F450109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 258 | 468 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300046559|Ga0495667_0237748|Ga0495667_0237748_560_814 |
| Length | 84 |
| Sequence | VTERPEIDQMVGRLLGPSAPEVGCDECFDELDRFVELDLAGRDADAAIPGLRAHLAGCPACREEYESLRALVASDAGVDAPPGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 147 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 152 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 153 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 156 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 157 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 158 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 159 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 160 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 161 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 162 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 163 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 164 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 165 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 166 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 167 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 168 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 169 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 255 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 87.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10204812 | 3300003320 | Bacteria | 1986 |
| 2 | JGI25405J52794_10048495 | 3300003911 | Bacteria | 907 |
| 3 | Ga0070658_10548724 | 3300005327 | Bacteria | 1000 |
| 4 | Ga0070676_11026013 | 3300005328 | Bacteria | 620 |
| 5 | Ga0070683_100006939 | 3300005329 | Bacteria | 9521 |
| 6 | Ga0070683_100152490 | 3300005329 | Bacteria | 2191 |
| 7 | Ga0070683_101143408 | 3300005329 | Bacteria | 748 |
| 8 | Ga0070683_102114605 | 3300005329 | Bacteria | 541 |
| 9 | Ga0070670_100598472 | 3300005331 | Bacteria | 986 |
| 10 | Ga0070666_11073371 | 3300005335 | Bacteria | 598 |
| 11 | Ga0070680_100616405 | 3300005336 | Bacteria | 932 |
| 12 | Ga0070680_100829850 | 3300005336 | Bacteria | 797 |
| 13 | Ga0070680_100881340 | 3300005336 | Unclassified | 772 |
| 14 | Ga0070682_100409716 | 3300005337 | Bacteria | 1027 |
| 15 | Ga0068868_100070196 | 3300005338 | Bacteria | 2793 |
| 16 | Ga0068868_100532775 | 3300005338 | Bacteria | 1033 |
| 17 | Ga0070660_100699142 | 3300005339 | Bacteria | 850 |
| 18 | Ga0070691_10069720 | 3300005341 | Unclassified | 1705 |
| 19 | Ga0070687_100274651 | 3300005343 | Bacteria | 1058 |
| 20 | Ga0070687_100629241 | 3300005343 | Bacteria | 741 |
| 21 | Ga0070661_100120734 | 3300005344 | Bacteria | 1963 |
| 22 | Ga0070668_100954719 | 3300005347 | Bacteria | 769 |
| 23 | Ga0070675_100367744 | 3300005354 | Bacteria | 1278 |
| 24 | Ga0070675_100473470 | 3300005354 | Bacteria | 1126 |
| 25 | Ga0070671_100026115 | 3300005355 | Bacteria | 4798 |
| 26 | Ga0070674_100296188 | 3300005356 | Unclassified | 1288 |
| 27 | Ga0070673_101765473 | 3300005364 | Bacteria | 586 |
| 28 | Ga0070714_100042957 | 3300005435 | Bacteria | 3820 |
| 29 | Ga0070714_100588164 | 3300005435 | Bacteria | 1068 |
| 30 | Ga0070713_100113264 | 3300005436 | Bacteria | 2368 |
| 31 | Ga0070711_100017562 | 3300005439 | Unclassified | 4558 |
| 32 | Ga0070711_100514255 | 3300005439 | Bacteria | 989 |
| 33 | Ga0070705_100583897 | 3300005440 | Bacteria | 862 |
| 34 | Ga0070700_100381899 | 3300005441 | Bacteria | 1054 |
| 35 | Ga0070708_102242757 | 3300005445 | Bacteria | 504 |
| 36 | Ga0070678_100274732 | 3300005456 | Unclassified | 1422 |
| 37 | Ga0070678_100991016 | 3300005456 | Bacteria | 772 |
| 38 | Ga0070678_101971627 | 3300005456 | Unclassified | 552 |
| 39 | Ga0070681_10177344 | 3300005458 | Bacteria | 2053 |
| 40 | Ga0070681_10198916 | 3300005458 | Bacteria | 1923 |
| 41 | Ga0070681_10332184 | 3300005458 | Bacteria | 1430 |
| 42 | Ga0070698_100818805 | 3300005471 | Bacteria | 875 |
| 43 | Ga0070679_100038323 | 3300005530 | Bacteria | 4764 |
| 44 | Ga0070679_100331416 | 3300005530 | Bacteria | 1470 |
| 45 | Ga0070679_100780486 | 3300005530 | Bacteria | 899 |
| 46 | Ga0070684_100098139 | 3300005535 | Bacteria | 2613 |
| 47 | Ga0070684_100205084 | 3300005535 | Bacteria | 1796 |
| 48 | Ga0068853_102490858 | 3300005539 | Bacteria | 501 |
| 49 | Ga0070672_100270699 | 3300005543 | Bacteria | 1434 |
| 50 | Ga0070686_100069268 | 3300005544 | Unclassified | 2304 |
| 51 | Ga0070696_100879762 | 3300005546 | Unclassified | 742 |
| 52 | Ga0070693_100004354 | 3300005547 | Bacteria | 6684 |
| 53 | Ga0070693_100745762 | 3300005547 | Unclassified | 721 |
| 54 | Ga0070693_101632965 | 3300005547 | Bacteria | 507 |
| 55 | Ga0070704_100003595 | 3300005549 | Bacteria | 8910 |
| 56 | Ga0070664_100009206 | 3300005564 | Bacteria | 8017 |
| 57 | Ga0070664_102079426 | 3300005564 | Bacteria | 539 |
| 58 | Ga0068857_100130838 | 3300005577 | Bacteria | 2263 |
| 59 | Ga0068857_100411943 | 3300005577 | Bacteria | 1259 |
| 60 | Ga0068857_100427517 | 3300005577 | Bacteria | 1236 |
| 61 | Ga0068854_100038961 | 3300005578 | Bacteria | 3345 |
| 62 | Ga0068854_100504148 | 3300005578 | Bacteria | 1020 |
| 63 | Ga0068854_101803971 | 3300005578 | Bacteria | 561 |
| 64 | Ga0068856_100006197 | 3300005614 | Bacteria | 11733 |
| 65 | Ga0068856_100626505 | 3300005614 | Unclassified | 1096 |
| 66 | Ga0068856_100868709 | 3300005614 | Bacteria | 921 |
| 67 | Ga0068856_101901928 | 3300005614 | Bacteria | 606 |
| 68 | Ga0070702_100071723 | 3300005615 | Bacteria | 2048 |
| 69 | Ga0068852_102469686 | 3300005616 | Bacteria | 540 |
| 70 | Ga0068864_100021045 | 3300005618 | Bacteria | 5462 |
| 71 | Ga0068864_101260044 | 3300005618 | Bacteria | 739 |
| 72 | Ga0068870_10701847 | 3300005840 | Unclassified | 698 |
| 73 | Ga0068858_100472101 | 3300005842 | Unclassified | 1210 |
| 74 | Ga0068862_100267591 | 3300005844 | Bacteria | 1562 |
| 75 | Ga0068862_101113829 | 3300005844 | Bacteria | 785 |
| 76 | Ga0081455_10038797 | 3300005937 | Bacteria | 4216 |
| 77 | Ga0081455_10220790 | 3300005937 | Bacteria | 1405 |
| 78 | Ga0081455_10516257 | 3300005937 | Bacteria | 798 |
| 79 | Ga0081455_10571147 | 3300005937 | Bacteria | 743 |
| 80 | Ga0081538_10062341 | 3300005981 | Bacteria | 2127 |
| 81 | Ga0081538_10106037 | 3300005981 | Bacteria | 1397 |
| 82 | Ga0081538_10251586 | 3300005981 | Bacteria | 673 |
| 83 | Ga0081539_10006841 | 3300005985 | Bacteria | 10664 |
| 84 | Ga0070717_10417967 | 3300006028 | Bacteria | 1206 |
| 85 | Ga0075365_10196528 | 3300006038 | Unclassified | 1412 |
| 86 | Ga0075368_10036139 | 3300006042 | Bacteria | 1929 |
| 87 | Ga0075364_10045982 | 3300006051 | Bacteria | 2841 |
| 88 | Ga0070716_100095215 | 3300006173 | Bacteria | 1812 |
| 89 | Ga0070716_101035641 | 3300006173 | Bacteria | 651 |
