F450109

General Info

Members Datasets Scaffolds Average Seq Length
468 258 468 76

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0237748|Ga0495667_0237748_560_814
Length 84
Sequence VTERPEIDQMVGRLLGPSAPEVGCDECFDELDRFVELDLAGRDADAAIPGLRAHLAGCPACREEYESLRALVASDAGVDAPPGD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
166 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 8.33
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10204812 3300003320 Bacteria 1986
2 JGI25405J52794_10048495 3300003911 Bacteria 907
3 Ga0070658_10548724 3300005327 Bacteria 1000
4 Ga0070676_11026013 3300005328 Bacteria 620
5 Ga0070683_100006939 3300005329 Bacteria 9521
6 Ga0070683_100152490 3300005329 Bacteria 2191
7 Ga0070683_101143408 3300005329 Bacteria 748
8 Ga0070683_102114605 3300005329 Bacteria 541
9 Ga0070670_100598472 3300005331 Bacteria 986
10 Ga0070666_11073371 3300005335 Bacteria 598
11 Ga0070680_100616405 3300005336 Bacteria 932
12 Ga0070680_100829850 3300005336 Bacteria 797
13 Ga0070680_100881340 3300005336 Unclassified 772
14 Ga0070682_100409716 3300005337 Bacteria 1027
15 Ga0068868_100070196 3300005338 Bacteria 2793
16 Ga0068868_100532775 3300005338 Bacteria 1033
17 Ga0070660_100699142 3300005339 Bacteria 850
18 Ga0070691_10069720 3300005341 Unclassified 1705
19 Ga0070687_100274651 3300005343 Bacteria 1058
20 Ga0070687_100629241 3300005343 Bacteria 741
21 Ga0070661_100120734 3300005344 Bacteria 1963
22 Ga0070668_100954719 3300005347 Bacteria 769
23 Ga0070675_100367744 3300005354 Bacteria 1278
24 Ga0070675_100473470 3300005354 Bacteria 1126
25 Ga0070671_100026115 3300005355 Bacteria 4798
26 Ga0070674_100296188 3300005356 Unclassified 1288
27 Ga0070673_101765473 3300005364 Bacteria 586
28 Ga0070714_100042957 3300005435 Bacteria 3820
29 Ga0070714_100588164 3300005435 Bacteria 1068
30 Ga0070713_100113264 3300005436 Bacteria 2368
31 Ga0070711_100017562 3300005439 Unclassified 4558
32 Ga0070711_100514255 3300005439 Bacteria 989
33 Ga0070705_100583897 3300005440 Bacteria 862
34 Ga0070700_100381899 3300005441 Bacteria 1054
35 Ga0070708_102242757 3300005445 Bacteria 504
36 Ga0070678_100274732 3300005456 Unclassified 1422
37 Ga0070678_100991016 3300005456 Bacteria 772
38 Ga0070678_101971627 3300005456 Unclassified 552
39 Ga0070681_10177344 3300005458 Bacteria 2053
40 Ga0070681_10198916 3300005458 Bacteria 1923
41 Ga0070681_10332184 3300005458 Bacteria 1430
42 Ga0070698_100818805 3300005471 Bacteria 875
43 Ga0070679_100038323 3300005530 Bacteria 4764
44 Ga0070679_100331416 3300005530 Bacteria 1470
45 Ga0070679_100780486 3300005530 Bacteria 899
46 Ga0070684_100098139 3300005535 Bacteria 2613
47 Ga0070684_100205084 3300005535 Bacteria 1796
48 Ga0068853_102490858 3300005539 Bacteria 501
49 Ga0070672_100270699 3300005543 Bacteria 1434
50 Ga0070686_100069268 3300005544 Unclassified 2304
51 Ga0070696_100879762 3300005546 Unclassified 742
52 Ga0070693_100004354 3300005547 Bacteria 6684
53 Ga0070693_100745762 3300005547 Unclassified 721
54 Ga0070693_101632965 3300005547 Bacteria 507
55 Ga0070704_100003595 3300005549 Bacteria 8910
56 Ga0070664_100009206 3300005564 Bacteria 8017
57 Ga0070664_102079426 3300005564 Bacteria 539
58 Ga0068857_100130838 3300005577 Bacteria 2263
59 Ga0068857_100411943 3300005577 Bacteria 1259
60 Ga0068857_100427517 3300005577 Bacteria 1236
61 Ga0068854_100038961 3300005578 Bacteria 3345
62 Ga0068854_100504148 3300005578 Bacteria 1020
63 Ga0068854_101803971 3300005578 Bacteria 561
64 Ga0068856_100006197 3300005614 Bacteria 11733
65 Ga0068856_100626505 3300005614 Unclassified 1096
66 Ga0068856_100868709 3300005614 Bacteria 921
67 Ga0068856_101901928 3300005614 Bacteria 606
68 Ga0070702_100071723 3300005615 Bacteria 2048
69 Ga0068852_102469686 3300005616 Bacteria 540
70 Ga0068864_100021045 3300005618 Bacteria 5462
71 Ga0068864_101260044 3300005618 Bacteria 739
72 Ga0068870_10701847 3300005840 Unclassified 698
73 Ga0068858_100472101 3300005842 Unclassified 1210
74 Ga0068862_100267591 3300005844 Bacteria 1562
75 Ga0068862_101113829 3300005844 Bacteria 785
76 Ga0081455_10038797 3300005937 Bacteria 4216
77 Ga0081455_10220790 3300005937 Bacteria 1405
78 Ga0081455_10516257 3300005937 Bacteria 798
79 Ga0081455_10571147 3300005937 Bacteria 743
80 Ga0081538_10062341 3300005981 Bacteria 2127
81 Ga0081538_10106037 3300005981 Bacteria 1397
82 Ga0081538_10251586 3300005981 Bacteria 673
83 Ga0081539_10006841 3300005985 Bacteria 10664
84 Ga0070717_10417967 3300006028 Bacteria 1206
85 Ga0075365_10196528 3300006038 Unclassified 1412
86 Ga0075368_10036139 3300006042 Bacteria 1929
87 Ga0075364_10045982 3300006051 Bacteria 2841
88 Ga0070716_100095215 3300006173 Bacteria 1812
89 Ga0070716_101035641 3300006173 Bacteria 651
90 Ga0070712_100004685 3300006175 Bacteria 8454
91 Ga0070712_100093938 3300006175 Bacteria 2203
92 Ga0075367_10076818 3300006178 Bacteria 2016
93 Ga0075367_10475592 3300006178 Bacteria 792
94 Ga0075366_10507487 3300006195 Bacteria 746
95 Ga0097621_100972260 3300006237 Bacteria 793
96 Ga0068871_101258432 3300006358 Bacteria 695
97 Ga0068871_101537845 3300006358 Unclassified 629
98 Ga0075430_100609397 3300006846 Bacteria 901
99 Ga0075431_101786465 3300006847 Unclassified 571
100 Ga0075434_100683946 3300006871 Bacteria 1044
101 Ga0075434_101089835 3300006871 Bacteria 812
102 Ga0075429_101137212 3300006880 Unclassified 682
103 Ga0068865_100523140 3300006881 Bacteria 992
104 Ga0097620_101180101 3300006931 Unclassified 843
105 Ga0075435_100202487 3300007076 Bacteria 1682
106 Ga0075435_100446016 3300007076 Bacteria 1116
107 Ga0111539_10016075 3300009094 Bacteria 9288
108 Ga0111539_10025887 3300009094 Bacteria 7181
109 Ga0111539_10134678 3300009094 Bacteria 2893
110 Ga0111539_10255682 3300009094 Bacteria 2040
111 Ga0111539_10426896 3300009094 Bacteria 1544
112 Ga0105245_10354726 3300009098 Bacteria 1454
113 Ga0105245_11494302 3300009098 Bacteria 726
114 Ga0105245_11522405 3300009098 Bacteria 720
115 Ga0114129_10058683 3300009147 Bacteria 5383
116 Ga0114129_10527943 3300009147 Bacteria 1538
117 Ga0105241_10624781 3300009174 Bacteria 976
118 Ga0105241_11421367 3300009174 Bacteria 665
119 Ga0105242_11710740 3300009176 Unclassified 665
120 Ga0105248_11705195 3300009177 Bacteria 714
121 Ga0105238_10908564 3300009551 Bacteria 899
122 Ga0105249_10870683 3300009553 Bacteria 967
123 Ga0105249_11200764 3300009553 Bacteria 829
124 Ga0105239_10056775 3300010375 Bacteria 4295
125 Ga0105239_11305881 3300010375 Bacteria 837
126 Ga0105239_11701974 3300010375 Bacteria 730
127 Ga0105239_13125440 3300010375 Bacteria 539
128 Ga0105239_13547591 3300010375 Bacteria 507
