405 Bacteria 11677
153 Ga0439438_013211 3300041405 Bacteria 2500
154 Ga0439447_000006 3300041407 Bacteria 101894
155 Ga0439447_000729 3300041407 Bacteria 12203
156 Ga0439447_001053 3300041407 Bacteria 10015
157 Ga0439447_002349 3300041407 Bacteria 6912
158 Ga0439447_004538 3300041407 Bacteria 4751
159 Ga0439466_0000036 3300041411 Bacteria 54279
160 Ga0439466_0000121 3300041411 Bacteria 30583
161 Ga0439466_0000224 3300041411 Bacteria 22371
162 Ga0439466_0000354 3300041411 Bacteria 17620
163 Ga0439466_0002829 3300041411 Bacteria 6793
164 Ga0439466_0060441 3300041411 Bacteria 1221
165 Ga0439432_000070 3300042006 Bacteria 31240
166 Ga0439432_000467 3300042006 Bacteria 15127
167 Ga0439432_004533 3300042006 Bacteria 5070
168 Ga0439451_000026 3300042009 Bacteria 32595
169 Ga0439452_000241 3300042010 Bacteria 37760
170 Ga0439452_000572 3300042010 Bacteria 19201
171 Ga0439452_066282 3300042010 Bacteria 801
172 Ga0439456_000035 3300042013 Bacteria 50951
173 Ga0439456_010855 3300042013 Bacteria 1883
174 Ga0439456_070467 3300042013 Bacteria 774
175 Ga0439463_000176 3300042016 Bacteria 16767
176 Ga0439463_000180 3300042016 Bacteria 16720
177 Ga0439463_011657 3300042016 Bacteria 2159
178 Ga0439463_012553 3300042016 Bacteria 2083
179 Ga0450911_006002 3300042115 Bacteria 1838
180 Ga0450905_000001 3300042142 Bacteria 51289
181 Ga0450906_000024 3300042145 Bacteria 27173
182 Ga0450907_000015 3300042146 Bacteria 85221
183 Ga0439446_0003047 3300042156 Bacteria 4107
184 Ga0450893_0003793 3300042532 Bacteria 2392
185 Ga0439440_0002233 3300042993 Bacteria 3627
186 Ga0495617_001809 3300046452 Bacteria 9104
187 Ga0495617_003535 3300046452 Bacteria 5850
188 Ga0495617_008850 3300046452 Bacteria 3464
189 Ga0495617_014041 3300046452 Bacteria 2722
190 Ga0495627_000244 3300046453 Bacteria 57194
191 Ga0495627_002243 3300046453 Bacteria 9571
192 Ga0495627_019677 3300046453 Bacteria 2260
193 Ga0495592_0000277 3300046454 Bacteria 43977
194 Ga0495603_0000015 3300046455 Bacteria 67608
195 Ga0495590_0000093 3300046457 Bacteria 55139
196 Ga0495590_0018216 3300046457 Bacteria 2516
197 Ga0495591_000191 3300046458 Bacteria 62737
198 Ga0495591_000418 3300046458 Bacteria 35269
199 Ga0495591_002948 3300046458 Bacteria 9086
200 Ga0495591_025982 3300046458 Bacteria 1828
201 Ga0495629_0115939 3300046459 Bacteria 1867
202 Ga0495629_0188327 3300046459 Bacteria 1429
203 Ga0495638_0000372 3300046460 Bacteria 55671
204 Ga0495638_0002771 3300046460 Bacteria 14084
205 Ga0495638_0004999 3300046460 Bacteria 9949
206 Ga0495638_0277901 3300046460 Bacteria 911
207 Ga0495638_0422956 3300046460 Bacteria 686
208 Ga0495650_0001331 3300046471 Bacteria 24756
209 Ga0495605_0000020 3300046474 Bacteria 254765
210 Ga0495605_0005300 3300046474 Bacteria 7521
211 Ga0495605_0025274 3300046474 Bacteria 3096
212 Ga0495584_0006183 3300046491 Bacteria 6290
213 Ga0495584_0012524 3300046491 Bacteria 4330
214 Ga0495584_0030978 3300046491 Bacteria 2707
215 Ga0495585_0000182 3300046492 Bacteria 66842
216 Ga0495585_0004872 3300046492 Bacteria 8606
217 Ga0495585_0006409 3300046492 Bacteria 7308
218 Ga0495585_0006454 3300046492 Bacteria 7274
219 Ga0495585_0011998 3300046492 Bacteria 5114
220 Ga0495607_0000255 3300046501 Bacteria 57210
221 Ga0495607_0000670 3300046501 Bacteria 33214
222 Ga0495607_0006076 3300046501 Bacteria 8538