| 90 | Ga0070712_100004685 | 3300006175 | Bacteria | 8454 |
| 91 | Ga0070712_100093938 | 3300006175 | Bacteria | 2203 |
| 92 | Ga0075367_10076818 | 3300006178 | Bacteria | 2016 |
| 93 | Ga0075367_10475592 | 3300006178 | Bacteria | 792 |
| 94 | Ga0075366_10507487 | 3300006195 | Bacteria | 746 |
| 95 | Ga0097621_100972260 | 3300006237 | Bacteria | 793 |
| 96 | Ga0068871_101258432 | 3300006358 | Bacteria | 695 |
| 97 | Ga0068871_101537845 | 3300006358 | Unclassified | 629 |
| 98 | Ga0075430_100609397 | 3300006846 | Bacteria | 901 |
| 99 | Ga0075431_101786465 | 3300006847 | Unclassified | 571 |
| 100 | Ga0075434_100683946 | 3300006871 | Bacteria | 1044 |
| 101 | Ga0075434_101089835 | 3300006871 | Bacteria | 812 |
| 102 | Ga0075429_101137212 | 3300006880 | Unclassified | 682 |
| 103 | Ga0068865_100523140 | 3300006881 | Bacteria | 992 |
| 104 | Ga0097620_101180101 | 3300006931 | Unclassified | 843 |
| 105 | Ga0075435_100202487 | 3300007076 | Bacteria | 1682 |
| 106 | Ga0075435_100446016 | 3300007076 | Bacteria | 1116 |
| 107 | Ga0111539_10016075 | 3300009094 | Bacteria | 9288 |
| 108 | Ga0111539_10025887 | 3300009094 | Bacteria | 7181 |
| 109 | Ga0111539_10134678 | 3300009094 | Bacteria | 2893 |
| 110 | Ga0111539_10255682 | 3300009094 | Bacteria | 2040 |
| 111 | Ga0111539_10426896 | 3300009094 | Bacteria | 1544 |
| 112 | Ga0105245_10354726 | 3300009098 | Bacteria | 1454 |
| 113 | Ga0105245_11494302 | 3300009098 | Bacteria | 726 |
| 114 | Ga0105245_11522405 | 3300009098 | Bacteria | 720 |
| 115 | Ga0114129_10058683 | 3300009147 | Bacteria | 5383 |
| 116 | Ga0114129_10527943 | 3300009147 | Bacteria | 1538 |
| 117 | Ga0105241_10624781 | 3300009174 | Bacteria | 976 |
| 118 | Ga0105241_11421367 | 3300009174 | Bacteria | 665 |
| 119 | Ga0105242_11710740 | 3300009176 | Unclassified | 665 |
| 120 | Ga0105248_11705195 | 3300009177 | Bacteria | 714 |
| 121 | Ga0105238_10908564 | 3300009551 | Bacteria | 899 |
| 122 | Ga0105249_10870683 | 3300009553 | Bacteria | 967 |
| 123 | Ga0105249_11200764 | 3300009553 | Bacteria | 829 |
| 124 | Ga0105239_10056775 | 3300010375 | Bacteria | 4295 |
| 125 | Ga0105239_11305881 | 3300010375 | Bacteria | 837 |
| 126 | Ga0105239_11701974 | 3300010375 | Bacteria | 730 |
| 127 | Ga0105239_13125440 | 3300010375 | Bacteria | 539 |
| 128 | Ga0105239_13547591 | 3300010375 | Bacteria | 507 |
| 129 | Ga0105246_10116941 | 3300011119 | Bacteria | 1969 |
| 130 | Ga0105246_10903242 | 3300011119 | Bacteria | 792 |
| 131 | Ga0157371_10456816 | 3300013102 | Bacteria | 939 |
| 132 | Ga0157371_11438615 | 3300013102 | Bacteria | 536 |
| 133 | Ga0157370_10483172 | 3300013104 | Bacteria | 1138 |
| 134 | Ga0157369_10265092 | 3300013105 | Bacteria | 1791 |
| 135 | Ga0157374_10171282 | 3300013296 | Bacteria | 2118 |
| 136 | Ga0157374_10270557 | 3300013296 | Bacteria | 1675 |
| 137 | Ga0157372_10452402 | 3300013307 | Bacteria | 1496 |
| 138 | Ga0157372_10825137 | 3300013307 | Bacteria | 1077 |
| 139 | Ga0157375_11308821 | 3300013308 | Bacteria | 852 |
| 140 | Ga0157375_12322231 | 3300013308 | Bacteria | 640 |
| 141 | Ga0163163_10774211 | 3300014325 | Unclassified | 1023 |
| 142 | Ga0182008_10497309 | 3300014497 | Bacteria | 670 |
| 143 | Ga0182008_10525424 | 3300014497 | Unclassified | 654 |
| 144 | Ga0157377_10023752 | 3300014745 | Bacteria | 3253 |
| 145 | Ga0157377_10166409 | 3300014745 | Bacteria | 1375 |
| 146 | Ga0182005_1116514 | 3300015265 | Unclassified | 758 |
| 147 | Ga0206353_10804249 | 3300020082 | Bacteria | 1577 |
| 148 | Ga0213876_10643718 | 3300021384 | Bacteria | 564 |
| 149 | Ga0207692_10199704 | 3300025898 | Bacteria | 1175 |
| 150 | Ga0207692_10675292 | 3300025898 | Unclassified | 669 |
| 151 | Ga0207680_10975550 | 3300025903 | Bacteria | 607 |
| 152 | Ga0207643_10255085 | 3300025908 | Bacteria | 1081 |
| 153 | Ga0207705_10500975 | 3300025909 | Unclassified | 943 |
| 154 | Ga0207705_11434492 | 3300025909 | Bacteria | 524 |
| 155 | Ga0207707_10028093 | 3300025912 | Bacteria | 4917 |
| 156 | Ga0207707_10220521 | 3300025912 | Bacteria | 1651 |
| 157 | Ga0207707_10483527 | 3300025912 | Bacteria | 1057 |
| 158 | Ga0207693_10013113 | 3300025915 | Bacteria | 6686 |
| 159 | Ga0207693_10025613 | 3300025915 | Bacteria | 4676 |
| 160 | Ga0207693_10961509 | 3300025915 | Bacteria | 653 |
| 161 | Ga0207663_10058431 | 3300025916 | Bacteria | 2434 |
| 162 | Ga0207663_10318123 | 3300025916 | Bacteria | 1169 |
| 163 | Ga0207660_10711163 | 3300025917 | Unclassified | 819 |
| 164 | Ga0207660_10742751 | 3300025917 | Bacteria | 801 |
| 165 | Ga0207662_10450456 | 3300025918 | Bacteria | 880 |
| 166 | Ga0207662_10742446 | 3300025918 | Bacteria | 690 |
| 167 | Ga0207657_10116388 | 3300025919 | Bacteria | 2203 |
| 168 | Ga0207657_11058267 | 3300025919 | Unclassified | 621 |
| 169 | Ga0207649_10003056 | 3300025920 | Bacteria | 9191 |
| 170 | Ga0207649_10575921 | 3300025920 | Bacteria | 864 |
| 171 | Ga0207649_11565872 | 3300025920 | Bacteria | 522 |
| 172 | Ga0207652_10689068 | 3300025921 | Bacteria | 912 |
| 173 | Ga0207652_11326595 | 3300025921 | Bacteria | 622 |
| 174 | Ga0207694_10469545 | 3300025924 | Unclassified | 1052 |
| 175 | Ga0207650_10347958 | 3300025925 | Bacteria | 1219 |
| 176 | Ga0207659_10309563 | 3300025926 | Bacteria | 1300 |
| 177 | Ga0207659_11426133 | 3300025926 | Bacteria | 593 |
| 178 | Ga0207687_10737704 | 3300025927 | Bacteria | 838 |
| 179 | Ga0207700_10287133 | 3300025928 | Bacteria | 1417 |
| 180 | Ga0207664_10883986 | 3300025929 | Bacteria | 803 |
| 181 | Ga0207644_10234009 | 3300025931 | Bacteria | 1461 |
| 182 | Ga0207644_11545651 | 3300025931 | Bacteria | 557 |
| 183 | Ga0207709_11472889 | 3300025935 | Bacteria | 564 |
| 184 | Ga0207669_10346682 | 3300025937 | Bacteria | 1146 |
| 185 | Ga0207669_10384455 | 3300025937 | Unclassified | 1095 |
| 186 | Ga0207665_10165909 | 3300025939 | Bacteria | 1592 |
| 187 | Ga0207689_10479412 | 3300025942 | Bacteria | 1041 |
| 188 | Ga0207661_10000864 | 3300025944 | Bacteria | 19886 |
| 189 | Ga0207661_10017485 | 3300025944 | Bacteria | 5309 |
| 190 | Ga0207661_10616752 | 3300025944 | Unclassified | 996 |
| 191 | Ga0207661_11780473 | 3300025944 | Bacteria | 561 |
| 192 | Ga0207679_10180486 | 3300025945 | Bacteria | 1746 |
| 193 | Ga0207679_10185752 | 3300025945 | Bacteria | 1723 |
| 194 | Ga0207651_11867628 | 3300025960 | Bacteria | 540 |
| 195 | Ga0207712_10612018 | 3300025961 | Bacteria | 943 |
| 196 | Ga0207640_10105937 | 3300025981 | Bacteria | 1982 |
| 197 | Ga0207640_11051453 | 3300025981 | Bacteria | 718 |
| 198 | Ga0207640_11263483 | 3300025981 | Bacteria | 658 |
| 199 | Ga0207677_10043872 | 3300026023 | Bacteria | 2975 |
| 200 | Ga0207677_10525883 | 3300026023 | Bacteria | 1027 |
| 201 | Ga0207677_11457454 | 3300026023 | Bacteria | 631 |