129 Ga0105246_10116941 3300011119 Bacteria 1969
130 Ga0105246_10903242 3300011119 Bacteria 792
131 Ga0157371_10456816 3300013102 Bacteria 939
132 Ga0157371_11438615 3300013102 Bacteria 536
133 Ga0157370_10483172 3300013104 Bacteria 1138
134 Ga0157369_10265092 3300013105 Bacteria 1791
135 Ga0157374_10171282 3300013296 Bacteria 2118
136 Ga0157374_10270557 3300013296 Bacteria 1675
137 Ga0157372_10452402 3300013307 Bacteria 1496
138 Ga0157372_10825137 3300013307 Bacteria 1077
139 Ga0157375_11308821 3300013308 Bacteria 852
140 Ga0157375_12322231 3300013308 Bacteria 640
141 Ga0163163_10774211 3300014325 Unclassified 1023
142 Ga0182008_10497309 3300014497 Bacteria 670
143 Ga0182008_10525424 3300014497 Unclassified 654
144 Ga0157377_10023752 3300014745 Bacteria 3253
145 Ga0157377_10166409 3300014745 Bacteria 1375
146 Ga0182005_1116514 3300015265 Unclassified 758
147 Ga0206353_10804249 3300020082 Bacteria 1577
148 Ga0213876_10643718 3300021384 Bacteria 564
149 Ga0207692_10199704 3300025898 Bacteria 1175
150 Ga0207692_10675292 3300025898 Unclassified 669
151 Ga0207680_10975550 3300025903 Bacteria 607
152 Ga0207643_10255085 3300025908 Bacteria 1081
153 Ga0207705_10500975 3300025909 Unclassified 943
154 Ga0207705_11434492 3300025909 Bacteria 524
155 Ga0207707_10028093 3300025912 Bacteria 4917
156 Ga0207707_10220521 3300025912 Bacteria 1651
157 Ga0207707_10483527 3300025912 Bacteria 1057
158 Ga0207693_10013113 3300025915 Bacteria 6686
159 Ga0207693_10025613 3300025915 Bacteria 4676
160 Ga0207693_10961509 3300025915 Bacteria 653
161 Ga0207663_10058431 3300025916 Bacteria 2434
162 Ga0207663_10318123 3300025916 Bacteria 1169
163 Ga0207660_10711163 3300025917 Unclassified 819
164 Ga0207660_10742751 3300025917 Bacteria 801
165 Ga0207662_10450456 3300025918 Bacteria 880
166 Ga0207662_10742446 3300025918 Bacteria 690
167 Ga0207657_10116388 3300025919 Bacteria 2203
168 Ga0207657_11058267 3300025919 Unclassified 621
169 Ga0207649_10003056 3300025920 Bacteria 9191
170 Ga0207649_10575921 3300025920 Bacteria 864
171 Ga0207649_11565872 3300025920 Bacteria 522
172 Ga0207652_10689068 3300025921 Bacteria 912
173 Ga0207652_11326595 3300025921 Bacteria 622
174 Ga0207694_10469545 3300025924 Unclassified 1052
175 Ga0207650_10347958 3300025925 Bacteria 1219
176 Ga0207659_10309563 3300025926 Bacteria 1300
177 Ga0207659_11426133 3300025926 Bacteria 593
178 Ga0207687_10737704 3300025927 Bacteria 838
179 Ga0207700_10287133 3300025928 Bacteria 1417
180 Ga0207664_10883986 3300025929 Bacteria 803
181 Ga0207644_10234009 3300025931 Bacteria 1461
182 Ga0207644_11545651 3300025931 Bacteria 557
183 Ga0207709_11472889 3300025935 Bacteria 564
184 Ga0207669_10346682 3300025937 Bacteria 1146
185 Ga0207669_10384455 3300025937 Unclassified 1095
186 Ga0207665_10165909 3300025939 Bacteria 1592
187 Ga0207689_10479412 3300025942 Bacteria 1041
188 Ga0207661_10000864 3300025944 Bacteria 19886
189 Ga0207661_10017485 3300025944 Bacteria 5309
190 Ga0207661_10616752 3300025944 Unclassified 996
191 Ga0207661_11780473 3300025944 Bacteria 561
192 Ga0207679_10180486 3300025945 Bacteria 1746
193 Ga0207679_10185752 3300025945 Bacteria 1723
194 Ga0207651_11867628 3300025960 Bacteria 540
195 Ga0207712_10612018 3300025961 Bacteria 943
196 Ga0207640_10105937 3300025981 Bacteria 1982
197 Ga0207640_11051453 3300025981 Bacteria 718
198 Ga0207640_11263483 3300025981 Bacteria 658
199 Ga0207677_10043872 3300026023 Bacteria 2975
200 Ga0207677_10525883 3300026023 Bacteria 1027
201 Ga0207677_11457454 3300026023 Bacteria 631
202 Ga0207703_11357960 3300026035 Bacteria 684
203 Ga0207639_11765497 3300026041 Bacteria 579
204 Ga0207708_10120974 3300026075 Bacteria 2040
205 Ga0207702_10009154 3300026078 Bacteria 8332
206 Ga0207702_10605148 3300026078 Unclassified 1076
207 Ga0207648_11732420 3300026089 Bacteria 586
208 Ga0207676_11196311 3300026095 Bacteria 753
209 Ga0207674_10036831 3300026116 Bacteria 5093
210 Ga0207674_10349326 3300026116 Bacteria 1430
211 Ga0207674_10368894 3300026116 Bacteria 1388
212 Ga0207675_100449058 3300026118 Bacteria 1277
213 Ga0207683_10089890 3300026121 Unclassified 2734
214 Ga0207683_11134828 3300026121 Bacteria 725
215 Ga0207428_10061175 3300027907 Bacteria 2982
216 Ga0207428_10188472 3300027907 Bacteria 1555
217 Ga0207428_10476951 3300027907 Bacteria 908
218 Ga0268266_11291452 3300028379 Bacteria 705
219 Ga0268266_11858205 3300028379 Unclassified 577
220 Ga0268265_10412382 3300028380 Bacteria 1252
221 Ga0268265_11486330 3300028380 Bacteria 681
222 Ga0307408_100552566 3300031548 Unclassified 1016
223 Ga0307405_11428502 3300031731 Unclassified 606
224 Ga0307412_10701319 3300031911 Bacteria 869
225 Ga0307409_100104867 3300031995 Bacteria 2356
226 Ga0307409_101904251 3300031995 Bacteria 624
227 Ga0307409_102961910 3300031995 Bacteria 501
228 Ga0307416_100675742 3300032002 Bacteria 1120
229 Ga0307416_100981508 3300032002 Unclassified 947
230 Ga0307415_100008142 3300032126 Bacteria 5793
231 Ga0307415_102320684 3300032126 Unclassified 526
232 Ga0373961_0224650 3300035241 Bacteria 671
233 Ga0373962_0171637 3300035242 Bacteria 720
234 Ga0373947_0730329 3300035725 Bacteria 676
235 Ga0373937_1061328 3300036401 Bacteria 759
236 Ga0395899_0006592 3300037312 Bacteria 8995
237 Ga0395899_0066507 3300037312 Unclassified 2646
238 Ga0395900_0001810 3300037418 Bacteria 24466
239 Ga0395900_0243090 3300037418 Bacteria 1805
240 Ga0395900_1132637 3300037418 Unclassified 699
241 Ga0395898_0018860 3300037466 Bacteria 7029
242 Ga0395898_0069596 3300037466 Bacteria 3404
243 Ga0395898_1044350 3300037466 Bacteria 752
244 Ga0395905_0013593 3300037471 Bacteria 7798
245 Ga0395905_0392845 3300037471 Bacteria 1282
246 Ga0395905_0532183 3300037471 Bacteria 1076
247 Ga0395905_0608441 3300037471 Unclassified 995
248 Ga0395901_0010238 3300038443 Bacteria 9497
249 Ga0395901_0090580 3300038443 Bacteria 3201
250 Ga0395901_0166231 3300038443 Unclassified 2316
251 Ga0395901_1144022 3300038443 Bacteria 747
252 Ga0395901_1281793 3300038443 Bacteria 695
253 Ga0436365_0355175 3300039437 Bacteria 579
254 Ga0439439_0004574 3300041406 Bacteria 3128
255 Ga0451789_1085657 3300041443 Bacteria 665
256 Ga0451793_0308359 3300041452 Bacteria 954
257 Ga0451802_0085701 3300041460 Bacteria 674
258 Ga0451804_0096207 3300041463 Bacteria 1154
259 Ga0451839_0903188 3300041496 Bacteria 619
260 Ga0451849_1168296 3300041505 Bacteria 2057
261 Ga0451851_1023841 3300041507 Bacteria 991
262 Ga0451853_2486766 3300041512 Bacteria 1591
263 Ga0439431_0050501 3300041997 Bacteria 1077
264 Ga0439433_0042761 3300041999 Bacteria 1057