223 Ga0495607_0017470 3300046501 Bacteria 4603
224 Ga0495607_0043749 3300046501 Bacteria 2646
225 Ga0495607_0152029 3300046501 Bacteria 1184
226 Ga0495583_0000393 3300046506 Bacteria 66835
227 Ga0495606_0002985 3300046507 Bacteria 18594
228 Ga0495606_0055011 3300046507 Bacteria 2575
229 Ga0495610_0000551 3300046512 Bacteria 37502
230 Ga0495610_0045518 3300046512 Bacteria 2171
231 Ga0495610_0049486 3300046512 Bacteria 2058
232 Ga0495616_0002982 3300046513 Bacteria 10994
233 Ga0495616_0033598 3300046513 Bacteria 2670
234 Ga0495616_0055930 3300046513 Bacteria 1951
235 Ga0495616_0148175 3300046513 Bacteria 1063
236 Ga0495620_0004885 3300046515 Bacteria 7527
237 Ga0495631_0000905 3300046518 Bacteria 18463
238 Ga0495632_0000266 3300046519 Bacteria 52024
239 Ga0495632_0000438 3300046519 Bacteria 39688
240 Ga0495632_0001948 3300046519 Bacteria 16486
241 Ga0495632_0003623 3300046519 Bacteria 10855
242 Ga0495632_0020008 3300046519 Bacteria 3635
243 Ga0495632_0035478 3300046519 Bacteria 2544
244 Ga0495632_0144890 3300046519 Bacteria 1100
245 Ga0495637_0000136 3300046520 Bacteria 55157
246 Ga0495637_0000190 3300046520 Bacteria 48103
247 Ga0495637_0000869 3300046520 Bacteria 19687
248 Ga0495637_0061160 3300046520 Bacteria 1544
249 Ga0495643_0000128 3300046522 Bacteria 122550
250 Ga0495643_0000381 3300046522 Bacteria 58799
251 Ga0495643_0000803 3300046522 Bacteria 34595
252 Ga0495643_0003752 3300046522 Bacteria 10992
253 Ga0495643_0056801 3300046522 Bacteria 2088
254 Ga0495643_0121213 3300046522 Bacteria 1321
255 Ga0495644_0002283 3300046523 Bacteria 7669
256 Ga0495644_0003260 3300046523 Bacteria 6415
257 Ga0495644_0011025 3300046523 Bacteria 3484
258 Ga0495648_0000284 3300046524 Bacteria 57498
259 Ga0495648_0000927 3300046524 Bacteria 30514
260 Ga0495648_0007289 3300046524 Bacteria 8872
261 Ga0495648_0118414 3300046524 Bacteria 1428
262 Ga0495666_0000028 3300046526 Bacteria 54995
263 Ga0495666_0004608 3300046526 Bacteria 6970
264 Ga0495642_0000042 3300046528 Bacteria 75891
265 Ga0495654_0000229 3300046530 Bacteria 52203
266 Ga0495654_0001075 3300046530 Bacteria 19908
267 Ga0495654_0001174 3300046530 Bacteria 18649
268 Ga0495654_0001430 3300046530 Bacteria 16428
269 Ga0495654_0001837 3300046530 Bacteria 14144
270 Ga0495654_0007965 3300046530 Bacteria 5884
271 Ga0495654_0010565 3300046530 Bacteria 5023
272 Ga0495654_0014311 3300046530 Bacteria 4224
273 Ga0495654_0034209 3300046530 Bacteria 2566
274 Ga0495654_0073018 3300046530 Bacteria 1623
275 Ga0495609_0000205 3300046538 Bacteria 58818
276 Ga0495609_0000301 3300046538 Bacteria 45226
277 Ga0495609_0028437 3300046538 Bacteria 2550
278 Ga0495597_0002643 3300046542 Bacteria 11110
279 Ga0495597_0017312 3300046542 Bacteria 3394
280 Ga0495597_0146438 3300046542 Bacteria 971
281 Ga0495622_0000728 3300046557 Bacteria 18618
282 Ga0495622_0370326 3300046557 Bacteria 619
283 Ga0495668_0000328 3300046616 Bacteria 64806
284 Ga0495668_0000594 3300046616 Bacteria 43998
285 Ga0495668_0046646 3300046616 Bacteria 2407
286 Ga0495625_0001201 3300046660 Bacteria 32943
287 Ga0495625_0001690 3300046660 Bacteria 25714
288 Ga0495625_0012605 3300046660 Bacteria 6841
289 Ga0495625_0013123 3300046660 Bacteria 6676
290 Ga0495625_0028269 3300046660 Bacteria 4207
291 Ga0495625_0048965 3300046660 Bacteria 3039
292 Ga0495625_0188622 3300046660 Bacteria 1367