| 202 | Ga0207703_11357960 | 3300026035 | Bacteria | 684 |
| 203 | Ga0207639_11765497 | 3300026041 | Bacteria | 579 |
| 204 | Ga0207708_10120974 | 3300026075 | Bacteria | 2040 |
| 205 | Ga0207702_10009154 | 3300026078 | Bacteria | 8332 |
| 206 | Ga0207702_10605148 | 3300026078 | Unclassified | 1076 |
| 207 | Ga0207648_11732420 | 3300026089 | Bacteria | 586 |
| 208 | Ga0207676_11196311 | 3300026095 | Bacteria | 753 |
| 209 | Ga0207674_10036831 | 3300026116 | Bacteria | 5093 |
| 210 | Ga0207674_10349326 | 3300026116 | Bacteria | 1430 |
| 211 | Ga0207674_10368894 | 3300026116 | Bacteria | 1388 |
| 212 | Ga0207675_100449058 | 3300026118 | Bacteria | 1277 |
| 213 | Ga0207683_10089890 | 3300026121 | Unclassified | 2734 |
| 214 | Ga0207683_11134828 | 3300026121 | Bacteria | 725 |
| 215 | Ga0207428_10061175 | 3300027907 | Bacteria | 2982 |
| 216 | Ga0207428_10188472 | 3300027907 | Bacteria | 1555 |
| 217 | Ga0207428_10476951 | 3300027907 | Bacteria | 908 |
| 218 | Ga0268266_11291452 | 3300028379 | Bacteria | 705 |
| 219 | Ga0268266_11858205 | 3300028379 | Unclassified | 577 |
| 220 | Ga0268265_10412382 | 3300028380 | Bacteria | 1252 |
| 221 | Ga0268265_11486330 | 3300028380 | Bacteria | 681 |
| 222 | Ga0307408_100552566 | 3300031548 | Unclassified | 1016 |
| 223 | Ga0307405_11428502 | 3300031731 | Unclassified | 606 |
| 224 | Ga0307412_10701319 | 3300031911 | Bacteria | 869 |
| 225 | Ga0307409_100104867 | 3300031995 | Bacteria | 2356 |
| 226 | Ga0307409_101904251 | 3300031995 | Bacteria | 624 |
| 227 | Ga0307409_102961910 | 3300031995 | Bacteria | 501 |
| 228 | Ga0307416_100675742 | 3300032002 | Bacteria | 1120 |
| 229 | Ga0307416_100981508 | 3300032002 | Unclassified | 947 |
| 230 | Ga0307415_100008142 | 3300032126 | Bacteria | 5793 |
| 231 | Ga0307415_102320684 | 3300032126 | Unclassified | 526 |
| 232 | Ga0373961_0224650 | 3300035241 | Bacteria | 671 |
| 233 | Ga0373962_0171637 | 3300035242 | Bacteria | 720 |
| 234 | Ga0373947_0730329 | 3300035725 | Bacteria | 676 |
| 235 | Ga0373937_1061328 | 3300036401 | Bacteria | 759 |
| 236 | Ga0395899_0006592 | 3300037312 | Bacteria | 8995 |
| 237 | Ga0395899_0066507 | 3300037312 | Unclassified | 2646 |
| 238 | Ga0395900_0001810 | 3300037418 | Bacteria | 24466 |
| 239 | Ga0395900_0243090 | 3300037418 | Bacteria | 1805 |
| 240 | Ga0395900_1132637 | 3300037418 | Unclassified | 699 |
| 241 | Ga0395898_0018860 | 3300037466 | Bacteria | 7029 |
| 242 | Ga0395898_0069596 | 3300037466 | Bacteria | 3404 |
| 243 | Ga0395898_1044350 | 3300037466 | Bacteria | 752 |
| 244 | Ga0395905_0013593 | 3300037471 | Bacteria | 7798 |
| 245 | Ga0395905_0392845 | 3300037471 | Bacteria | 1282 |
| 246 | Ga0395905_0532183 | 3300037471 | Bacteria | 1076 |
| 247 | Ga0395905_0608441 | 3300037471 | Unclassified | 995 |
| 248 | Ga0395901_0010238 | 3300038443 | Bacteria | 9497 |
| 249 | Ga0395901_0090580 | 3300038443 | Bacteria | 3201 |
| 250 | Ga0395901_0166231 | 3300038443 | Unclassified | 2316 |
| 251 | Ga0395901_1144022 | 3300038443 | Bacteria | 747 |
| 252 | Ga0395901_1281793 | 3300038443 | Bacteria | 695 |
| 253 | Ga0436365_0355175 | 3300039437 | Bacteria | 579 |
| 254 | Ga0439439_0004574 | 3300041406 | Bacteria | 3128 |
| 255 | Ga0451789_1085657 | 3300041443 | Bacteria | 665 |
| 256 | Ga0451793_0308359 | 3300041452 | Bacteria | 954 |
| 257 | Ga0451802_0085701 | 3300041460 | Bacteria | 674 |
| 258 | Ga0451804_0096207 | 3300041463 | Bacteria | 1154 |
| 259 | Ga0451839_0903188 | 3300041496 | Bacteria | 619 |
| 260 | Ga0451849_1168296 | 3300041505 | Bacteria | 2057 |
| 261 | Ga0451851_1023841 | 3300041507 | Bacteria | 991 |
| 262 | Ga0451853_2486766 | 3300041512 | Bacteria | 1591 |
| 263 | Ga0439431_0050501 | 3300041997 | Bacteria | 1077 |
| 264 | Ga0439433_0042761 | 3300041999 | Bacteria | 1057 |
| 265 | Ga0439448_0028929 | 3300042005 | Bacteria | 1752 |
| 266 | Ga0439448_0168451 | 3300042005 | Unclassified | 764 |
| 267 | Ga0439450_097981 | 3300042008 | Bacteria | 742 |
| 268 | Ga0439451_082571 | 3300042009 | Bacteria | 646 |
| 269 | Ga0439456_068464 | 3300042013 | Bacteria | 785 |
| 270 | Ga0439462_0000555 | 3300042015 | Bacteria | 7394 |
| 271 | Ga0439463_064218 | 3300042016 | Bacteria | 939 |
| 272 | Ga0450922_035967 | 3300042124 | Bacteria | 551 |
| 273 | Ga0450898_120784 | 3300042134 | Bacteria | 559 |
| 274 | Ga0450902_007814 | 3300042137 | Bacteria | 1662 |
| 275 | Ga0450906_004386 | 3300042145 | Bacteria | 2959 |
| 276 | Ga0439446_0002209 | 3300042156 | Bacteria | 4642 |
| 277 | Ga0439459_0027868 | 3300042438 | Bacteria | 1130 |
| 278 | Ga0439440_0095730 | 3300042993 | Bacteria | 802 |
| 279 | Ga0466963_0019815 | 3300044694 | Bacteria | 4224 |
| 280 | Ga0466963_0027175 | 3300044694 | Bacteria | 3663 |
| 281 | Ga0466963_1000061 | 3300044694 | Bacteria | 589 |
| 282 | Ga0466971_0267239 | 3300044719 | Bacteria | 817 |
| 283 | Ga0466957_0398967 | 3300044842 | Bacteria | 940 |
| 284 | Ga0466959_0857008 | 3300045049 | Bacteria | 607 |
| 285 | Ga0466967_0016414 | 3300045976 | Bacteria | 5840 |
| 286 | Ga0466967_0058248 | 3300045976 | Bacteria | 3414 |
| 287 | Ga0466967_0091959 | 3300045976 | Bacteria | 2758 |
| 288 | Ga0466967_0465253 | 3300045976 | Bacteria | 1237 |
| 289 | Ga0466967_1235039 | 3300045976 | Bacteria | 744 |
| 290 | Ga0495653_0194187 | 3300046463 | Bacteria | 1383 |
| 291 | Ga0495608_0177006 | 3300046511 | Bacteria | 1351 |
| 292 | Ga0495628_0613926 | 3300046516 | Bacteria | 776 |
| 293 | Ga0495652_0207272 | 3300046529 | Bacteria | 1483 |
| 294 | Ga0495652_1038751 | 3300046529 | Unclassified | 534 |
| 295 | Ga0495645_0355566 | 3300046543 | Bacteria | 943 |
| 296 | Ga0495667_0237748 | 3300046559 | Bacteria | 1161 |
| 297 | Ga0495634_0069806 | 3300046642 | Bacteria | 2317 |
| 298 | Ga0495635_0223573 | 3300046663 | Bacteria | 1273 |
| 299 | Ga0495657_0746216 | 3300046675 | Bacteria | 561 |
| 300 | Ga0495600_0567180 | 3300046809 | Bacteria | 692 |
| 301 | Ga0495604_0810485 | 3300047317 | Bacteria | 589 |
| 302 | Ga0495674_1265237 | 3300047319 | Bacteria | 555 |
| 303 | Ga0495680_0395327 | 3300047322 | Bacteria | 955 |
| 304 | Ga0495680_0685891 | 3300047322 | Bacteria | 678 |
| 305 | Ga0495675_0673816 | 3300047444 | Bacteria | 581 |
| 306 | Ga0495684_0628110 | 3300047471 | Bacteria | 721 |
| 307 | Ga0495684_0816258 | 3300047471 | Bacteria | 608 |
| 308 | Ga0495593_0376299 | 3300047673 | Bacteria | 710 |
| 309 | Ga0495602_0670705 | 3300048088 | Bacteria | 706 |
| 310 | Ga0496100_0003140 | 3300048903 | Bacteria | 8560 |
| 311 | Ga0496100_0409799 | 3300048903 | Unclassified | 1034 |
| 312 | Ga0496100_0488779 | 3300048903 | Bacteria | 947 |
| 313 | Ga0496100_0909778 | 3300048903 | Bacteria | 691 |
| 314 | Ga0496101_0005451 | 3300048904 | Bacteria | 8111 |
| 315 | Ga0496101_0250822 | 3300048904 | Bacteria | 1379 |