265 Ga0439448_0028929 3300042005 Bacteria 1752
266 Ga0439448_0168451 3300042005 Unclassified 764
267 Ga0439450_097981 3300042008 Bacteria 742
268 Ga0439451_082571 3300042009 Bacteria 646
269 Ga0439456_068464 3300042013 Bacteria 785
270 Ga0439462_0000555 3300042015 Bacteria 7394
271 Ga0439463_064218 3300042016 Bacteria 939
272 Ga0450922_035967 3300042124 Bacteria 551
273 Ga0450898_120784 3300042134 Bacteria 559
274 Ga0450902_007814 3300042137 Bacteria 1662
275 Ga0450906_004386 3300042145 Bacteria 2959
276 Ga0439446_0002209 3300042156 Bacteria 4642
277 Ga0439459_0027868 3300042438 Bacteria 1130
278 Ga0439440_0095730 3300042993 Bacteria 802
279 Ga0466963_0019815 3300044694 Bacteria 4224
280 Ga0466963_0027175 3300044694 Bacteria 3663
281 Ga0466963_1000061 3300044694 Bacteria 589
282 Ga0466971_0267239 3300044719 Bacteria 817
283 Ga0466957_0398967 3300044842 Bacteria 940
284 Ga0466959_0857008 3300045049 Bacteria 607
285 Ga0466967_0016414 3300045976 Bacteria 5840
286 Ga0466967_0058248 3300045976 Bacteria 3414
287 Ga0466967_0091959 3300045976 Bacteria 2758
288 Ga0466967_0465253 3300045976 Bacteria 1237
289 Ga0466967_1235039 3300045976 Bacteria 744
290 Ga0495653_0194187 3300046463 Bacteria 1383
291 Ga0495608_0177006 3300046511 Bacteria 1351
292 Ga0495628_0613926 3300046516 Bacteria 776
293 Ga0495652_0207272 3300046529 Bacteria 1483
294 Ga0495652_1038751 3300046529 Unclassified 534
295 Ga0495645_0355566 3300046543 Bacteria 943
296 Ga0495667_0237748 3300046559 Bacteria 1161
297 Ga0495634_0069806 3300046642 Bacteria 2317
298 Ga0495635_0223573 3300046663 Bacteria 1273
299 Ga0495657_0746216 3300046675 Bacteria 561
300 Ga0495600_0567180 3300046809 Bacteria 692
301 Ga0495604_0810485 3300047317 Bacteria 589
302 Ga0495674_1265237 3300047319 Bacteria 555
303 Ga0495680_0395327 3300047322 Bacteria 955
304 Ga0495680_0685891 3300047322 Bacteria 678
305 Ga0495675_0673816 3300047444 Bacteria 581
306 Ga0495684_0628110 3300047471 Bacteria 721
307 Ga0495684_0816258 3300047471 Bacteria 608
308 Ga0495593_0376299 3300047673 Bacteria 710
309 Ga0495602_0670705 3300048088 Bacteria 706
310 Ga0496100_0003140 3300048903 Bacteria 8560
311 Ga0496100_0409799 3300048903 Unclassified 1034
312 Ga0496100_0488779 3300048903 Bacteria 947
313 Ga0496100_0909778 3300048903 Bacteria 691
314 Ga0496101_0005451 3300048904 Bacteria 8111
315 Ga0496101_0250822 3300048904 Bacteria 1379
316 Ga0496101_0882498 3300048904 Bacteria 704
317 Ga0496102_0052646 3300048905 Unclassified 3709
318 Ga0496102_0755131 3300048905 Bacteria 895
319 Ga0496102_0920772 3300048905 Bacteria 796
320 Ga0496102_0930997 3300048905 Bacteria 790
321 Ga0496103_0035484 3300048906 Unclassified 3053
322 Ga0496103_0211746 3300048906 Bacteria 1246
323 Ga0496104_0000278 3300048907 Bacteria 45634
324 Ga0496104_0386068 3300048907 Bacteria 1313
325 Ga0496105_0139318 3300048908 Bacteria 1997
326 Ga0496105_0791462 3300048908 Bacteria 722
327 Ga0496106_0196371 3300048909 Bacteria 1605
328 Ga0496107_0902367 3300048910 Bacteria 644
329 Ga0496108_0002990 3300048911 Bacteria 13582
330 Ga0496108_0264804 3300048911 Bacteria 1496
331 Ga0496109_0009286 3300048912 Bacteria 8379
332 Ga0496109_1856818 3300048912 Bacteria 535
333 Ga0496109_1893354 3300048912 Bacteria 529
334 Ga0496110_0016483 3300048913 Bacteria 6171
335 Ga0496110_0297706 3300048913 Bacteria 1470
336 Ga0496110_1149491 3300048913 Bacteria 685
337 Ga0496111_0008333 3300048914 Bacteria 6853
338 Ga0496112_0076295 3300048915 Bacteria 3315
339 Ga0496112_0384654 3300048915 Bacteria 1344
340 Ga0496113_0075358 3300048916 Unclassified 2575
341 Ga0496114_0133499 3300048917 Unclassified 2145
342 Ga0496114_0576667 3300048917 Unclassified 993
343 Ga0496114_1172755 3300048917 Bacteria 654
344 Ga0496115_0000616 3300048918 Bacteria 27043
345 Ga0501031_0010913 3300049568 Bacteria 5916
346 Ga0501031_0038088 3300049568 Bacteria 3139
347 Ga0501031_0453480 3300049568 Unclassified 828
348 Ga0501031_0811598 3300049568 Bacteria 600
349 Ga0501032_1061320 3300049569 Bacteria 508
350 Ga0501033_0160590 3300049570 Bacteria 1618
351 Ga0501033_0599600 3300049570 Bacteria 755
352 Ga0501036_0002524 3300049572 Bacteria 14364
353 Ga0501036_0047341 3300049572 Bacteria 3642
354 Ga0501036_0108780 3300049572 Bacteria 2343
355 Ga0501036_1083028 3300049572 Bacteria 655
356 Ga0501037_0071912 3300049573 Bacteria 2516
357 Ga0501037_0098688 3300049573 Bacteria 2110
358 Ga0501037_0293173 3300049573 Bacteria 1131
359 Ga0501038_0014110 3300049574 Bacteria 7278
360 Ga0501038_0303573 3300049574 Bacteria 1252
361 Ga0501038_0379203 3300049574 Bacteria 1097
362 Ga0501039_0011222 3300049575 Bacteria 6828
363 Ga0501039_0020844 3300049575 Bacteria 5025
364 Ga0501039_0102954 3300049575 Bacteria 2228
365 Ga0501040_0000959 3300049576 Bacteria 18211
366 Ga0501040_0051137 3300049576 Bacteria 2827
367 Ga0501040_0095039 3300049576 Bacteria 2074
368 Ga0501041_0021465 3300049577 Bacteria 3868
369 Ga0501041_0055623 3300049577 Bacteria 2416
370 Ga0501042_0010114 3300049578 Bacteria 6309
371 Ga0501042_0011961 3300049578 Bacteria 5865
372 Ga0501042_0015103 3300049578 Bacteria 5279
373 Ga0501042_0151712 3300049578 Bacteria 1671
374 Ga0501042_0860808 3300049578 Bacteria 660
375 Ga0501043_0170638 3300049579 Bacteria 1697
376 Ga0501046_0045585 3300049580 Bacteria 3483
377 Ga0501046_0188633 3300049580 Bacteria 1539
378 Ga0501048_0014367 3300049582 Bacteria 5864
379 Ga0501048_0016605 3300049582 Bacteria 5428
380 Ga0501048_0076854 3300049582 Bacteria 2356
381 Ga0501048_0887292 3300049582 Bacteria 641
382 Ga0501048_0954305 3300049582 Bacteria 617
383 Ga0501067_0024545 3300049583 Bacteria 3344
384 Ga0501067_0060413 3300049583 Bacteria 2098
385 Ga0501068_0006738 3300049584 Bacteria 6347
386 Ga0501068_0063187 3300049584 Bacteria 2252
387 Ga0501069_0037789 3300049585 Bacteria 2664
388 Ga0501069_0300699 3300049585 Bacteria 941
389 Ga0501070_0560655 3300049586 Bacteria 914
390 Ga0501071_0021135 3300049587 Bacteria 4532
391 Ga0501071_0021276 3300049587 Bacteria 4515
392 Ga0501071_1383884 3300049587 Bacteria 543
393 Ga0501071_1454537 3300049587 Unclassified 529
394 Ga0501072_0003784 3300049588 Bacteria 11426
395 Ga0501072_0009880 3300049588 Bacteria 7257
396 Ga0501073_0319930 3300049589 Bacteria 1071
397 Ga0501073_0489873 3300049589 Bacteria 850
398 Ga0501074_0015108 3300049590 Bacteria 5615
399 Ga0501074_0018328 3300049590 Bacteria 5085
400 Ga0501075_0024962 3300049591 Bacteria 4388
401 Ga0501075_0038975 3300049591 Bacteria 3554
402 Ga0501075_0735535 3300049591 Bacteria 751
403 Ga0501075_0998171 3300049591 Bacteria 636
404 Ga0501075_1438077 3300049591 Bacteria 522