293 Ga0495659_0000099 3300046664 Bacteria 38226
294 Ga0495661_0000163 3300046665 Bacteria 78896
295 Ga0495661_0002441 3300046665 Bacteria 14313
296 Ga0495661_0151710 3300046665 Bacteria 1251
297 Ga0495661_0287266 3300046665 Bacteria 827
298 Ga0495669_0004536 3300046684 Bacteria 5744
299 Ga0495669_0017971 3300046684 Bacteria 3036
300 Ga0495613_0000182 3300046689 Bacteria 61411
301 Ga0495624_0102066 3300046690 Bacteria 1766
302 Ga0495670_0002456 3300046691 Bacteria 9155
303 Ga0495670_0010289 3300046691 Bacteria 4595
304 Ga0495670_0076017 3300046691 Bacteria 1706
305 Ga0495670_0245842 3300046691 Bacteria 953
306 Ga0495671_0000284 3300046692 Bacteria 42448
307 Ga0495671_0005120 3300046692 Bacteria 7714
308 Ga0495671_0090758 3300046692 Bacteria 1495
309 Ga0495649_0000103 3300046694 Bacteria 75113
310 Ga0495649_0000310 3300046694 Bacteria 42647
311 Ga0495649_0014342 3300046694 Bacteria 4545
312 Ga0495649_0019584 3300046694 Bacteria 3802
313 Ga0495649_0033728 3300046694 Bacteria 2817
314 Ga0495649_0071248 3300046694 Bacteria 1863
315 Ga0495649_0191557 3300046694 Bacteria 1064
316 Ga0495649_0193041 3300046694 Bacteria 1059
317 Ga0495649_0246262 3300046694 Bacteria 919
318 Ga0495589_0000520 3300046794 Bacteria 27048
319 Ga0495589_0000902 3300046794 Bacteria 18342
320 Ga0495589_0001067 3300046794 Bacteria 16448
321 Ga0495589_0003589 3300046794 Bacteria 8384
322 Ga0495600_0006383 3300046809 Bacteria 7176
323 Ga0495660_0008581 3300046810 Bacteria 5979
324 Ga0495660_0011043 3300046810 Bacteria 5244
325 Ga0495660_0012348 3300046810 Bacteria 4956
326 Ga0495660_0012823 3300046810 Bacteria 4861
327 Ga0495660_0014024 3300046810 Bacteria 4646
328 Ga0495660_0019452 3300046810 Bacteria 3899
329 Ga0495660_0096853 3300046810 Bacteria 1524
330 Ga0495672_0000268 3300047320 Bacteria 72131
331 Ga0495672_0000318 3300047320 Bacteria 64020
332 Ga0495672_0000709 3300047320 Bacteria 36671
333 Ga0495672_0070625 3300047320 Bacteria 1978
334 Ga0495672_0113243 3300047320 Bacteria 1453
335 Ga0495680_0003372 3300047322 Bacteria 15785
336 Ga0495680_0007255 3300047322 Bacteria 10204
337 Ga0495680_0019917 3300047322 Bacteria 5655
338 Ga0495680_0315012 3300047322 Bacteria 1096
339 Ga0495683_0000731 3300047323 Bacteria 23833
340 Ga0495683_0001722 3300047323 Bacteria 13869
341 Ga0495683_0001963 3300047323 Bacteria 12834
342 Ga0495683_0001971 3300047323 Bacteria 12815
343 Ga0495677_0000879 3300047445 Bacteria 12148
344 Ga0495685_002726 3300047447 Bacteria 5571
345 Ga0495673_0000276 3300047469 Bacteria 69967
346 Ga0495673_0000281 3300047469 Bacteria 68886
347 Ga0495673_0000732 3300047469 Bacteria 31449
348 Ga0495673_0000764 3300047469 Bacteria 30514
349 Ga0495673_0002249 3300047469 Bacteria 13862
350 Ga0495681_0000097 3300047470 Bacteria 76004
351 Ga0495681_0000124 3300047470 Bacteria 67763
352 Ga0495681_0000367 3300047470 Bacteria 35217
353 Ga0495681_0002355 3300047470 Bacteria 13567
354 Ga0495681_0005913 3300047470 Bacteria 8117
355 Ga0495681_0043004 3300047470 Bacteria 2182
356 Ga0495686_0000546 3300047472 Bacteria 53799
357 Ga0495686_0136709 3300047472 Bacteria 1449
358 Ga0495593_0000260 3300047673 Bacteria 28520
359 Ga0495593_0004162 3300047673 Bacteria 8614
360 Ga0495602_0010283 3300048088 Bacteria 9715
361 Ga0495626_0000045 3300048091 Bacteria 164931