| 316 | Ga0496101_0882498 | 3300048904 | Bacteria | 704 |
| 317 | Ga0496102_0052646 | 3300048905 | Unclassified | 3709 |
| 318 | Ga0496102_0755131 | 3300048905 | Bacteria | 895 |
| 319 | Ga0496102_0920772 | 3300048905 | Bacteria | 796 |
| 320 | Ga0496102_0930997 | 3300048905 | Bacteria | 790 |
| 321 | Ga0496103_0035484 | 3300048906 | Unclassified | 3053 |
| 322 | Ga0496103_0211746 | 3300048906 | Bacteria | 1246 |
| 323 | Ga0496104_0000278 | 3300048907 | Bacteria | 45634 |
| 324 | Ga0496104_0386068 | 3300048907 | Bacteria | 1313 |
| 325 | Ga0496105_0139318 | 3300048908 | Bacteria | 1997 |
| 326 | Ga0496105_0791462 | 3300048908 | Bacteria | 722 |
| 327 | Ga0496106_0196371 | 3300048909 | Bacteria | 1605 |
| 328 | Ga0496107_0902367 | 3300048910 | Bacteria | 644 |
| 329 | Ga0496108_0002990 | 3300048911 | Bacteria | 13582 |
| 330 | Ga0496108_0264804 | 3300048911 | Bacteria | 1496 |
| 331 | Ga0496109_0009286 | 3300048912 | Bacteria | 8379 |
| 332 | Ga0496109_1856818 | 3300048912 | Bacteria | 535 |
| 333 | Ga0496109_1893354 | 3300048912 | Bacteria | 529 |
| 334 | Ga0496110_0016483 | 3300048913 | Bacteria | 6171 |
| 335 | Ga0496110_0297706 | 3300048913 | Bacteria | 1470 |
| 336 | Ga0496110_1149491 | 3300048913 | Bacteria | 685 |
| 337 | Ga0496111_0008333 | 3300048914 | Bacteria | 6853 |
| 338 | Ga0496112_0076295 | 3300048915 | Bacteria | 3315 |
| 339 | Ga0496112_0384654 | 3300048915 | Bacteria | 1344 |
| 340 | Ga0496113_0075358 | 3300048916 | Unclassified | 2575 |
| 341 | Ga0496114_0133499 | 3300048917 | Unclassified | 2145 |
| 342 | Ga0496114_0576667 | 3300048917 | Unclassified | 993 |
| 343 | Ga0496114_1172755 | 3300048917 | Bacteria | 654 |
| 344 | Ga0496115_0000616 | 3300048918 | Bacteria | 27043 |
| 345 | Ga0501031_0010913 | 3300049568 | Bacteria | 5916 |
| 346 | Ga0501031_0038088 | 3300049568 | Bacteria | 3139 |
| 347 | Ga0501031_0453480 | 3300049568 | Unclassified | 828 |
| 348 | Ga0501031_0811598 | 3300049568 | Bacteria | 600 |
| 349 | Ga0501032_1061320 | 3300049569 | Bacteria | 508 |
| 350 | Ga0501033_0160590 | 3300049570 | Bacteria | 1618 |
| 351 | Ga0501033_0599600 | 3300049570 | Bacteria | 755 |
| 352 | Ga0501036_0002524 | 3300049572 | Bacteria | 14364 |
| 353 | Ga0501036_0047341 | 3300049572 | Bacteria | 3642 |
| 354 | Ga0501036_0108780 | 3300049572 | Bacteria | 2343 |
| 355 | Ga0501036_1083028 | 3300049572 | Bacteria | 655 |
| 356 | Ga0501037_0071912 | 3300049573 | Bacteria | 2516 |
| 357 | Ga0501037_0098688 | 3300049573 | Bacteria | 2110 |
| 358 | Ga0501037_0293173 | 3300049573 | Bacteria | 1131 |
| 359 | Ga0501038_0014110 | 3300049574 | Bacteria | 7278 |
| 360 | Ga0501038_0303573 | 3300049574 | Bacteria | 1252 |
| 361 | Ga0501038_0379203 | 3300049574 | Bacteria | 1097 |
| 362 | Ga0501039_0011222 | 3300049575 | Bacteria | 6828 |
| 363 | Ga0501039_0020844 | 3300049575 | Bacteria | 5025 |
| 364 | Ga0501039_0102954 | 3300049575 | Bacteria | 2228 |
| 365 | Ga0501040_0000959 | 3300049576 | Bacteria | 18211 |
| 366 | Ga0501040_0051137 | 3300049576 | Bacteria | 2827 |
| 367 | Ga0501040_0095039 | 3300049576 | Bacteria | 2074 |
| 368 | Ga0501041_0021465 | 3300049577 | Bacteria | 3868 |
| 369 | Ga0501041_0055623 | 3300049577 | Bacteria | 2416 |
| 370 | Ga0501042_0010114 | 3300049578 | Bacteria | 6309 |
| 371 | Ga0501042_0011961 | 3300049578 | Bacteria | 5865 |
| 372 | Ga0501042_0015103 | 3300049578 | Bacteria | 5279 |
| 373 | Ga0501042_0151712 | 3300049578 | Bacteria | 1671 |
| 374 | Ga0501042_0860808 | 3300049578 | Bacteria | 660 |
| 375 | Ga0501043_0170638 | 3300049579 | Bacteria | 1697 |
| 376 | Ga0501046_0045585 | 3300049580 | Bacteria | 3483 |
| 377 | Ga0501046_0188633 | 3300049580 | Bacteria | 1539 |
| 378 | Ga0501048_0014367 | 3300049582 | Bacteria | 5864 |
| 379 | Ga0501048_0016605 | 3300049582 | Bacteria | 5428 |
| 380 | Ga0501048_0076854 | 3300049582 | Bacteria | 2356 |
| 381 | Ga0501048_0887292 | 3300049582 | Bacteria | 641 |
| 382 | Ga0501048_0954305 | 3300049582 | Bacteria | 617 |
| 383 | Ga0501067_0024545 | 3300049583 | Bacteria | 3344 |
| 384 | Ga0501067_0060413 | 3300049583 | Bacteria | 2098 |
| 385 | Ga0501068_0006738 | 3300049584 | Bacteria | 6347 |
| 386 | Ga0501068_0063187 | 3300049584 | Bacteria | 2252 |
| 387 | Ga0501069_0037789 | 3300049585 | Bacteria | 2664 |
| 388 | Ga0501069_0300699 | 3300049585 | Bacteria | 941 |
| 389 | Ga0501070_0560655 | 3300049586 | Bacteria | 914 |
| 390 | Ga0501071_0021135 | 3300049587 | Bacteria | 4532 |
| 391 | Ga0501071_0021276 | 3300049587 | Bacteria | 4515 |
| 392 | Ga0501071_1383884 | 3300049587 | Bacteria | 543 |
| 393 | Ga0501071_1454537 | 3300049587 | Unclassified | 529 |
| 394 | Ga0501072_0003784 | 3300049588 | Bacteria | 11426 |
| 395 | Ga0501072_0009880 | 3300049588 | Bacteria | 7257 |
| 396 | Ga0501073_0319930 | 3300049589 | Bacteria | 1071 |
| 397 | Ga0501073_0489873 | 3300049589 | Bacteria | 850 |
| 398 | Ga0501074_0015108 | 3300049590 | Bacteria | 5615 |
| 399 | Ga0501074_0018328 | 3300049590 | Bacteria | 5085 |
| 400 | Ga0501075_0024962 | 3300049591 | Bacteria | 4388 |
| 401 | Ga0501075_0038975 | 3300049591 | Bacteria | 3554 |
| 402 | Ga0501075_0735535 | 3300049591 | Bacteria | 751 |
| 403 | Ga0501075_0998171 | 3300049591 | Bacteria | 636 |
| 404 | Ga0501075_1438077 | 3300049591 | Bacteria | 522 |
| 405 | Ga0501076_0003617 | 3300049592 | Bacteria | 10853 |
| 406 | Ga0501076_0015559 | 3300049592 | Bacteria | 5753 |
| 407 | Ga0501076_0041701 | 3300049592 | Bacteria | 3612 |
| 408 | Ga0501076_0713451 | 3300049592 | Bacteria | 828 |
| 409 | Ga0501076_1090823 | 3300049592 | Bacteria | 657 |
| 410 | Ga0501076_1150136 | 3300049592 | Bacteria | 639 |
| 411 | Ga0501077_0013154 | 3300049593 | Bacteria | 5185 |
| 412 | Ga0501077_0015744 | 3300049593 | Bacteria | 4762 |
| 413 | Ga0501077_0032408 | 3300049593 | Bacteria | 3326 |
| 414 | Ga0501079_0006065 | 3300049741 | Bacteria | 9056 |
| 415 | Ga0501079_0094918 | 3300049741 | Bacteria | 2311 |
| 416 | Ga0501079_0632545 | 3300049741 | Bacteria | 842 |
| 417 | Ga0501079_0715156 | 3300049741 | Bacteria | 788 |
| 418 | Ga0501079_1596653 | 3300049741 | Bacteria | 513 |
| 419 | Ga0501080_0081274 | 3300049742 | Bacteria | 3011 |
| 420 | Ga0501080_0332643 | 3300049742 | Bacteria | 1373 |
| 421 | Ga0501081_0015524 | 3300049743 | Bacteria | 5026 |
| 422 | Ga0501081_0021810 | 3300049743 | Bacteria | 4278 |
| 423 | Ga0501081_0037476 | 3300049743 | Bacteria | 3308 |
| 424 | Ga0501081_0900756 | 3300049743 | Bacteria | 667 |
| 425 | Ga0501083_0063298 | 3300049744 | Bacteria | 2467 |
| 426 | Ga0501273_097382 | 3300049770 | Bacteria | 507 |
| 427 | Ga0501035_0048076 | 3300049822 | Bacteria | 3827 |
| 428 | Ga0501035_0057276 | 3300049822 | Bacteria | 3475 |
| 429 | Ga0501035_0177956 | 3300049822 | Bacteria | 1834 |
| 430 | Ga0501044_0475688 | 3300049823 | Bacteria | 1153 |