405 Ga0501076_0003617 3300049592 Bacteria 10853
406 Ga0501076_0015559 3300049592 Bacteria 5753
407 Ga0501076_0041701 3300049592 Bacteria 3612
408 Ga0501076_0713451 3300049592 Bacteria 828
409 Ga0501076_1090823 3300049592 Bacteria 657
410 Ga0501076_1150136 3300049592 Bacteria 639
411 Ga0501077_0013154 3300049593 Bacteria 5185
412 Ga0501077_0015744 3300049593 Bacteria 4762
413 Ga0501077_0032408 3300049593 Bacteria 3326
414 Ga0501079_0006065 3300049741 Bacteria 9056
415 Ga0501079_0094918 3300049741 Bacteria 2311
416 Ga0501079_0632545 3300049741 Bacteria 842
417 Ga0501079_0715156 3300049741 Bacteria 788
418 Ga0501079_1596653 3300049741 Bacteria 513
419 Ga0501080_0081274 3300049742 Bacteria 3011
420 Ga0501080_0332643 3300049742 Bacteria 1373
421 Ga0501081_0015524 3300049743 Bacteria 5026
422 Ga0501081_0021810 3300049743 Bacteria 4278
423 Ga0501081_0037476 3300049743 Bacteria 3308
424 Ga0501081_0900756 3300049743 Bacteria 667
425 Ga0501083_0063298 3300049744 Bacteria 2467
426 Ga0501273_097382 3300049770 Bacteria 507
427 Ga0501035_0048076 3300049822 Bacteria 3827
428 Ga0501035_0057276 3300049822 Bacteria 3475
429 Ga0501035_0177956 3300049822 Bacteria 1834
430 Ga0501044_0475688 3300049823 Bacteria 1153
431 Ga0501045_0005803 3300049824 Bacteria 8544
432 Ga0501045_0019316 3300049824 Bacteria 4856
433 Ga0501045_0024513 3300049824 Bacteria 4332
434 nmdc:mga03n38_422983_c1 3300050490 Bacteria 737
435 nmdc:mga00v17_11892_c1 3300050491 Bacteria 4792
436 nmdc:mga0yw44_295304_c1 3300050492 Bacteria 1085
437 nmdc:mga0yw44_5302_c1 3300050492 Bacteria 6061
438 nmdc:mga06z11_348262_c1 3300050494 Bacteria 886
439 nmdc:mga06z11_54166_c1 3300050494 Bacteria 2066
440 nmdc:mga05p37_106964_c1 3300050507 Bacteria 3441
441 nmdc:mga05p37_1970528_c1 3300050507 Bacteria 554
442 nmdc:mga09592_1007590_c1 3300050508 Unclassified 696
443 nmdc:mga0qj67_410542_c1 3300050509 Bacteria 1092
444 nmdc:mga06r32_1289846_c1 3300050510 Bacteria 674
445 nmdc:mga08y16_1683057_c1 3300050511 Bacteria 590
446 nmdc:mga08y16_193507_c1 3300050511 Bacteria 2109
447 nmdc:mga08y16_33642_c1 3300050511 Bacteria 5382
448 nmdc:mga08y16_399047_c1 3300050511 Bacteria 1408
449 nmdc:mga0n895_866175_c1 3300050512 Bacteria 890
450 nmdc:mga0rr50_463143_c1 3300050513 Bacteria 1075
451 nmdc:mga0rr50_871929_c1 3300050513 Bacteria 767
452 Ga0495595_0078967 3300053084 Bacteria 1565
453 Ga0495619_0311079 3300053085 Bacteria 1091
454 Ga0495619_0666409 3300053085 Bacteria 709
455 Ga0501084_0008866 3300054114 Bacteria 8324
456 Ga0501084_0030486 3300054114 Bacteria 4509
457 Ga0501084_0289360 3300054114 Bacteria 1384
458 Ga0501084_1092270 3300054114 Bacteria 670
459 Ga0590071_056467 3300059421 Unclassified 955
460 Ga0590075_025527 3300059424 Bacteria 1485
461 Ga0501082_0007521 3300060353 Bacteria 9401
462 Ga0501082_0126268 3300060353 Bacteria 2219
463 Ga0501082_0143228 3300060353 Bacteria 2074
464 Ga0466962_0168806 3300061719 Bacteria 1065
465 Ga0530510_0008919 3300061734 Bacteria 7021
466 Ga0530510_0014386 3300061734 Bacteria 5579
467 Ga0530510_0098694 3300061734 Bacteria 2135
468 Ga0530510_0869485 3300061734 Bacteria 689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0166231 Ga0395901_0166231_2098_2304 65
2 3300006178 Ga0075367_10475592 Ga0075367_104755922 66
3 3300010375 Ga0105239_10056775 Ga0105239_100567751 66
4 3300014745 Ga0157377_10166409 Ga0157377_101664093 66
5 3300049587 Ga0501071_1454537 Ga0501071_1454537_217_423 66
6 3300050494 nmdc:mga06z11_348262_c1 nmdc:mga06z11_348262_c1_304_513 66
7 3300060353 Ga0501082_0126268 Ga0501082_0126268_1603_1809 66
8 3300061734 Ga0530510_0869485 Ga0530510_0869485_85_291 66
9 3300045049 Ga0466959_0857008 Ga0466959_0857008_365_577 68
10 3300045976 Ga0466967_1235039 Ga0466967_1235039_365_577 68
11 3300047319 Ga0495674_1265237 Ga0495674_1265237_40_297 68
12 3300006880 Ga0075429_101137212 Ga0075429_1011372122 69
13 3300010375 Ga0105239_13125440 Ga0105239_131254401 69
14 3300032126 Ga0307415_102320684 Ga0307415_1023206842 69
15 3300046463 Ga0495653_0194187 Ga0495653_0194187_87_308 69
16 3300046511 Ga0495608_0177006 Ga0495608_0177006_337_558 69
17 3300046516 Ga0495628_0613926 Ga0495628_0613926_217_438 69
18 3300046529 Ga0495652_0207272 Ga0495652_0207272_439_660 69
19 3300046543 Ga0495645_0355566 Ga0495645_0355566_42_263 69
20 3300046642 Ga0495634_0069806 Ga0495634_0069806_1666_1887 69
21 3300046663 Ga0495635_0223573 Ga0495635_0223573_122_343 69
22 3300047322 Ga0495680_0685891 Ga0495680_0685891_343_564 69
23 3300047444 Ga0495675_0673816 Ga0495675_0673816_25_246 69
24 3300047471 Ga0495684_0816258 Ga0495684_0816258_298_519 69
25 3300048088 Ga0495602_0670705 Ga0495602_0670705_217_438 69
26 3300049568 Ga0501031_0453480 Ga0501031_0453480_177_395 69
27 3300049570 Ga0501033_0599600 Ga0501033_0599600_242_460 69
28 3300049572 Ga0501036_0002524 Ga0501036_0002524_11820_12038 69
29 3300049573 Ga0501037_0071912 Ga0501037_0071912_1773_1991 69
30 3300049574 Ga0501038_0014110 Ga0501038_0014110_4089_4307 69
31 3300049575 Ga0501039_0020844 Ga0501039_0020844_2581_2799 69
32 3300049576 Ga0501040_0095039 Ga0501040_0095039_1633_1851 69
33 3300049577 Ga0501041_0055623 Ga0501041_0055623_585_803 69
34 3300049578 Ga0501042_0015103 Ga0501042_0015103_2787_3005 69
35 3300049578 Ga0501042_0151712 Ga0501042_0151712_78_296 69
36 3300049582 Ga0501048_0076854 Ga0501048_0076854_1626_1844 69
37 3300049591 Ga0501075_0998171 Ga0501075_0998171_115_333 69
38 3300049592 Ga0501076_0041701 Ga0501076_0041701_1075_1293 69
39 3300049593 Ga0501077_0032408 Ga0501077_0032408_448_666 69
40 3300049741 Ga0501079_0632545 Ga0501079_0632545_15_233 69
41 3300049743 Ga0501081_0037476 Ga0501081_0037476_123_341 69
42 3300049744 Ga0501083_0063298 Ga0501083_0063298_1266_1484 69
43 3300049822 Ga0501035_0177956 Ga0501035_0177956_1013_1231 69
44 3300049824 Ga0501045_0019316 Ga0501045_0019316_1175_1393 69
45 3300050508 nmdc:mga09592_1007590_c1 nmdc:mga09592_1007590_c1_313_528 69
46 3300053084 Ga0495595_0078967 Ga0495595_0078967_1021_1242 69
47 3300053085 Ga0495619_0311079 Ga0495619_0311079_439_660 69
48 3300054114 Ga0501084_0030486 Ga0501084_0030486_2230_2448 69
49 3300054114 Ga0501084_0289360 Ga0501084_0289360_1111_1329 69
50 3300060353 Ga0501082_0143228 Ga0501082_0143228_1807_2025 69
51 3300005842 Ga0068858_100472101 Ga0068858_1004721013 70
52 3300005981 Ga0081538_10062341 Ga0081538_100623413 70
53 3300026035 Ga0207703_11357960 Ga0207703_113579602 70
54 3300026118 Ga0207675_100449058 Ga0207675_1004490583 70
55 3300050513 nmdc:mga0rr50_463143_c1 nmdc:mga0rr50_463143_c1_162_389 70
56 3300005355 Ga0070671_100026115 Ga0070671_1000261154 71