362 Ga0495626_0000442 3300048091 Bacteria 42376
363 Ga0495626_0000690 3300048091 Bacteria 32282
364 Ga0495626_0005696 3300048091 Bacteria 7207
365 Ga0495626_0025108 3300048091 Bacteria 2916
366 Ga0495626_0028320 3300048091 Bacteria 2717
367 Ga0496116_0000207 3300048919 Bacteria 111531
368 Ga0496116_0000603 3300048919 Bacteria 47538
369 Ga0496116_0029145 3300048919 Bacteria 3985
370 Ga0496117_0002289 3300048920 Bacteria 24708
371 Ga0496117_0002888 3300048920 Bacteria 20832
372 Ga0496117_0006564 3300048920 Bacteria 11706
373 Ga0496117_0009488 3300048920 Bacteria 9045
374 Ga0496117_0073769 3300048920 Bacteria 2275
375 Ga0496117_0347307 3300048920 Bacteria 767
376 Ga0496117_0405700 3300048920 Bacteria 686
377 Ga0496118_0001038 3300048921 Bacteria 43279
378 Ga0496118_0002132 3300048921 Bacteria 27641
379 Ga0496118_0022235 3300048921 Bacteria 5552
380 Ga0496118_0024269 3300048921 Bacteria 5242
381 Ga0496118_0127374 3300048921 Bacteria 1643
382 Ga0496118_0164193 3300048921 Bacteria 1368
383 Ga0496119_0000120 3300048922 Bacteria 109767
384 Ga0496119_0036952 3300048922 Bacteria 3180
385 Ga0496120_0000540 3300048923 Bacteria 57943
386 Ga0496120_0009974 3300048923 Bacteria 6677
387 Ga0496120_0112741 3300048923 Bacteria 1418
388 Ga0496121_0004216 3300048924 Bacteria 19597
389 Ga0496121_0006691 3300048924 Bacteria 14167
390 Ga0496121_0008826 3300048924 Bacteria 11739
391 Ga0496122_0001523 3300048925 Bacteria 36892
392 Ga0496122_0209552 3300048925 Bacteria 1130
393 Ga0496123_0000683 3300048926 Bacteria 55914
394 Ga0496123_0013704 3300048926 Bacteria 6780
395 Ga0496124_0001102 3300048927 Bacteria 42451
396 Ga0496124_0003445 3300048927 Bacteria 19347
397 Ga0496124_0021065 3300048927 Bacteria 6012
398 Ga0496124_0054262 3300048927 Bacteria 3393
399 Ga0496124_0104485 3300048927 Bacteria 2290
400 Ga0496124_0177553 3300048927 Bacteria 1642
401 Ga0496125_0001262 3300048928 Bacteria 37739
402 Ga0496125_0001332 3300048928 Bacteria 36457
403 Ga0496125_0004139 3300048928 Bacteria 16935
404 Ga0496125_0004993 3300048928 Bacteria 14979
405 Ga0496125_0008514 3300048928 Bacteria 10723
406 Ga0496125_0011807 3300048928 Bacteria 8704
407 Ga0496125_0041436 3300048928 Bacteria 3936
408 Ga0496125_0057541 3300048928 Bacteria 3147
409 Ga0495678_000289 3300049459 Bacteria 55364
410 Ga0495678_023354 3300049459 Bacteria 2688
411 Ga0495682_0000143 3300049460 Bacteria 62210
412 Ga0495682_0001702 3300049460 Bacteria 11187
413 Ga0495682_0006549 3300049460 Bacteria 4706
414 Ga0495682_0015208 3300049460 Bacteria 2916
415 Ga0495682_0021811 3300049460 Bacteria 2398
416 Ga0495682_0029815 3300049460 Bacteria 2021
417 Ga0495682_0031475 3300049460 Bacteria 1960
418 Ga0501034_0571774 3300049571 Bacteria 1038
419 Ga0501227_001109 3300049665 Bacteria 5989
420 Ga0501235_036049 3300049669 Bacteria 1124
421 Ga0501252_006015 3300049682 Bacteria 1337
422 Ga0501226_000399 3300049853 Bacteria 6286
423 Ga0500572_000011 3300053111 Bacteria 64261
424 2511274597 2511231007 Bacteria 6306603
425 2511296074 2511231011 Bacteria 6149768
426 2511366474 2511231023 Bacteria 6808468
427 2555670757 2554235341 Bacteria 6867980
428 2599357690 2599185160 Bacteria 6844013
429 2599382595 2599185164 Bacteria 6841688
430 2599389042 2599185165 Bacteria 6843250
431 2599463822 2599185181 Bacteria 6844519
432 2599492842 2599185186 Bacteria 6831633