| 431 | Ga0501045_0005803 | 3300049824 | Bacteria | 8544 |
| 432 | Ga0501045_0019316 | 3300049824 | Bacteria | 4856 |
| 433 | Ga0501045_0024513 | 3300049824 | Bacteria | 4332 |
| 434 | nmdc:mga03n38_422983_c1 | 3300050490 | Bacteria | 737 |
| 435 | nmdc:mga00v17_11892_c1 | 3300050491 | Bacteria | 4792 |
| 436 | nmdc:mga0yw44_295304_c1 | 3300050492 | Bacteria | 1085 |
| 437 | nmdc:mga0yw44_5302_c1 | 3300050492 | Bacteria | 6061 |
| 438 | nmdc:mga06z11_348262_c1 | 3300050494 | Bacteria | 886 |
| 439 | nmdc:mga06z11_54166_c1 | 3300050494 | Bacteria | 2066 |
| 440 | nmdc:mga05p37_106964_c1 | 3300050507 | Bacteria | 3441 |
| 441 | nmdc:mga05p37_1970528_c1 | 3300050507 | Bacteria | 554 |
| 442 | nmdc:mga09592_1007590_c1 | 3300050508 | Unclassified | 696 |
| 443 | nmdc:mga0qj67_410542_c1 | 3300050509 | Bacteria | 1092 |
| 444 | nmdc:mga06r32_1289846_c1 | 3300050510 | Bacteria | 674 |
| 445 | nmdc:mga08y16_1683057_c1 | 3300050511 | Bacteria | 590 |
| 446 | nmdc:mga08y16_193507_c1 | 3300050511 | Bacteria | 2109 |
| 447 | nmdc:mga08y16_33642_c1 | 3300050511 | Bacteria | 5382 |
| 448 | nmdc:mga08y16_399047_c1 | 3300050511 | Bacteria | 1408 |
| 449 | nmdc:mga0n895_866175_c1 | 3300050512 | Bacteria | 890 |
| 450 | nmdc:mga0rr50_463143_c1 | 3300050513 | Bacteria | 1075 |
| 451 | nmdc:mga0rr50_871929_c1 | 3300050513 | Bacteria | 767 |
| 452 | Ga0495595_0078967 | 3300053084 | Bacteria | 1565 |
| 453 | Ga0495619_0311079 | 3300053085 | Bacteria | 1091 |
| 454 | Ga0495619_0666409 | 3300053085 | Bacteria | 709 |
| 455 | Ga0501084_0008866 | 3300054114 | Bacteria | 8324 |
| 456 | Ga0501084_0030486 | 3300054114 | Bacteria | 4509 |
| 457 | Ga0501084_0289360 | 3300054114 | Bacteria | 1384 |
| 458 | Ga0501084_1092270 | 3300054114 | Bacteria | 670 |
| 459 | Ga0590071_056467 | 3300059421 | Unclassified | 955 |
| 460 | Ga0590075_025527 | 3300059424 | Bacteria | 1485 |
| 461 | Ga0501082_0007521 | 3300060353 | Bacteria | 9401 |
| 462 | Ga0501082_0126268 | 3300060353 | Bacteria | 2219 |
| 463 | Ga0501082_0143228 | 3300060353 | Bacteria | 2074 |
| 464 | Ga0466962_0168806 | 3300061719 | Bacteria | 1065 |
| 465 | Ga0530510_0008919 | 3300061734 | Bacteria | 7021 |
| 466 | Ga0530510_0014386 | 3300061734 | Bacteria | 5579 |
| 467 | Ga0530510_0098694 | 3300061734 | Bacteria | 2135 |
| 468 | Ga0530510_0869485 | 3300061734 | Bacteria | 689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0166231 | Ga0395901_0166231_2098_2304 | 65 |
| 2 | 3300006178 | Ga0075367_10475592 | Ga0075367_104755922 | 66 |
| 3 | 3300010375 | Ga0105239_10056775 | Ga0105239_100567751 | 66 |
| 4 | 3300014745 | Ga0157377_10166409 | Ga0157377_101664093 | 66 |
| 5 | 3300049587 | Ga0501071_1454537 | Ga0501071_1454537_217_423 | 66 |
| 6 | 3300050494 | nmdc:mga06z11_348262_c1 | nmdc:mga06z11_348262_c1_304_513 | 66 |
| 7 | 3300060353 | Ga0501082_0126268 | Ga0501082_0126268_1603_1809 | 66 |
| 8 | 3300061734 | Ga0530510_0869485 | Ga0530510_0869485_85_291 | 66 |
| 9 | 3300045049 | Ga0466959_0857008 | Ga0466959_0857008_365_577 | 68 |
| 10 | 3300045976 | Ga0466967_1235039 | Ga0466967_1235039_365_577 | 68 |
| 11 | 3300047319 | Ga0495674_1265237 | Ga0495674_1265237_40_297 | 68 |
| 12 | 3300006880 | Ga0075429_101137212 | Ga0075429_1011372122 | 69 |
| 13 | 3300010375 | Ga0105239_13125440 | Ga0105239_131254401 | 69 |
| 14 | 3300032126 | Ga0307415_102320684 | Ga0307415_1023206842 | 69 |
| 15 | 3300046463 | Ga0495653_0194187 | Ga0495653_0194187_87_308 | 69 |
| 16 | 3300046511 | Ga0495608_0177006 | Ga0495608_0177006_337_558 | 69 |
| 17 | 3300046516 | Ga0495628_0613926 | Ga0495628_0613926_217_438 | 69 |
| 18 | 3300046529 | Ga0495652_0207272 | Ga0495652_0207272_439_660 | 69 |
| 19 | 3300046543 | Ga0495645_0355566 | Ga0495645_0355566_42_263 | 69 |
| 20 | 3300046642 | Ga0495634_0069806 | Ga0495634_0069806_1666_1887 | 69 |
| 21 | 3300046663 | Ga0495635_0223573 | Ga0495635_0223573_122_343 | 69 |
| 22 | 3300047322 | Ga0495680_0685891 | Ga0495680_0685891_343_564 | 69 |
| 23 | 3300047444 | Ga0495675_0673816 | Ga0495675_0673816_25_246 | 69 |
| 24 | 3300047471 | Ga0495684_0816258 | Ga0495684_0816258_298_519 | 69 |
| 25 | 3300048088 | Ga0495602_0670705 | Ga0495602_0670705_217_438 | 69 |
| 26 | 3300049568 | Ga0501031_0453480 | Ga0501031_0453480_177_395 | 69 |
| 27 | 3300049570 | Ga0501033_0599600 | Ga0501033_0599600_242_460 | 69 |
| 28 | 3300049572 | Ga0501036_0002524 | Ga0501036_0002524_11820_12038 | 69 |
| 29 | 3300049573 | Ga0501037_0071912 | Ga0501037_0071912_1773_1991 | 69 |
| 30 | 3300049574 | Ga0501038_0014110 | Ga0501038_0014110_4089_4307 | 69 |
| 31 | 3300049575 | Ga0501039_0020844 | Ga0501039_0020844_2581_2799 | 69 |
| 32 | 3300049576 | Ga0501040_0095039 | Ga0501040_0095039_1633_1851 | 69 |
| 33 | 3300049577 | Ga0501041_0055623 | Ga0501041_0055623_585_803 | 69 |
| 34 | 3300049578 | Ga0501042_0015103 | Ga0501042_0015103_2787_3005 | 69 |
| 35 | 3300049578 | Ga0501042_0151712 | Ga0501042_0151712_78_296 | 69 |
| 36 | 3300049582 | Ga0501048_0076854 | Ga0501048_0076854_1626_1844 | 69 |
| 37 | 3300049591 | Ga0501075_0998171 | Ga0501075_0998171_115_333 | 69 |
| 38 | 3300049592 | Ga0501076_0041701 | Ga0501076_0041701_1075_1293 | 69 |
| 39 | 3300049593 | Ga0501077_0032408 | Ga0501077_0032408_448_666 | 69 |
| 40 | 3300049741 | Ga0501079_0632545 | Ga0501079_0632545_15_233 | 69 |
| 41 | 3300049743 | Ga0501081_0037476 | Ga0501081_0037476_123_341 | 69 |
| 42 | 3300049744 | Ga0501083_0063298 | Ga0501083_0063298_1266_1484 | 69 |
| 43 | 3300049822 | Ga0501035_0177956 | Ga0501035_0177956_1013_1231 | 69 |
| 44 | 3300049824 | Ga0501045_0019316 | Ga0501045_0019316_1175_1393 | 69 |
| 45 | 3300050508 | nmdc:mga09592_1007590_c1 | nmdc:mga09592_1007590_c1_313_528 | 69 |
| 46 | 3300053084 | Ga0495595_0078967 | Ga0495595_0078967_1021_1242 | 69 |
| 47 | 3300053085 | Ga0495619_0311079 | Ga0495619_0311079_439_660 | 69 |
| 48 | 3300054114 | Ga0501084_0030486 | Ga0501084_0030486_2230_2448 | 69 |
| 49 | 3300054114 | Ga0501084_0289360 | Ga0501084_0289360_1111_1329 | 69 |
| 50 | 3300060353 | Ga0501082_0143228 | Ga0501082_0143228_1807_2025 | 69 |
| 51 | 3300005842 | Ga0068858_100472101 | Ga0068858_1004721013 | 70 |
| 52 | 3300005981 | Ga0081538_10062341 | Ga0081538_100623413 | 70 |
| 53 | 3300026035 | Ga0207703_11357960 | Ga0207703_113579602 | 70 |
| 54 | 3300026118 | Ga0207675_100449058 | Ga0207675_1004490583 | 70 |
| 55 | 3300050513 | nmdc:mga0rr50_463143_c1 | nmdc:mga0rr50_463143_c1_162_389 | 70 |
| 56 | 3300005355 | Ga0070671_100026115 | Ga0070671_1000261154 | 71 |
| 57 | 3300005435 | Ga0070714_100588164 | Ga0070714_1005881642 | 71 |
| 58 | 3300005436 | Ga0070713_100113264 | Ga0070713_1001132643 | 71 |
| 59 | 3300005439 | Ga0070711_100017562 | Ga0070711_1000175623 | 71 |
| 60 | 3300005456 | Ga0070678_101971627 | Ga0070678_1019716272 | 71 |