57 3300005435 Ga0070714_100588164 Ga0070714_1005881642 71
58 3300005436 Ga0070713_100113264 Ga0070713_1001132643 71
59 3300005439 Ga0070711_100017562 Ga0070711_1000175623 71
60 3300005456 Ga0070678_101971627 Ga0070678_1019716272 71
61 3300006028 Ga0070717_10417967 Ga0070717_104179672 71
62 3300006173 Ga0070716_100095215 Ga0070716_1000952152 71
63 3300006175 Ga0070712_100004685 Ga0070712_1000046856 71
64 3300006358 Ga0068871_101537845 Ga0068871_1015378452 71
65 3300009174 Ga0105241_10624781 Ga0105241_106247812 71
66 3300009176 Ga0105242_11710740 Ga0105242_117107401 71
67 3300009177 Ga0105248_11705195 Ga0105248_117051952 71
68 3300013296 Ga0157374_10270557 Ga0157374_102705572 71
69 3300013308 Ga0157375_11308821 Ga0157375_113088212 71
70 3300025898 Ga0207692_10199704 Ga0207692_101997042 71
71 3300025898 Ga0207692_10675292 Ga0207692_106752922 71
72 3300025915 Ga0207693_10013113 Ga0207693_100131136 71
73 3300025916 Ga0207663_10058431 Ga0207663_100584315 71
74 3300025928 Ga0207700_10287133 Ga0207700_102871332 71
75 3300025929 Ga0207664_10883986 Ga0207664_108839862 71
76 3300025931 Ga0207644_10234009 Ga0207644_102340092 71
77 3300025939 Ga0207665_10165909 Ga0207665_101659091 71
78 3300028379 Ga0268266_11858205 Ga0268266_118582051 71
79 3300035241 Ga0373961_0224650 Ga0373961_0224650_247_471 71
80 3300045976 Ga0466967_0091959 Ga0466967_0091959_1487_1708 71
81 3300048903 Ga0496100_0003140 Ga0496100_0003140_5007_5231 71
82 3300048904 Ga0496101_0005451 Ga0496101_0005451_2982_3206 71
83 3300048905 Ga0496102_0052646 Ga0496102_0052646_1317_1541 71
84 3300048906 Ga0496103_0035484 Ga0496103_0035484_621_845 71
85 3300048907 Ga0496104_0000278 Ga0496104_0000278_10932_11156 71
86 3300048908 Ga0496105_0139318 Ga0496105_0139318_1130_1354 71
87 3300048909 Ga0496106_0196371 Ga0496106_0196371_1257_1481 71
88 3300048910 Ga0496107_0902367 Ga0496107_0902367_27_251 71
89 3300048911 Ga0496108_0002990 Ga0496108_0002990_9147_9371 71
90 3300048912 Ga0496109_0009286 Ga0496109_0009286_2982_3206 71
91 3300048913 Ga0496110_0016483 Ga0496110_0016483_2790_3014 71
92 3300048914 Ga0496111_0008333 Ga0496111_0008333_3061_3285 71
93 3300048915 Ga0496112_0384654 Ga0496112_0384654_225_449 71
94 3300048916 Ga0496113_0075358 Ga0496113_0075358_2330_2554 71
95 3300048917 Ga0496114_0133499 Ga0496114_0133499_375_599 71
96 3300048918 Ga0496115_0000616 Ga0496115_0000616_13778_14002 71
97 3300005327 Ga0070658_10548724 Ga0070658_105487242 72
98 3300005328 Ga0070676_11026013 Ga0070676_110260131 72
99 3300005335 Ga0070666_11073371 Ga0070666_110733712 72
100 3300005614 Ga0068856_100868709 Ga0068856_1008687091 72
101 3300005616 Ga0068852_102469686 Ga0068852_1024696862 72
102 3300006931 Ga0097620_101180101 Ga0097620_1011801012 72
103 3300007076 Ga0075435_100202487 Ga0075435_1002024874 72
104 3300025909 Ga0207705_11434492 Ga0207705_114344921 72
105 3300025919 Ga0207657_11058267 Ga0207657_110582672 72
106 3300046675 Ga0495657_0746216 Ga0495657_0746216_286_513 72
107 3300048917 Ga0496114_0576667 Ga0496114_0576667_280_513 72
108 3300049573 Ga0501037_0293173 Ga0501037_0293173_160_390 72
109 3300049578 Ga0501042_0860808 Ga0501042_0860808_365_589 72
110 3300049580 Ga0501046_0188633 Ga0501046_0188633_296_520 72
111 3300049582 Ga0501048_0887292 Ga0501048_0887292_334_558 72
112 3300049592 Ga0501076_0713451 Ga0501076_0713451_175_399 72
113 3300049741 Ga0501079_1596653 Ga0501079_1596653_69_290 72
114 3300049743 Ga0501081_0900756 Ga0501081_0900756_382_603 72
115 3300003911 JGI25405J52794_10048495 JGI25405J52794_100484952 73
116 3300005329 Ga0070683_100006939 Ga0070683_1000069396 73
117 3300005329 Ga0070683_100152490 Ga0070683_1001524902 73
118 3300005329 Ga0070683_101143408 Ga0070683_1011434082 73
119 3300005329 Ga0070683_102114605 Ga0070683_1021146051 73
120 3300005331 Ga0070670_100598472 Ga0070670_1005984722 73
121 3300005336 Ga0070680_100616405 Ga0070680_1006164051 73
122 3300005336 Ga0070680_100829850 Ga0070680_1008298502 73
123 3300005336 Ga0070680_100881340 Ga0070680_1008813402 73
124 3300005337 Ga0070682_100409716 Ga0070682_1004097162 73
125 3300005338 Ga0068868_100070196 Ga0068868_1000701966 73
126 3300005338 Ga0068868_100532775 Ga0068868_1005327752 73
127 3300005339 Ga0070660_100699142 Ga0070660_1006991422 73
128 3300005341 Ga0070691_10069720 Ga0070691_100697203 73
129 3300005343 Ga0070687_100274651 Ga0070687_1002746512 73
130 3300005343 Ga0070687_100629241 Ga0070687_1006292412 73
131 3300005344 Ga0070661_100120734 Ga0070661_1001207344 73
132 3300005347 Ga0070668_100954719 Ga0070668_1009547192 73
133 3300005354 Ga0070675_100367744 Ga0070675_1003677443 73
134 3300005354 Ga0070675_100473470 Ga0070675_1004734703 73
135 3300005356 Ga0070674_100296188 Ga0070674_1002961883 73
136 3300005364 Ga0070673_101765473 Ga0070673_1017654732 73
137 3300005435 Ga0070714_100042957 Ga0070714_1000429574 73
138 3300005439 Ga0070711_100514255 Ga0070711_1005142552 73
139 3300005440 Ga0070705_100583897 Ga0070705_1005838972 73
140 3300005441 Ga0070700_100381899 Ga0070700_1003818992 73
141 3300005445 Ga0070708_102242757 Ga0070708_1022427571 73
142 3300005456 Ga0070678_100274732 Ga0070678_1002747322 73
143 3300005456 Ga0070678_100991016 Ga0070678_1009910162 73
144 3300005458 Ga0070681_10177344 Ga0070681_101773444 73
145 3300005458 Ga0070681_10198916 Ga0070681_101989163 73
146 3300005458 Ga0070681_10332184 Ga0070681_103321843 73
147 3300005471 Ga0070698_100818805 Ga0070698_1008188052 73
148 3300005530 Ga0070679_100038323 Ga0070679_1000383236 73
149 3300005530 Ga0070679_100331416 Ga0070679_1003314162 73
150 3300005530 Ga0070679_100780486 Ga0070679_1007804862 73
151 3300005535 Ga0070684_100098139 Ga0070684_1000981394 73
152 3300005535 Ga0070684_100205084 Ga0070684_1002050843 73
153 3300005539 Ga0068853_102490858 Ga0068853_1024908582 73
154 3300005543 Ga0070672_100270699 Ga0070672_1002706993 73
155 3300005544 Ga0070686_100069268 Ga0070686_1000692685 73
156 3300005547 Ga0070693_100004354 Ga0070693_1000043548 73
157 3300005547 Ga0070693_100745762 Ga0070693_1007457621 73
158 3300005547 Ga0070693_101632965 Ga0070693_1016329652 73
159 3300005549 Ga0070704_100003595 Ga0070704_1000035958 73
160 3300005564 Ga0070664_100009206 Ga0070664_1000092066 73
161 3300005564 Ga0070664_102079426 Ga0070664_1020794261 73
162 3300005577 Ga0068857_100130838 Ga0068857_1001308382 73
163 3300005577 Ga0068857_100411943 Ga0068857_1004119432 73
164 3300005577 Ga0068857_100427517 Ga0068857_1004275173 73
165 3300005578 Ga0068854_100038961 Ga0068854_1000389614 73
166 3300005578 Ga0068854_100504148 Ga0068854_1005041482 73
167 3300005578 Ga0068854_101803971 Ga0068854_1018039712 73