433 2599982303 2599185309 Bacteria 5969593
434 2600216959 2599185356 Bacteria 6843884
435 2601777130 2600255313 Bacteria 6842543
436 2621299044 2619619299 Bacteria 6649820
437 2643874022 2643221571 Bacteria 6228673
438 2644185702 2643221633 Bacteria 6733554
439 2715759433 2713897149 Bacteria 6506249
440 2723249227 2721755607 Bacteria 5841722
441 2784264740 2784132063 Bacteria 6262788
442 2794597459 2791355520 Bacteria 5948615
443 2808927069 2808606376 Bacteria 6248667
444 2808927875 2808606377 Bacteria 6646337
445 2808949188 2808606380 Bacteria 6248705
446 2808949585 2808606381 Bacteria 6646461
447 2817492229 2816332298 Bacteria 6852809
448 2842830384 2842826826 Bacteria 5974129
449 2842854843 2842854478 Bacteria 6143501
450 2852614771 2852612431 Bacteria 6885235
451 2852667490 2852667396 Bacteria 6885555
452 2880233220 2880230671 Bacteria 6140320
453 2900052162 2900051742 Bacteria 4985156
454 2904522051 2904518522 Bacteria 6068986
455 2917074594 2917070673 Bacteria 6868303
456 2919390312 2919385768 Bacteria 5897293
457 2919491607 2919487758 Bacteria 5929766
458 2919703067 2919697872 Bacteria 6553725
459 2939656960 2939651529 Bacteria 5895393
460 2974291175 2974289157 Bacteria 6080362
461 2984288998 2984286254 Bacteria 6702062
462 2998142015 2998139840 Bacteria 6073514
463 3007513479 3007511990 Bacteria 6481491
464 3007616081 3007614139 Bacteria 6053559
465 3007869542 3007866637 Bacteria 5899198
466 637321106 637000220 Bacteria 7074893
467 8054348683 8054347763 Bacteria 5901107
468 8055882125 8055878733 Bacteria 5907058
469 Ga0495597_0050207
470 MRS1b_contig_8706904
471 JGI25154J39366_1003733
472 rootL2_10000530
473 Ga0055539_1000348
474 Ga0055533_1000340
475 Ga0055532_1000419
476 Ga0055525_1000490
477 Ga0055535_1006581
478 Ga0055534_1018171
479 Ga0055530_10000703
480 Ga0055540_1000623
481 Ga0055540_1000743
482 Ga0055541_1000240
483 Ga0065714_10007046
484 Ga0065714_10009840
485 Ga0065714_10011990
486 Ga0065714_10064791
487 Ga0065714_10077089
488 Ga0065714_10147193
489 Ga0065714_10212418
490 Ga0065704_10090511
491 Ga0065712_10005942
492 Ga0065712_10084107
493 Ga0065712_10100648
494 Ga0070670_100000636
495 Ga0070662_100005392
496 Ga0070664_100000201
497 Ga0068851_10003434
498 Ga0075432_10004265
499 Ga0079104_1000730
500 Ga0079104_1000878
501 Ga0079104_1013641
502 Ga0079104_1014902
503 Ga0105251_10041288
504 Ga0105251_10048598
505 Ga0105244_10007470
506 Ga0105244_10036755
507 Ga0105244_10059827
508 Ga0105250_10021250
509 Ga0105237_10000413
510 Ga0105246_10002457
511 Ga0105246_10005408
512 Ga0157373_10000594
513 Ga0157373_10002562
514 Ga0157373_10008095
515 Ga0157373_10014454
516 Ga0157373_10019046
517 Ga0157373_10032327
518 Ga0157371_10000515
519 Ga0157371_10002800
520 Ga0157371_10020270
521 Ga0157371_10023457
522 Ga0157371_10048472
523 Ga0157371_10059478
524 Ga0157370_10006088
525 Ga0157370_10007330
526 Ga0157370_10019115
527 Ga0157370_10021368
528 Ga0157370_10027526
529 Ga0157370_10135427
530 Ga0157370_10288558
531 Ga0157370_10819374
532 Ga0157369_10001400
533 Ga0157369_10006462
534 Ga0157369_10053904
535 Ga0157369_10089925
536 Ga0157369_10174112
537 Ga0163162_10095904
538 Ga0163162_10099451
539 Ga0157372_10000261
540 Ga0157372_10400492
541 Ga0157375_10000471
542 Ga0157375_10020355
543 Ga0157375_10046943
544 Ga0182008_10001776