| 61 | 3300006028 | Ga0070717_10417967 | Ga0070717_104179672 | 71 |
| 62 | 3300006173 | Ga0070716_100095215 | Ga0070716_1000952152 | 71 |
| 63 | 3300006175 | Ga0070712_100004685 | Ga0070712_1000046856 | 71 |
| 64 | 3300006358 | Ga0068871_101537845 | Ga0068871_1015378452 | 71 |
| 65 | 3300009174 | Ga0105241_10624781 | Ga0105241_106247812 | 71 |
| 66 | 3300009176 | Ga0105242_11710740 | Ga0105242_117107401 | 71 |
| 67 | 3300009177 | Ga0105248_11705195 | Ga0105248_117051952 | 71 |
| 68 | 3300013296 | Ga0157374_10270557 | Ga0157374_102705572 | 71 |
| 69 | 3300013308 | Ga0157375_11308821 | Ga0157375_113088212 | 71 |
| 70 | 3300025898 | Ga0207692_10199704 | Ga0207692_101997042 | 71 |
| 71 | 3300025898 | Ga0207692_10675292 | Ga0207692_106752922 | 71 |
| 72 | 3300025915 | Ga0207693_10013113 | Ga0207693_100131136 | 71 |
| 73 | 3300025916 | Ga0207663_10058431 | Ga0207663_100584315 | 71 |
| 74 | 3300025928 | Ga0207700_10287133 | Ga0207700_102871332 | 71 |
| 75 | 3300025929 | Ga0207664_10883986 | Ga0207664_108839862 | 71 |
| 76 | 3300025931 | Ga0207644_10234009 | Ga0207644_102340092 | 71 |
| 77 | 3300025939 | Ga0207665_10165909 | Ga0207665_101659091 | 71 |
| 78 | 3300028379 | Ga0268266_11858205 | Ga0268266_118582051 | 71 |
| 79 | 3300035241 | Ga0373961_0224650 | Ga0373961_0224650_247_471 | 71 |
| 80 | 3300045976 | Ga0466967_0091959 | Ga0466967_0091959_1487_1708 | 71 |
| 81 | 3300048903 | Ga0496100_0003140 | Ga0496100_0003140_5007_5231 | 71 |
| 82 | 3300048904 | Ga0496101_0005451 | Ga0496101_0005451_2982_3206 | 71 |
| 83 | 3300048905 | Ga0496102_0052646 | Ga0496102_0052646_1317_1541 | 71 |
| 84 | 3300048906 | Ga0496103_0035484 | Ga0496103_0035484_621_845 | 71 |
| 85 | 3300048907 | Ga0496104_0000278 | Ga0496104_0000278_10932_11156 | 71 |
| 86 | 3300048908 | Ga0496105_0139318 | Ga0496105_0139318_1130_1354 | 71 |
| 87 | 3300048909 | Ga0496106_0196371 | Ga0496106_0196371_1257_1481 | 71 |
| 88 | 3300048910 | Ga0496107_0902367 | Ga0496107_0902367_27_251 | 71 |
| 89 | 3300048911 | Ga0496108_0002990 | Ga0496108_0002990_9147_9371 | 71 |
| 90 | 3300048912 | Ga0496109_0009286 | Ga0496109_0009286_2982_3206 | 71 |
| 91 | 3300048913 | Ga0496110_0016483 | Ga0496110_0016483_2790_3014 | 71 |
| 92 | 3300048914 | Ga0496111_0008333 | Ga0496111_0008333_3061_3285 | 71 |
| 93 | 3300048915 | Ga0496112_0384654 | Ga0496112_0384654_225_449 | 71 |
| 94 | 3300048916 | Ga0496113_0075358 | Ga0496113_0075358_2330_2554 | 71 |
| 95 | 3300048917 | Ga0496114_0133499 | Ga0496114_0133499_375_599 | 71 |
| 96 | 3300048918 | Ga0496115_0000616 | Ga0496115_0000616_13778_14002 | 71 |
| 97 | 3300005327 | Ga0070658_10548724 | Ga0070658_105487242 | 72 |
| 98 | 3300005328 | Ga0070676_11026013 | Ga0070676_110260131 | 72 |
| 99 | 3300005335 | Ga0070666_11073371 | Ga0070666_110733712 | 72 |
| 100 | 3300005614 | Ga0068856_100868709 | Ga0068856_1008687091 | 72 |
| 101 | 3300005616 | Ga0068852_102469686 | Ga0068852_1024696862 | 72 |
| 102 | 3300006931 | Ga0097620_101180101 | Ga0097620_1011801012 | 72 |
| 103 | 3300007076 | Ga0075435_100202487 | Ga0075435_1002024874 | 72 |
| 104 | 3300025909 | Ga0207705_11434492 | Ga0207705_114344921 | 72 |
| 105 | 3300025919 | Ga0207657_11058267 | Ga0207657_110582672 | 72 |
| 106 | 3300046675 | Ga0495657_0746216 | Ga0495657_0746216_286_513 | 72 |
| 107 | 3300048917 | Ga0496114_0576667 | Ga0496114_0576667_280_513 | 72 |
| 108 | 3300049573 | Ga0501037_0293173 | Ga0501037_0293173_160_390 | 72 |
| 109 | 3300049578 | Ga0501042_0860808 | Ga0501042_0860808_365_589 | 72 |
| 110 | 3300049580 | Ga0501046_0188633 | Ga0501046_0188633_296_520 | 72 |
| 111 | 3300049582 | Ga0501048_0887292 | Ga0501048_0887292_334_558 | 72 |
| 112 | 3300049592 | Ga0501076_0713451 | Ga0501076_0713451_175_399 | 72 |
| 113 | 3300049741 | Ga0501079_1596653 | Ga0501079_1596653_69_290 | 72 |
| 114 | 3300049743 | Ga0501081_0900756 | Ga0501081_0900756_382_603 | 72 |
| 115 | 3300003911 | JGI25405J52794_10048495 | JGI25405J52794_100484952 | 73 |
| 116 | 3300005329 | Ga0070683_100006939 | Ga0070683_1000069396 | 73 |
| 117 | 3300005329 | Ga0070683_100152490 | Ga0070683_1001524902 | 73 |
| 118 | 3300005329 | Ga0070683_101143408 | Ga0070683_1011434082 | 73 |
| 119 | 3300005329 | Ga0070683_102114605 | Ga0070683_1021146051 | 73 |
| 120 | 3300005331 | Ga0070670_100598472 | Ga0070670_1005984722 | 73 |
| 121 | 3300005336 | Ga0070680_100616405 | Ga0070680_1006164051 | 73 |
| 122 | 3300005336 | Ga0070680_100829850 | Ga0070680_1008298502 | 73 |
| 123 | 3300005336 | Ga0070680_100881340 | Ga0070680_1008813402 | 73 |
| 124 | 3300005337 | Ga0070682_100409716 | Ga0070682_1004097162 | 73 |
| 125 | 3300005338 | Ga0068868_100070196 | Ga0068868_1000701966 | 73 |
| 126 | 3300005338 | Ga0068868_100532775 | Ga0068868_1005327752 | 73 |
| 127 | 3300005339 | Ga0070660_100699142 | Ga0070660_1006991422 | 73 |
| 128 | 3300005341 | Ga0070691_10069720 | Ga0070691_100697203 | 73 |
| 129 | 3300005343 | Ga0070687_100274651 | Ga0070687_1002746512 | 73 |
| 130 | 3300005343 | Ga0070687_100629241 | Ga0070687_1006292412 | 73 |
| 131 | 3300005344 | Ga0070661_100120734 | Ga0070661_1001207344 | 73 |
| 132 | 3300005347 | Ga0070668_100954719 | Ga0070668_1009547192 | 73 |
| 133 | 3300005354 | Ga0070675_100367744 | Ga0070675_1003677443 | 73 |
| 134 | 3300005354 | Ga0070675_100473470 | Ga0070675_1004734703 | 73 |
| 135 | 3300005356 | Ga0070674_100296188 | Ga0070674_1002961883 | 73 |
| 136 | 3300005364 | Ga0070673_101765473 | Ga0070673_1017654732 | 73 |
| 137 | 3300005435 | Ga0070714_100042957 | Ga0070714_1000429574 | 73 |
| 138 | 3300005439 | Ga0070711_100514255 | Ga0070711_1005142552 | 73 |
| 139 | 3300005440 | Ga0070705_100583897 | Ga0070705_1005838972 | 73 |
| 140 | 3300005441 | Ga0070700_100381899 | Ga0070700_1003818992 | 73 |
| 141 | 3300005445 | Ga0070708_102242757 | Ga0070708_1022427571 | 73 |
| 142 | 3300005456 | Ga0070678_100274732 | Ga0070678_1002747322 | 73 |
| 143 | 3300005456 | Ga0070678_100991016 | Ga0070678_1009910162 | 73 |
| 144 | 3300005458 | Ga0070681_10177344 | Ga0070681_101773444 | 73 |
| 145 | 3300005458 | Ga0070681_10198916 | Ga0070681_101989163 | 73 |
| 146 | 3300005458 | Ga0070681_10332184 | Ga0070681_103321843 | 73 |
| 147 | 3300005471 | Ga0070698_100818805 | Ga0070698_1008188052 | 73 |
| 148 | 3300005530 | Ga0070679_100038323 | Ga0070679_1000383236 | 73 |
| 149 | 3300005530 | Ga0070679_100331416 | Ga0070679_1003314162 | 73 |
| 150 | 3300005530 | Ga0070679_100780486 | Ga0070679_1007804862 | 73 |
| 151 | 3300005535 | Ga0070684_100098139 | Ga0070684_1000981394 | 73 |
| 152 | 3300005535 | Ga0070684_100205084 | Ga0070684_1002050843 | 73 |
| 153 | 3300005539 | Ga0068853_102490858 | Ga0068853_1024908582 | 73 |
| 154 | 3300005543 | Ga0070672_100270699 | Ga0070672_1002706993 | 73 |