168 3300005614 Ga0068856_100006197 Ga0068856_1000061972 73
169 3300005614 Ga0068856_100626505 Ga0068856_1006265052 73
170 3300005614 Ga0068856_101901928 Ga0068856_1019019282 73
171 3300005615 Ga0070702_100071723 Ga0070702_1000717232 73
172 3300005618 Ga0068864_100021045 Ga0068864_1000210454 73
173 3300005618 Ga0068864_101260044 Ga0068864_1012600442 73
174 3300005840 Ga0068870_10701847 Ga0068870_107018472 73
175 3300005844 Ga0068862_100267591 Ga0068862_1002675912 73
176 3300005844 Ga0068862_101113829 Ga0068862_1011138292 73
177 3300005937 Ga0081455_10038797 Ga0081455_100387976 73
178 3300005937 Ga0081455_10220790 Ga0081455_102207902 73
179 3300005937 Ga0081455_10516257 Ga0081455_105162572 73
180 3300005937 Ga0081455_10571147 Ga0081455_105711472 73
181 3300005981 Ga0081538_10106037 Ga0081538_101060372 73
182 3300005981 Ga0081538_10251586 Ga0081538_102515862 73
183 3300005985 Ga0081539_10006841 Ga0081539_100068418 73
184 3300006038 Ga0075365_10196528 Ga0075365_101965282 73
185 3300006042 Ga0075368_10036139 Ga0075368_100361394 73
186 3300006051 Ga0075364_10045982 Ga0075364_100459824 73
187 3300006173 Ga0070716_101035641 Ga0070716_1010356412 73
188 3300006175 Ga0070712_100093938 Ga0070712_1000939382 73
189 3300006178 Ga0075367_10076818 Ga0075367_100768182 73
190 3300006195 Ga0075366_10507487 Ga0075366_105074872 73
191 3300006237 Ga0097621_100972260 Ga0097621_1009722602 73
192 3300006358 Ga0068871_101258432 Ga0068871_1012584322 73
193 3300006846 Ga0075430_100609397 Ga0075430_1006093972 73
194 3300006847 Ga0075431_101786465 Ga0075431_1017864652 73
195 3300006871 Ga0075434_100683946 Ga0075434_1006839462 73
196 3300006871 Ga0075434_101089835 Ga0075434_1010898352 73
197 3300006881 Ga0068865_100523140 Ga0068865_1005231402 73
198 3300007076 Ga0075435_100446016 Ga0075435_1004460162 73
199 3300009094 Ga0111539_10016075 Ga0111539_100160754 73
200 3300009094 Ga0111539_10025887 Ga0111539_100258874 73
201 3300009094 Ga0111539_10134678 Ga0111539_101346782 73
202 3300009094 Ga0111539_10255682 Ga0111539_102556824 73
203 3300009094 Ga0111539_10426896 Ga0111539_104268962 73
204 3300009098 Ga0105245_10354726 Ga0105245_103547263 73
205 3300009098 Ga0105245_11494302 Ga0105245_114943021 73
206 3300009098 Ga0105245_11522405 Ga0105245_115224052 73
207 3300009147 Ga0114129_10058683 Ga0114129_100586835 73
208 3300009147 Ga0114129_10527943 Ga0114129_105279434 73
209 3300009174 Ga0105241_11421367 Ga0105241_114213671 73
210 3300009551 Ga0105238_10908564 Ga0105238_109085642 73
211 3300009553 Ga0105249_10870683 Ga0105249_108706832 73
212 3300009553 Ga0105249_11200764 Ga0105249_112007642 73
213 3300010375 Ga0105239_11305881 Ga0105239_113058812 73
214 3300010375 Ga0105239_11701974 Ga0105239_117019742 73
215 3300010375 Ga0105239_13547591 Ga0105239_135475911 73
216 3300011119 Ga0105246_10116941 Ga0105246_101169412 73
217 3300011119 Ga0105246_10903242 Ga0105246_109032421 73
218 3300013102 Ga0157371_10456816 Ga0157371_104568163 73
219 3300013102 Ga0157371_11438615 Ga0157371_114386152 73
220 3300013104 Ga0157370_10483172 Ga0157370_104831722 73
221 3300013105 Ga0157369_10265092 Ga0157369_102650922 73
222 3300013296 Ga0157374_10171282 Ga0157374_101712824 73
223 3300013307 Ga0157372_10452402 Ga0157372_104524022 73
224 3300013307 Ga0157372_10825137 Ga0157372_108251372 73
225 3300013308 Ga0157375_12322231 Ga0157375_123222312 73
226 3300014325 Ga0163163_10774211 Ga0163163_107742111 73
227 3300014497 Ga0182008_10497309 Ga0182008_104973091 73
228 3300014497 Ga0182008_10525424 Ga0182008_105254242 73
229 3300014745 Ga0157377_10023752 Ga0157377_100237525 73
230 3300015265 Ga0182005_1116514 Ga0182005_11165142 73
231 3300020082 Ga0206353_10804249 Ga0206353_108042492 73
232 3300021384 Ga0213876_10643718 Ga0213876_106437181 73
233 3300025903 Ga0207680_10975550 Ga0207680_109755502 73
234 3300025908 Ga0207643_10255085 Ga0207643_102550852 73
235 3300025909 Ga0207705_10500975 Ga0207705_105009752 73
236 3300025912 Ga0207707_10028093 Ga0207707_100280936 73
237 3300025912 Ga0207707_10220521 Ga0207707_102205212 73
238 3300025912 Ga0207707_10483527 Ga0207707_104835273 73
239 3300025915 Ga0207693_10025613 Ga0207693_100256136 73
240 3300025915 Ga0207693_10961509 Ga0207693_109615091 73
241 3300025916 Ga0207663_10318123 Ga0207663_103181232 73
242 3300025917 Ga0207660_10711163 Ga0207660_107111632 73
243 3300025917 Ga0207660_10742751 Ga0207660_107427512 73
244 3300025918 Ga0207662_10450456 Ga0207662_104504561 73
245 3300025918 Ga0207662_10742446 Ga0207662_107424461 73
246 3300025919 Ga0207657_10116388 Ga0207657_101163884 73
247 3300025920 Ga0207649_10003056 Ga0207649_100030564 73
248 3300025920 Ga0207649_11565872 Ga0207649_115658722 73
249 3300025921 Ga0207652_10689068 Ga0207652_106890682 73
250 3300025921 Ga0207652_11326595 Ga0207652_113265952 73
251 3300025924 Ga0207694_10469545 Ga0207694_104695452 73
252 3300025925 Ga0207650_10347958 Ga0207650_103479583 73
253 3300025926 Ga0207659_10309563 Ga0207659_103095633 73
254 3300025926 Ga0207659_11426133 Ga0207659_114261332 73
255 3300025927 Ga0207687_10737704 Ga0207687_107377042 73
256 3300025931 Ga0207644_11545651 Ga0207644_115456512 73
257 3300025935 Ga0207709_11472889 Ga0207709_114728892 73
258 3300025937 Ga0207669_10346682 Ga0207669_103466822 73
259 3300025937 Ga0207669_10384455 Ga0207669_103844552 73
260 3300025942 Ga0207689_10479412 Ga0207689_104794121 73
261 3300025944 Ga0207661_10000864 Ga0207661_1000086421 73
262 3300025944 Ga0207661_10017485 Ga0207661_100174852 73
263 3300025944 Ga0207661_10616752 Ga0207661_106167522 73
264 3300025944 Ga0207661_11780473 Ga0207661_117804731 73
265 3300025945 Ga0207679_10180486 Ga0207679_101804863 73
266 3300025945 Ga0207679_10185752 Ga0207679_101857522 73
267 3300025960 Ga0207651_11867628 Ga0207651_118676282 73
268 3300025961 Ga0207712_10612018 Ga0207712_106120182 73
269 3300025981 Ga0207640_10105937 Ga0207640_101059374 73
270 3300025981 Ga0207640_11051453 Ga0207640_110514532 73
271 3300025981 Ga0207640_11263483 Ga0207640_112634832 73
272 3300026023 Ga0207677_10043872 Ga0207677_100438725 73
273 3300026023 Ga0207677_10525883 Ga0207677_105258832 73
274 3300026023 Ga0207677_11457454 Ga0207677_114574541 73
275 3300026041 Ga0207639_11765497 Ga0207639_117654972 73
276 3300026075 Ga0207708_10120974 Ga0207708_101209743 73
277 3300026078 Ga0207702_10009154 Ga0207702_100091549 73
278 3300026078 Ga0207702_10605148 Ga0207702_106051482 73
279 3300026089 Ga0207648_11732420 Ga0207648_117324202 73
280 3300026095 Ga0207676_11196311 Ga0207676_111963112 73
281 3300026116 Ga0207674_10036831 Ga0207674_100368313 73