545 Ga0182008_10006137
546 Ga0182008_10006568
547 Ga0182008_10070304
548 Ga0182008_10088765
549 Ga0182008_10109219
550 Ga0182008_10311129
551 Ga0182006_1001203
552 Ga0182006_1001761
553 Ga0182006_1001798
554 Ga0182006_1013203
555 Ga0182006_1025294
556 Ga0182007_10000115
557 Ga0182007_10000242
558 Ga0182007_10007640
559 Ga0182007_10018447
560 Ga0182007_10039466
561 Ga0182007_10079356
562 Ga0182005_1000452
563 Ga0182005_1002004
564 Ga0182005_1002751
565 Ga0182005_1007085
566 Ga0182005_1010172
567 Ga0163161_10356261
568 Ga0209784_100368
569 Ga0209566_100664
570 Ga0209674_100420
571 Ga0209147_100549
572 Ga0209563_100296
573 Ga0209437_101174
574 Ga0209258_100754
575 Ga0209646_1000464
576 Ga0209026_1026571
577 Ga0209677_100561
578 Ga0209675_1008531
579 Ga0209676_1000003
580 Ga0209050_1000004
581 Ga0209050_1000079
582 Ga0209050_1007915
583 Ga0209256_1001780
584 Ga0209051_1000006
585 Ga0209051_1000054
586 Ga0209257_1008525
587 Ga0207656_10021279
588 Ga0207696_1000045
589 Ga0207655_1007431
590 Ga0207655_1010548
591 Ga0207655_1104446
592 Ga0207713_1000259
593 Ga0207713_1033267
594 Ga0207713_1038157
595 Ga0207671_10001061
596 Ga0207649_10000183
597 Ga0207650_10000369
598 Ga0207706_10039996
599 Ga0207679_10000016
600 Ga0209281_1000015
601 Ga0209281_1000018
602 Ga0209281_1000450
603 Ga0209281_1014078
604 Ga0209281_1017263
605 Ga0207428_10001296
606 Ga0316179_1012668
607 Ga0316178_1002000
608 Ga0316183_1036010
609 Ga0307408_100100959
610 Ga0307408_101028850
611 Ga0307405_10000596
612 Ga0307405_10000806
613 Ga0307405_10002850
614 Ga0307406_10026453
615 Ga0307412_10057345
616 Ga0307412_10521816
617 Ga0307414_10037503
618 Ga0237819_00264
619 Ga0439438_000107
620 Ga0439438_001162
621 Ga0439438_013211
622 Ga0439447_000006
623 Ga0439447_000729
624 Ga0439447_001053
625 Ga0439447_002349
626 Ga0439447_004538
627 Ga0439466_0000036
628 Ga0439466_0000121
629 Ga0439466_0000224
630 Ga0439466_0000354
631 Ga0439466_0002829
632 Ga0439466_0060441
633 Ga0439432_000070
634 Ga0439432_000467
635 Ga0439432_004533
636 Ga0439451_000026
637 Ga0439452_000241
638 Ga0439452_000572
639 Ga0439452_066282
640 Ga0439456_000035
641 Ga0439456_010855
642 Ga0439456_070467
643 Ga0439463_000176
644 Ga0439463_000180
645 Ga0439463_011657
646 Ga0439463_012553
647 Ga0450911_006002
648 Ga0450905_000001
649 Ga0450906_000024
650 Ga0450907_000015
651 Ga0439446_0003047
652 Ga0450893_0003793
653 Ga0439440_0002233
654 Ga0495617_001809
655 Ga0495617_003535
656 Ga0495617_008850
657 Ga0495617_014041
658 Ga0495627_000244
659 Ga0495627_002243
660 Ga0495627_019677
661 Ga0495592_0000277
662 Ga0495603_0000015
663 Ga0495590_0000093
664 Ga0495590_0018216
665 Ga0495591_000191
666 Ga0495591_000418
667 Ga0495591_002948
668 Ga0495591_025982
669 Ga0495629_0115939
670 Ga0495629_0188327
671 Ga0495638_0000372
672 Ga0495638_0002771
673 Ga0495638_0004999
674 Ga0495638_0277901
675 Ga0495638_0422956
676 Ga0495650_0001331
677 Ga0495605_0000020
678 Ga0495605_0005300
679 Ga0495605_0025274
680 Ga0495584_0006183
681 Ga0495584_0012524
682 Ga0495584_0030978
683 Ga0495585_0000182
684 Ga0495585_0004872
685 Ga0495585_0006409
686 Ga0495585_0006454
687 Ga0495585_0011998
688 Ga0495607_0000255
689 Ga0495607_0000670
690 Ga0495607_0006076
691 Ga0495607_0017470
692 Ga0495607_0043749
693 Ga0495607_0152029
694 Ga0495583_0000393
695 Ga0495606_0002985