| 155 | 3300005544 | Ga0070686_100069268 | Ga0070686_1000692685 | 73 |
| 156 | 3300005547 | Ga0070693_100004354 | Ga0070693_1000043548 | 73 |
| 157 | 3300005547 | Ga0070693_100745762 | Ga0070693_1007457621 | 73 |
| 158 | 3300005547 | Ga0070693_101632965 | Ga0070693_1016329652 | 73 |
| 159 | 3300005549 | Ga0070704_100003595 | Ga0070704_1000035958 | 73 |
| 160 | 3300005564 | Ga0070664_100009206 | Ga0070664_1000092066 | 73 |
| 161 | 3300005564 | Ga0070664_102079426 | Ga0070664_1020794261 | 73 |
| 162 | 3300005577 | Ga0068857_100130838 | Ga0068857_1001308382 | 73 |
| 163 | 3300005577 | Ga0068857_100411943 | Ga0068857_1004119432 | 73 |
| 164 | 3300005577 | Ga0068857_100427517 | Ga0068857_1004275173 | 73 |
| 165 | 3300005578 | Ga0068854_100038961 | Ga0068854_1000389614 | 73 |
| 166 | 3300005578 | Ga0068854_100504148 | Ga0068854_1005041482 | 73 |
| 167 | 3300005578 | Ga0068854_101803971 | Ga0068854_1018039712 | 73 |
| 168 | 3300005614 | Ga0068856_100006197 | Ga0068856_1000061972 | 73 |
| 169 | 3300005614 | Ga0068856_100626505 | Ga0068856_1006265052 | 73 |
| 170 | 3300005614 | Ga0068856_101901928 | Ga0068856_1019019282 | 73 |
| 171 | 3300005615 | Ga0070702_100071723 | Ga0070702_1000717232 | 73 |
| 172 | 3300005618 | Ga0068864_100021045 | Ga0068864_1000210454 | 73 |
| 173 | 3300005618 | Ga0068864_101260044 | Ga0068864_1012600442 | 73 |
| 174 | 3300005840 | Ga0068870_10701847 | Ga0068870_107018472 | 73 |
| 175 | 3300005844 | Ga0068862_100267591 | Ga0068862_1002675912 | 73 |
| 176 | 3300005844 | Ga0068862_101113829 | Ga0068862_1011138292 | 73 |
| 177 | 3300005937 | Ga0081455_10038797 | Ga0081455_100387976 | 73 |
| 178 | 3300005937 | Ga0081455_10220790 | Ga0081455_102207902 | 73 |
| 179 | 3300005937 | Ga0081455_10516257 | Ga0081455_105162572 | 73 |
| 180 | 3300005937 | Ga0081455_10571147 | Ga0081455_105711472 | 73 |
| 181 | 3300005981 | Ga0081538_10106037 | Ga0081538_101060372 | 73 |
| 182 | 3300005981 | Ga0081538_10251586 | Ga0081538_102515862 | 73 |
| 183 | 3300005985 | Ga0081539_10006841 | Ga0081539_100068418 | 73 |
| 184 | 3300006038 | Ga0075365_10196528 | Ga0075365_101965282 | 73 |
| 185 | 3300006042 | Ga0075368_10036139 | Ga0075368_100361394 | 73 |
| 186 | 3300006051 | Ga0075364_10045982 | Ga0075364_100459824 | 73 |
| 187 | 3300006173 | Ga0070716_101035641 | Ga0070716_1010356412 | 73 |
| 188 | 3300006175 | Ga0070712_100093938 | Ga0070712_1000939382 | 73 |
| 189 | 3300006178 | Ga0075367_10076818 | Ga0075367_100768182 | 73 |
| 190 | 3300006195 | Ga0075366_10507487 | Ga0075366_105074872 | 73 |
| 191 | 3300006237 | Ga0097621_100972260 | Ga0097621_1009722602 | 73 |
| 192 | 3300006358 | Ga0068871_101258432 | Ga0068871_1012584322 | 73 |
| 193 | 3300006846 | Ga0075430_100609397 | Ga0075430_1006093972 | 73 |
| 194 | 3300006847 | Ga0075431_101786465 | Ga0075431_1017864652 | 73 |
| 195 | 3300006871 | Ga0075434_100683946 | Ga0075434_1006839462 | 73 |
| 196 | 3300006871 | Ga0075434_101089835 | Ga0075434_1010898352 | 73 |
| 197 | 3300006881 | Ga0068865_100523140 | Ga0068865_1005231402 | 73 |
| 198 | 3300007076 | Ga0075435_100446016 | Ga0075435_1004460162 | 73 |
| 199 | 3300009094 | Ga0111539_10016075 | Ga0111539_100160754 | 73 |
| 200 | 3300009094 | Ga0111539_10025887 | Ga0111539_100258874 | 73 |
| 201 | 3300009094 | Ga0111539_10134678 | Ga0111539_101346782 | 73 |
| 202 | 3300009094 | Ga0111539_10255682 | Ga0111539_102556824 | 73 |
| 203 | 3300009094 | Ga0111539_10426896 | Ga0111539_104268962 | 73 |
| 204 | 3300009098 | Ga0105245_10354726 | Ga0105245_103547263 | 73 |
| 205 | 3300009098 | Ga0105245_11494302 | Ga0105245_114943021 | 73 |
| 206 | 3300009098 | Ga0105245_11522405 | Ga0105245_115224052 | 73 |
| 207 | 3300009147 | Ga0114129_10058683 | Ga0114129_100586835 | 73 |
| 208 | 3300009147 | Ga0114129_10527943 | Ga0114129_105279434 | 73 |
| 209 | 3300009174 | Ga0105241_11421367 | Ga0105241_114213671 | 73 |
| 210 | 3300009551 | Ga0105238_10908564 | Ga0105238_109085642 | 73 |
| 211 | 3300009553 | Ga0105249_10870683 | Ga0105249_108706832 | 73 |
| 212 | 3300009553 | Ga0105249_11200764 | Ga0105249_112007642 | 73 |
| 213 | 3300010375 | Ga0105239_11305881 | Ga0105239_113058812 | 73 |
| 214 | 3300010375 | Ga0105239_11701974 | Ga0105239_117019742 | 73 |
| 215 | 3300010375 | Ga0105239_13547591 | Ga0105239_135475911 | 73 |
| 216 | 3300011119 | Ga0105246_10116941 | Ga0105246_101169412 | 73 |
| 217 | 3300011119 | Ga0105246_10903242 | Ga0105246_109032421 | 73 |
| 218 | 3300013102 | Ga0157371_10456816 | Ga0157371_104568163 | 73 |
| 219 | 3300013102 | Ga0157371_11438615 | Ga0157371_114386152 | 73 |
| 220 | 3300013104 | Ga0157370_10483172 | Ga0157370_104831722 | 73 |
| 221 | 3300013105 | Ga0157369_10265092 | Ga0157369_102650922 | 73 |
| 222 | 3300013296 | Ga0157374_10171282 | Ga0157374_101712824 | 73 |
| 223 | 3300013307 | Ga0157372_10452402 | Ga0157372_104524022 | 73 |
| 224 | 3300013307 | Ga0157372_10825137 | Ga0157372_108251372 | 73 |
| 225 | 3300013308 | Ga0157375_12322231 | Ga0157375_123222312 | 73 |
| 226 | 3300014325 | Ga0163163_10774211 | Ga0163163_107742111 | 73 |
| 227 | 3300014497 | Ga0182008_10497309 | Ga0182008_104973091 | 73 |
| 228 | 3300014497 | Ga0182008_10525424 | Ga0182008_105254242 | 73 |
| 229 | 3300014745 | Ga0157377_10023752 | Ga0157377_100237525 | 73 |
| 230 | 3300015265 | Ga0182005_1116514 | Ga0182005_11165142 | 73 |
| 231 | 3300020082 | Ga0206353_10804249 | Ga0206353_108042492 | 73 |
| 232 | 3300021384 | Ga0213876_10643718 | Ga0213876_106437181 | 73 |
| 233 | 3300025903 | Ga0207680_10975550 | Ga0207680_109755502 | 73 |
| 234 | 3300025908 | Ga0207643_10255085 | Ga0207643_102550852 | 73 |
| 235 | 3300025909 | Ga0207705_10500975 | Ga0207705_105009752 | 73 |
| 236 | 3300025912 | Ga0207707_10028093 | Ga0207707_100280936 | 73 |
| 237 | 3300025912 | Ga0207707_10220521 | Ga0207707_102205212 | 73 |
| 238 | 3300025912 | Ga0207707_10483527 | Ga0207707_104835273 | 73 |
| 239 | 3300025915 | Ga0207693_10025613 | Ga0207693_100256136 | 73 |
| 240 | 3300025915 | Ga0207693_10961509 | Ga0207693_109615091 | 73 |
| 241 | 3300025916 | Ga0207663_10318123 | Ga0207663_103181232 | 73 |
| 242 | 3300025917 | Ga0207660_10711163 | Ga0207660_107111632 | 73 |
| 243 | 3300025917 | Ga0207660_10742751 | Ga0207660_107427512 | 73 |
| 244 | 3300025918 | Ga0207662_10450456 | Ga0207662_104504561 | 73 |
| 245 | 3300025918 | Ga0207662_10742446 | Ga0207662_107424461 | 73 |
| 246 | 3300025919 | Ga0207657_10116388 | Ga0207657_101163884 | 73 |
| 247 | 3300025920 | Ga0207649_10003056 | Ga0207649_100030564 | 73 |
| 248 | 3300025920 | Ga0207649_11565872 | Ga0207649_115658722 | 73 |
| 249 | 3300025921 | Ga0207652_10689068 | Ga0207652_106890682 | 73 |
| 250 | 3300025921 | Ga0207652_11326595 | Ga0207652_113265952 | 73 |
| 251 | 3300025924 | Ga0207694_10469545 | Ga0207694_104695452 | 73 |