282 3300026116 Ga0207674_10349326 Ga0207674_103493263 73
283 3300026116 Ga0207674_10368894 Ga0207674_103688942 73
284 3300026121 Ga0207683_10089890 Ga0207683_100898905 73
285 3300026121 Ga0207683_11134828 Ga0207683_111348282 73
286 3300027907 Ga0207428_10061175 Ga0207428_100611754 73
287 3300027907 Ga0207428_10188472 Ga0207428_101884723 73
288 3300027907 Ga0207428_10476951 Ga0207428_104769512 73
289 3300028379 Ga0268266_11291452 Ga0268266_112914522 73
290 3300028380 Ga0268265_10412382 Ga0268265_104123822 73
291 3300028380 Ga0268265_11486330 Ga0268265_114863302 73
292 3300031548 Ga0307408_100552566 Ga0307408_1005525662 73
293 3300031731 Ga0307405_11428502 Ga0307405_114285022 73
294 3300031911 Ga0307412_10701319 Ga0307412_107013192 73
295 3300031995 Ga0307409_100104867 Ga0307409_1001048674 73
296 3300031995 Ga0307409_101904251 Ga0307409_1019042512 73
297 3300031995 Ga0307409_102961910 Ga0307409_1029619102 73
298 3300032002 Ga0307416_100675742 Ga0307416_1006757421 73
299 3300032002 Ga0307416_100981508 Ga0307416_1009815082 73
300 3300032126 Ga0307415_100008142 Ga0307415_1000081428 73
301 3300035242 Ga0373962_0171637 Ga0373962_0171637_428_661 73
302 3300035725 Ga0373947_0730329 Ga0373947_0730329_52_288 73
303 3300036401 Ga0373937_1061328 Ga0373937_1061328_303_545 73
304 3300037312 Ga0395899_0006592 Ga0395899_0006592_1013_1243 73
305 3300037312 Ga0395899_0066507 Ga0395899_0066507_1580_1816 73
306 3300037418 Ga0395900_0001810 Ga0395900_0001810_8849_9079 73
307 3300037418 Ga0395900_0243090 Ga0395900_0243090_919_1155 73
308 3300037418 Ga0395900_1132637 Ga0395900_1132637_265_501 73
309 3300037466 Ga0395898_0018860 Ga0395898_0018860_6020_6253 73
310 3300037466 Ga0395898_0069596 Ga0395898_0069596_1342_1572 73
311 3300037466 Ga0395898_1044350 Ga0395898_1044350_360_596 73
312 3300037471 Ga0395905_0013593 Ga0395905_0013593_4594_4824 73
313 3300037471 Ga0395905_0392845 Ga0395905_0392845_689_913 73
314 3300037471 Ga0395905_0532183 Ga0395905_0532183_131_367 73
315 3300037471 Ga0395905_0608441 Ga0395905_0608441_216_452 73
316 3300038443 Ga0395901_0010238 Ga0395901_0010238_2976_3206 73
317 3300038443 Ga0395901_0090580 Ga0395901_0090580_1621_1854 73
318 3300038443 Ga0395901_1144022 Ga0395901_1144022_379_612 73
319 3300038443 Ga0395901_1281793 Ga0395901_1281793_308_547 73
320 3300039437 Ga0436365_0355175 Ga0436365_0355175_189_419 73
321 3300041406 Ga0439439_0004574 Ga0439439_0004574_1054_1287 73
322 3300041443 Ga0451789_1085657 Ga0451789_1085657_317_556 73
323 3300041452 Ga0451793_0308359 Ga0451793_0308359_300_539 73
324 3300041460 Ga0451802_0085701 Ga0451802_0085701_345_584 73
325 3300041463 Ga0451804_0096207 Ga0451804_0096207_602_841 73
326 3300041496 Ga0451839_0903188 Ga0451839_0903188_100_327 73
327 3300041505 Ga0451849_1168296 Ga0451849_1168296_1414_1653 73
328 3300041507 Ga0451851_1023841 Ga0451851_1023841_259_498 73
329 3300041512 Ga0451853_2486766 Ga0451853_2486766_1233_1472 73
330 3300041997 Ga0439431_0050501 Ga0439431_0050501_377_610 73
331 3300041999 Ga0439433_0042761 Ga0439433_0042761_276_509 73
332 3300042005 Ga0439448_0028929 Ga0439448_0028929_538_768 73
333 3300042005 Ga0439448_0168451 Ga0439448_0168451_454_687 73
334 3300042008 Ga0439450_097981 Ga0439450_097981_468_698 73
335 3300042009 Ga0439451_082571 Ga0439451_082571_346_582 73
336 3300042013 Ga0439456_068464 Ga0439456_068464_150_386 73
337 3300042015 Ga0439462_0000555 Ga0439462_0000555_4271_4504 73
338 3300042016 Ga0439463_064218 Ga0439463_064218_502_735 73
339 3300042124 Ga0450922_035967 Ga0450922_035967_43_273 73
340 3300042134 Ga0450898_120784 Ga0450898_120784_184_414 73
341 3300042137 Ga0450902_007814 Ga0450902_007814_53_283 73
342 3300042145 Ga0450906_004386 Ga0450906_004386_398_628 73
343 3300042156 Ga0439446_0002209 Ga0439446_0002209_4352_4585 73
344 3300042438 Ga0439459_0027868 Ga0439459_0027868_777_1007 73
345 3300042993 Ga0439440_0095730 Ga0439440_0095730_329_559 73
346 3300044694 Ga0466963_0019815 Ga0466963_0019815_261_485 73
347 3300044694 Ga0466963_0027175 Ga0466963_0027175_1857_2081 73
348 3300044694 Ga0466963_1000061 Ga0466963_1000061_279_509 73
349 3300044719 Ga0466971_0267239 Ga0466971_0267239_428_658 73
350 3300044842 Ga0466957_0398967 Ga0466957_0398967_78_302 73
351 3300045976 Ga0466967_0016414 Ga0466967_0016414_812_1036 73
352 3300045976 Ga0466967_0058248 Ga0466967_0058248_2750_2974 73
353 3300045976 Ga0466967_0465253 Ga0466967_0465253_849_1073 73
354 3300046529 Ga0495652_1038751 Ga0495652_1038751_134_385 73
355 3300046559 Ga0495667_0237748 Ga0495667_0237748_560_814 73
356 3300046809 Ga0495600_0567180 Ga0495600_0567180_206_460 73
357 3300047317 Ga0495604_0810485 Ga0495604_0810485_300_554 73
358 3300047322 Ga0495680_0395327 Ga0495680_0395327_171_425 73
359 3300047471 Ga0495684_0628110 Ga0495684_0628110_335_589 73
360 3300047673 Ga0495593_0376299 Ga0495593_0376299_280_516 73
361 3300048903 Ga0496100_0409799 Ga0496100_0409799_547_786 73
362 3300048903 Ga0496100_0488779 Ga0496100_0488779_109_342 73
363 3300048903 Ga0496100_0909778 Ga0496100_0909778_176_403 73
364 3300048904 Ga0496101_0250822 Ga0496101_0250822_752_985 73
365 3300048904 Ga0496101_0882498 Ga0496101_0882498_444_683 73
366 3300048905 Ga0496102_0755131 Ga0496102_0755131_378_617 73
367 3300048905 Ga0496102_0920772 Ga0496102_0920772_115_351 73
368 3300048905 Ga0496102_0930997 Ga0496102_0930997_476_700 73
369 3300048906 Ga0496103_0211746 Ga0496103_0211746_625_864 73
370 3300048907 Ga0496104_0386068 Ga0496104_0386068_686_922 73
371 3300048908 Ga0496105_0791462 Ga0496105_0791462_290_526 73
372 3300048911 Ga0496108_0264804 Ga0496108_0264804_346_576 73
373 3300048912 Ga0496109_1856818 Ga0496109_1856818_196_426 73
374 3300048912 Ga0496109_1893354 Ga0496109_1893354_91_327 73
375 3300048913 Ga0496110_0297706 Ga0496110_0297706_664_894 73
376 3300048913 Ga0496110_1149491 Ga0496110_1149491_273_497 73
377 3300048915 Ga0496112_0076295 Ga0496112_0076295_2631_2867 73
378 3300048917 Ga0496114_1172755 Ga0496114_1172755_338_565 73
379 3300049568 Ga0501031_0010913 Ga0501031_0010913_1613_1846 73
380 3300049568 Ga0501031_0038088 Ga0501031_0038088_2124_2357 73
381 3300049568 Ga0501031_0811598 Ga0501031_0811598_101_337 73
382 3300049569 Ga0501032_1061320 Ga0501032_1061320_119_352 73
383 3300049570 Ga0501033_0160590 Ga0501033_0160590_1324_1557 73
384 3300049572 Ga0501036_0047341 Ga0501036_0047341_130_363 73
385 3300049572 Ga0501036_0108780 Ga0501036_0108780_1350_1583 73
386 3300049572 Ga0501036_1083028 Ga0501036_1083028_29_259 73
387 3300049573 Ga0501037_0098688 Ga0501037_0098688_1503_1736 73
388 3300049574 Ga0501038_0303573 Ga0501038_0303573_24_257 73