696 Ga0495606_0055011
697 Ga0495610_0000551
698 Ga0495610_0045518
699 Ga0495610_0049486
700 Ga0495616_0002982
701 Ga0495616_0033598
702 Ga0495616_0055930
703 Ga0495616_0148175
704 Ga0495620_0004885
705 Ga0495631_0000905
706 Ga0495632_0000266
707 Ga0495632_0000438
708 Ga0495632_0001948
709 Ga0495632_0003623
710 Ga0495632_0020008
711 Ga0495632_0035478
712 Ga0495632_0144890
713 Ga0495637_0000136
714 Ga0495637_0000190
715 Ga0495637_0000869
716 Ga0495637_0061160
717 Ga0495643_0000128
718 Ga0495643_0000381
719 Ga0495643_0000803
720 Ga0495643_0003752
721 Ga0495643_0056801
722 Ga0495643_0121213
723 Ga0495644_0002283
724 Ga0495644_0003260
725 Ga0495644_0011025
726 Ga0495648_0000284
727 Ga0495648_0000927
728 Ga0495648_0007289
729 Ga0495648_0118414
730 Ga0495666_0000028
731 Ga0495666_0004608
732 Ga0495642_0000042
733 Ga0495654_0000229
734 Ga0495654_0001075
735 Ga0495654_0001174
736 Ga0495654_0001430
737 Ga0495654_0001837
738 Ga0495654_0007965
739 Ga0495654_0010565
740 Ga0495654_0014311
741 Ga0495654_0034209
742 Ga0495654_0073018
743 Ga0495609_0000205
744 Ga0495609_0000301
745 Ga0495609_0028437
746 Ga0495597_0002643
747 Ga0495597_0017312
748 Ga0495597_0146438
749 Ga0495622_0000728
750 Ga0495622_0370326
751 Ga0495668_0000328
752 Ga0495668_0000594
753 Ga0495668_0046646
754 Ga0495625_0001201
755 Ga0495625_0001690
756 Ga0495625_0012605
757 Ga0495625_0013123
758 Ga0495625_0028269
759 Ga0495625_0048965
760 Ga0495625_0188622
761 Ga0495659_0000099
762 Ga0495661_0000163
763 Ga0495661_0002441
764 Ga0495661_0151710
765 Ga0495661_0287266
766 Ga0495669_0004536
767 Ga0495669_0017971
768 Ga0495613_0000182
769 Ga0495624_0102066
770 Ga0495670_0002456
771 Ga0495670_0010289
772 Ga0495670_0076017
773 Ga0495670_0245842
774 Ga0495671_0000284
775 Ga0495671_0005120
776 Ga0495671_0090758
777 Ga0495649_0000103
778 Ga0495649_0000310
779 Ga0495649_0014342
780 Ga0495649_0019584
781 Ga0495649_0033728
782 Ga0495649_0071248
783 Ga0495649_0191557
784 Ga0495649_0193041
785 Ga0495649_0246262
786 Ga0495589_0000520
787 Ga0495589_0000902
788 Ga0495589_0001067
789 Ga0495589_0003589
790 Ga0495600_0006383
791 Ga0495660_0008581
792 Ga0495660_0011043
793 Ga0495660_0012348
794 Ga0495660_0012823
795 Ga0495660_0014024
796 Ga0495660_0019452
797 Ga0495660_0096853
798 Ga0495672_0000268
799 Ga0495672_0000318
800 Ga0495672_0000709
801 Ga0495672_0070625
802 Ga0495672_0113243
803 Ga0495680_0003372
804 Ga0495680_0007255
805 Ga0495680_0019917
806 Ga0495680_0315012
807 Ga0495683_0000731
808 Ga0495683_0001722
809 Ga0495683_0001963
810 Ga0495683_0001971
811 Ga0495677_0000879
812 Ga0495685_002726
813 Ga0495673_0000276
814 Ga0495673_0000281
815 Ga0495673_0000732
816 Ga0495673_0000764
817 Ga0495673_0002249
818 Ga0495681_0000097
819 Ga0495681_0000124
820 Ga0495681_0000367
821 Ga0495681_0002355
822 Ga0495681_0005913
823 Ga0495681_0043004
824 Ga0495686_0000546
825 Ga0495686_0136709
826 Ga0495593_0000260
827 Ga0495593_0004162
828 Ga0495602_0010283
829 Ga0495626_0000045
830 Ga0495626_0000442
831 Ga0495626_0000690
832 Ga0495626_0005696
833 Ga0495626_0025108
834 Ga0495626_0028320
835 Ga0496116_0000207
836 Ga0496116_0000603
837 Ga0496116_0029145
838 Ga0496117_0002289
839 Ga0496117_0002888
840 Ga0496117_0006564
841 Ga0496117_0009488
842 Ga0496117_0073769
843 Ga0496117_0347307
844 Ga0496117_0405700
845 Ga0496118_0001038
846 Ga0496118_0002132
847 Ga0496118_0022235
848 Ga0496118_0024269
849 Ga0496118_0127374
850 Ga0496118_0164193
851 Ga0496119_0000120
852 Ga0496119_0036952
853 Ga0496120_0000540
854 Ga0496120_0009974
855 Ga0496120_0112741
856 Ga0496121_0004216
857 Ga0496121_0006691
858 Ga0496121_0008826
859 Ga0496122_0001523
860 Ga0496122_0209552
861 Ga0496123_0000683
862 Ga0496123_0013704
863 Ga0496124_0001102
864 Ga0496124_0003445
865 Ga0496124_0021065
866 Ga0496124_0054262
867 Ga0496124_0104485
868 Ga0496124_0177553
869 Ga0496125_0001262
870 Ga0496125_0001332
871 Ga0496125_0004139
872 Ga0496125_0004993
873 Ga0496125_0008514
874 Ga0496125_0011807
875 Ga0496125_0041436
876 Ga0496125_0057541
877 Ga0495678_000289
878 Ga0495678_023354
879 Ga0495682_0000143
880 Ga0495682_0001702
881 Ga0495682_0006549
882 Ga0495682_0015208
883 Ga0495682_0021811
884 Ga0495682_0029815
885 Ga0495682_0031475
886 Ga0501034_0571774
887 Ga0501227_001109
888 Ga0501235_036049
889 Ga0501252_006015
890 Ga0501226_000399
891 Ga0500572_000011
892 2511274597
893 2511296074
894 2511366474
895 2555670757
896 2599357690
897 2599382595
898 2599389042
899 2599463822
900 2599492842
901 2599982303
902 2600216959
903 2601777130
904 2621299044
905 2643874022
906 2644185702
907 2715759433
908 2723249227
909 2784264740
910 2794597459
911 2808927069
912 2808927875
913 2808949188
914 2808949585
915 2817492229
916 2842830384
917 2842854843
918 2852614771
919 2852667490
920 2880233220
921 2900052162
922 2904522051
923 2917074594
924 2919390312
925 2919491607
926 2919703067
927 2939656960
928 2974291175
929 2984288998
930 2998142015
931 3007513479
932 3007616081
933 3007869542
934 637321106
935 8054348683
936 8055882125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18894

PhageMetallopep

Putative phage metallopeptidase

55

210

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3in9-assembly1.cif.gz_A crystal structure of heparin lyase i complexed with disaccharide heparin 0.8609 130 153
3ikw-assembly1.cif.gz_A structure of heparinase i from bacteroides thetaiotaomicron 0.7145 130 152
3ina-assembly1.cif.gz_A crystal structure of heparin lyase i h151a mutant complexed with a dodecasaccharide heparin 0.7035 123 152
3ilr-assembly1.cif.gz_A structure of heparinase i from bacteroides thetaiotaomicron in complex with tetrasaccharide product 0.6754 130 152
6ut3-assembly1.cif.gz_B x-ray structure of thermococcus gammatolerans mcrb aaa+ domain hexamer in p21 symmetry 0.4652 129 167
ID Description Score Start End Superfamily
3inaA02 Alpha Beta;Roll;duf1285 like fold; 0.8127 130 152 3.10.540.20
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.772 101 129 3.30.2010.10
af_A0A1D6I433_58_177_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7528 46 129 3.30.2010.10
af_P25894_60_145_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7302 103 129 3.30.2010.10
af_A0A1D6JTF3_15_142_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7059 52 129 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A3A4A4V1-F1-model_v4 deleted 0.9748 2 129
AF-A0A3M4AVS5-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9737 2 129
AF-A0A351NIN4-F1-model_v4 deleted 0.965 2 155
AF-A0A3A8FJT5-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9253 1 113
AF-A0A6I4ILQ0-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9234 1 154

Map