389 3300049574 Ga0501038_0379203 Ga0501038_0379203_845_1078 73
390 3300049575 Ga0501039_0011222 Ga0501039_0011222_2906_3139 73
391 3300049575 Ga0501039_0102954 Ga0501039_0102954_819_1052 73
392 3300049576 Ga0501040_0000959 Ga0501040_0000959_4986_5219 73
393 3300049576 Ga0501040_0051137 Ga0501040_0051137_642_875 73
394 3300049577 Ga0501041_0021465 Ga0501041_0021465_2612_2845 73
395 3300049578 Ga0501042_0010114 Ga0501042_0010114_1002_1235 73
396 3300049578 Ga0501042_0011961 Ga0501042_0011961_1660_1893 73
397 3300049579 Ga0501043_0170638 Ga0501043_0170638_743_976 73
398 3300049580 Ga0501046_0045585 Ga0501046_0045585_2065_2298 73
399 3300049582 Ga0501048_0014367 Ga0501048_0014367_1744_1977 73
400 3300049582 Ga0501048_0016605 Ga0501048_0016605_1932_2165 73
401 3300049582 Ga0501048_0954305 Ga0501048_0954305_96_335 73
402 3300049583 Ga0501067_0060413 Ga0501067_0060413_1043_1273 73
403 3300049584 Ga0501068_0006738 Ga0501068_0006738_4664_4894 73
404 3300049584 Ga0501068_0063187 Ga0501068_0063187_189_422 73
405 3300049585 Ga0501069_0300699 Ga0501069_0300699_232_465 73
406 3300049587 Ga0501071_0021135 Ga0501071_0021135_1013_1246 73
407 3300049587 Ga0501071_0021276 Ga0501071_0021276_2001_2234 73
408 3300049587 Ga0501071_1383884 Ga0501071_1383884_155_394 73
409 3300049588 Ga0501072_0003784 Ga0501072_0003784_7506_7739 73
410 3300049588 Ga0501072_0009880 Ga0501072_0009880_3180_3413 73
411 3300049589 Ga0501073_0319930 Ga0501073_0319930_317_550 73
412 3300049589 Ga0501073_0489873 Ga0501073_0489873_408_641 73
413 3300049590 Ga0501074_0015108 Ga0501074_0015108_1983_2216 73
414 3300049590 Ga0501074_0018328 Ga0501074_0018328_3710_3943 73
415 3300049591 Ga0501075_0024962 Ga0501075_0024962_1235_1468 73
416 3300049591 Ga0501075_0038975 Ga0501075_0038975_1575_1808 73
417 3300049591 Ga0501075_1438077 Ga0501075_1438077_255_491 73
418 3300049592 Ga0501076_0003617 Ga0501076_0003617_6776_7009 73
419 3300049592 Ga0501076_0015559 Ga0501076_0015559_2689_2922 73
420 3300049592 Ga0501076_1090823 Ga0501076_1090823_340_576 73
421 3300049592 Ga0501076_1150136 Ga0501076_1150136_224_451 73
422 3300049593 Ga0501077_0013154 Ga0501077_0013154_3007_3240 73
423 3300049593 Ga0501077_0015744 Ga0501077_0015744_1787_2020 73
424 3300049741 Ga0501079_0006065 Ga0501079_0006065_1808_2041 73
425 3300049741 Ga0501079_0094918 Ga0501079_0094918_790_1023 73
426 3300049741 Ga0501079_0715156 Ga0501079_0715156_225_458 73
427 3300049742 Ga0501080_0081274 Ga0501080_0081274_1596_1829 73
428 3300049742 Ga0501080_0332643 Ga0501080_0332643_479_712 73
429 3300049743 Ga0501081_0015524 Ga0501081_0015524_1721_1954 73
430 3300049743 Ga0501081_0021810 Ga0501081_0021810_561_794 73
431 3300049770 Ga0501273_097382 Ga0501273_097382_234_470 73
432 3300049822 Ga0501035_0048076 Ga0501035_0048076_2676_2909 73
433 3300049822 Ga0501035_0057276 Ga0501035_0057276_1184_1417 73
434 3300049823 Ga0501044_0475688 Ga0501044_0475688_181_414 73
435 3300049824 Ga0501045_0005803 Ga0501045_0005803_4556_4789 73
436 3300049824 Ga0501045_0024513 Ga0501045_0024513_949_1182 73
437 3300050490 nmdc:mga03n38_422983_c1 nmdc:mga03n38_422983_c1_308_538 73
438 3300050491 nmdc:mga00v17_11892_c1 nmdc:mga00v17_11892_c1_3021_3251 73
439 3300050492 nmdc:mga0yw44_295304_c1 nmdc:mga0yw44_295304_c1_319_549 73
440 3300050492 nmdc:mga0yw44_5302_c1 nmdc:mga0yw44_5302_c1_5483_5713 73
441 3300050494 nmdc:mga06z11_54166_c1 nmdc:mga06z11_54166_c1_417_647 73
442 3300050507 nmdc:mga05p37_106964_c1 nmdc:mga05p37_106964_c1_227_463 73
443 3300050507 nmdc:mga05p37_1970528_c1 nmdc:mga05p37_1970528_c1_224_454 73
444 3300050509 nmdc:mga0qj67_410542_c1 nmdc:mga0qj67_410542_c1_394_621 73
445 3300050510 nmdc:mga06r32_1289846_c1 nmdc:mga06r32_1289846_c1_165_401 73
446 3300050511 nmdc:mga08y16_1683057_c1 nmdc:mga08y16_1683057_c1_217_447 73
447 3300050511 nmdc:mga08y16_193507_c1 nmdc:mga08y16_193507_c1_454_693 73
448 3300050511 nmdc:mga08y16_33642_c1 nmdc:mga08y16_33642_c1_3636_3872 73
449 3300050511 nmdc:mga08y16_399047_c1 nmdc:mga08y16_399047_c1_468_695 73
450 3300050512 nmdc:mga0n895_866175_c1 nmdc:mga0n895_866175_c1_181_417 73
451 3300050513 nmdc:mga0rr50_871929_c1 nmdc:mga0rr50_871929_c1_182_418 73
452 3300053085 Ga0495619_0666409 Ga0495619_0666409_261_515 73
453 3300054114 Ga0501084_0008866 Ga0501084_0008866_3698_3931 73
454 3300054114 Ga0501084_1092270 Ga0501084_1092270_303_542 73
455 3300059421 Ga0590071_056467 Ga0590071_056467_521_754 73
456 3300059424 Ga0590075_025527 Ga0590075_025527_53_286 73
457 3300060353 Ga0501082_0007521 Ga0501082_0007521_7125_7358 73
458 3300061719 Ga0466962_0168806 Ga0466962_0168806_150_380 73
459 3300061734 Ga0530510_0008919 Ga0530510_0008919_3027_3260 73
460 3300061734 Ga0530510_0014386 Ga0530510_0014386_3392_3625 73
461 3300061734 Ga0530510_0098694 Ga0530510_0098694_435_659 73
462 3300003320 rootH2_10204812 rootH2_102048122 74
463 3300005546 Ga0070696_100879762 Ga0070696_1008797621 74
464 3300025920 Ga0207649_10575921 Ga0207649_105759211 74
465 3300049583 Ga0501067_0024545 Ga0501067_0024545_1710_1934 74
466 3300049585 Ga0501069_0037789 Ga0501069_0037789_777_1001 74
467 3300049586 Ga0501070_0560655 Ga0501070_0560655_280_528 74
468 3300049591 Ga0501075_0735535 Ga0501075_0735535_335_652 74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5685 28 74
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.5406 30 72
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.5076 3 73
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.4758 3 73
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.443 30 72
ID Description Score Start End Superfamily
af_Q5AAR0_149_292_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.5425 23 54 1.20.930.10
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5406 30 72 1.10.10.1320
af_A8JV07_554_695_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.5348 25 55 1.20.930.10
af_D3ZAI0_403_485_1.10.10.790 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module 0.5017 1 74 1.10.10.790
af_D3ZAI0_403_485_1.10.10.790 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module 0.4958 1 74 1.10.10.790
ID Description Score Start End GO Terms
AF-A0A7W1YN45-F1-model_v4 Zinc-finger domain-containing protein 0.9613 25 71
AF-A0A847FN81-F1-model_v4 Zinc-finger domain-containing protein 0.9393 18 73
AF-A0A1F8U7R0-F1-model_v4 Zinc-finger domain-containing protein 0.9391 19 74
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9334 19 72
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.9319 17 69

Feature Viewer

pLDDT pTM Quality
85.6 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map