| 252 | 3300025925 | Ga0207650_10347958 | Ga0207650_103479583 | 73 |
| 253 | 3300025926 | Ga0207659_10309563 | Ga0207659_103095633 | 73 |
| 254 | 3300025926 | Ga0207659_11426133 | Ga0207659_114261332 | 73 |
| 255 | 3300025927 | Ga0207687_10737704 | Ga0207687_107377042 | 73 |
| 256 | 3300025931 | Ga0207644_11545651 | Ga0207644_115456512 | 73 |
| 257 | 3300025935 | Ga0207709_11472889 | Ga0207709_114728892 | 73 |
| 258 | 3300025937 | Ga0207669_10346682 | Ga0207669_103466822 | 73 |
| 259 | 3300025937 | Ga0207669_10384455 | Ga0207669_103844552 | 73 |
| 260 | 3300025942 | Ga0207689_10479412 | Ga0207689_104794121 | 73 |
| 261 | 3300025944 | Ga0207661_10000864 | Ga0207661_1000086421 | 73 |
| 262 | 3300025944 | Ga0207661_10017485 | Ga0207661_100174852 | 73 |
| 263 | 3300025944 | Ga0207661_10616752 | Ga0207661_106167522 | 73 |
| 264 | 3300025944 | Ga0207661_11780473 | Ga0207661_117804731 | 73 |
| 265 | 3300025945 | Ga0207679_10180486 | Ga0207679_101804863 | 73 |
| 266 | 3300025945 | Ga0207679_10185752 | Ga0207679_101857522 | 73 |
| 267 | 3300025960 | Ga0207651_11867628 | Ga0207651_118676282 | 73 |
| 268 | 3300025961 | Ga0207712_10612018 | Ga0207712_106120182 | 73 |
| 269 | 3300025981 | Ga0207640_10105937 | Ga0207640_101059374 | 73 |
| 270 | 3300025981 | Ga0207640_11051453 | Ga0207640_110514532 | 73 |
| 271 | 3300025981 | Ga0207640_11263483 | Ga0207640_112634832 | 73 |
| 272 | 3300026023 | Ga0207677_10043872 | Ga0207677_100438725 | 73 |
| 273 | 3300026023 | Ga0207677_10525883 | Ga0207677_105258832 | 73 |
| 274 | 3300026023 | Ga0207677_11457454 | Ga0207677_114574541 | 73 |
| 275 | 3300026041 | Ga0207639_11765497 | Ga0207639_117654972 | 73 |
| 276 | 3300026075 | Ga0207708_10120974 | Ga0207708_101209743 | 73 |
| 277 | 3300026078 | Ga0207702_10009154 | Ga0207702_100091549 | 73 |
| 278 | 3300026078 | Ga0207702_10605148 | Ga0207702_106051482 | 73 |
| 279 | 3300026089 | Ga0207648_11732420 | Ga0207648_117324202 | 73 |
| 280 | 3300026095 | Ga0207676_11196311 | Ga0207676_111963112 | 73 |
| 281 | 3300026116 | Ga0207674_10036831 | Ga0207674_100368313 | 73 |
| 282 | 3300026116 | Ga0207674_10349326 | Ga0207674_103493263 | 73 |
| 283 | 3300026116 | Ga0207674_10368894 | Ga0207674_103688942 | 73 |
| 284 | 3300026121 | Ga0207683_10089890 | Ga0207683_100898905 | 73 |
| 285 | 3300026121 | Ga0207683_11134828 | Ga0207683_111348282 | 73 |
| 286 | 3300027907 | Ga0207428_10061175 | Ga0207428_100611754 | 73 |
| 287 | 3300027907 | Ga0207428_10188472 | Ga0207428_101884723 | 73 |
| 288 | 3300027907 | Ga0207428_10476951 | Ga0207428_104769512 | 73 |
| 289 | 3300028379 | Ga0268266_11291452 | Ga0268266_112914522 | 73 |
| 290 | 3300028380 | Ga0268265_10412382 | Ga0268265_104123822 | 73 |
| 291 | 3300028380 | Ga0268265_11486330 | Ga0268265_114863302 | 73 |
| 292 | 3300031548 | Ga0307408_100552566 | Ga0307408_1005525662 | 73 |
| 293 | 3300031731 | Ga0307405_11428502 | Ga0307405_114285022 | 73 |
| 294 | 3300031911 | Ga0307412_10701319 | Ga0307412_107013192 | 73 |
| 295 | 3300031995 | Ga0307409_100104867 | Ga0307409_1001048674 | 73 |
| 296 | 3300031995 | Ga0307409_101904251 | Ga0307409_1019042512 | 73 |
| 297 | 3300031995 | Ga0307409_102961910 | Ga0307409_1029619102 | 73 |
| 298 | 3300032002 | Ga0307416_100675742 | Ga0307416_1006757421 | 73 |
| 299 | 3300032002 | Ga0307416_100981508 | Ga0307416_1009815082 | 73 |
| 300 | 3300032126 | Ga0307415_100008142 | Ga0307415_1000081428 | 73 |
| 301 | 3300035242 | Ga0373962_0171637 | Ga0373962_0171637_428_661 | 73 |
| 302 | 3300035725 | Ga0373947_0730329 | Ga0373947_0730329_52_288 | 73 |
| 303 | 3300036401 | Ga0373937_1061328 | Ga0373937_1061328_303_545 | 73 |
| 304 | 3300037312 | Ga0395899_0006592 | Ga0395899_0006592_1013_1243 | 73 |
| 305 | 3300037312 | Ga0395899_0066507 | Ga0395899_0066507_1580_1816 | 73 |
| 306 | 3300037418 | Ga0395900_0001810 | Ga0395900_0001810_8849_9079 | 73 |
| 307 | 3300037418 | Ga0395900_0243090 | Ga0395900_0243090_919_1155 | 73 |
| 308 | 3300037418 | Ga0395900_1132637 | Ga0395900_1132637_265_501 | 73 |
| 309 | 3300037466 | Ga0395898_0018860 | Ga0395898_0018860_6020_6253 | 73 |
| 310 | 3300037466 | Ga0395898_0069596 | Ga0395898_0069596_1342_1572 | 73 |
| 311 | 3300037466 | Ga0395898_1044350 | Ga0395898_1044350_360_596 | 73 |
| 312 | 3300037471 | Ga0395905_0013593 | Ga0395905_0013593_4594_4824 | 73 |
| 313 | 3300037471 | Ga0395905_0392845 | Ga0395905_0392845_689_913 | 73 |
| 314 | 3300037471 | Ga0395905_0532183 | Ga0395905_0532183_131_367 | 73 |
| 315 | 3300037471 | Ga0395905_0608441 | Ga0395905_0608441_216_452 | 73 |
| 316 | 3300038443 | Ga0395901_0010238 | Ga0395901_0010238_2976_3206 | 73 |
| 317 | 3300038443 | Ga0395901_0090580 | Ga0395901_0090580_1621_1854 | 73 |
| 318 | 3300038443 | Ga0395901_1144022 | Ga0395901_1144022_379_612 | 73 |
| 319 | 3300038443 | Ga0395901_1281793 | Ga0395901_1281793_308_547 | 73 |
| 320 | 3300039437 | Ga0436365_0355175 | Ga0436365_0355175_189_419 | 73 |
| 321 | 3300041406 | Ga0439439_0004574 | Ga0439439_0004574_1054_1287 | 73 |
| 322 | 3300041443 | Ga0451789_1085657 | Ga0451789_1085657_317_556 | 73 |
| 323 | 3300041452 | Ga0451793_0308359 | Ga0451793_0308359_300_539 | 73 |
| 324 | 3300041460 | Ga0451802_0085701 | Ga0451802_0085701_345_584 | 73 |
| 325 | 3300041463 | Ga0451804_0096207 | Ga0451804_0096207_602_841 | 73 |
| 326 | 3300041496 | Ga0451839_0903188 | Ga0451839_0903188_100_327 | 73 |
| 327 | 3300041505 | Ga0451849_1168296 | Ga0451849_1168296_1414_1653 | 73 |
| 328 | 3300041507 | Ga0451851_1023841 | Ga0451851_1023841_259_498 | 73 |
| 329 | 3300041512 | Ga0451853_2486766 | Ga0451853_2486766_1233_1472 | 73 |
| 330 | 3300041997 | Ga0439431_0050501 | Ga0439431_0050501_377_610 | 73 |
| 331 | 3300041999 | Ga0439433_0042761 | Ga0439433_0042761_276_509 | 73 |
| 332 | 3300042005 | Ga0439448_0028929 | Ga0439448_0028929_538_768 | 73 |
| 333 | 3300042005 | Ga0439448_0168451 | Ga0439448_0168451_454_687 | 73 |
| 334 | 3300042008 | Ga0439450_097981 | Ga0439450_097981_468_698 | 73 |
| 335 | 3300042009 | Ga0439451_082571 | Ga0439451_082571_346_582 | 73 |
| 336 | 3300042013 | Ga0439456_068464 | Ga0439456_068464_150_386 | 73 |
| 337 | 3300042015 | Ga0439462_0000555 | Ga0439462_0000555_4271_4504 | 73 |
| 338 | 3300042016 | Ga0439463_064218 | Ga0439463_064218_502_735 | 73 |
| 339 | 3300042124 | Ga0450922_035967 | Ga0450922_035967_43_273 | 73 |
| 340 | 3300042134 | Ga0450898_120784 | Ga0450898_120784_184_414 | 73 |
| 341 | 3300042137 | Ga0450902_007814 | Ga0450902_007814_53_283 | 73 |
| 342 | 3300042145 | Ga0450906_004386 | Ga0450906_004386_398_628 | 73 |
| 343 | 3300042156 | Ga0439446_0002209 | Ga0439446_0002209_4352_4585 | 73 |
| 344 | 3300042438 | Ga0439459_0027868 | Ga0439459_0027868_777_1007 | 73 |
| 345 | 3300042993 | Ga0439440_0095730 | Ga0439440_0095730_329_559 | 73 |
| 346 | 3300044694 | Ga0466963_0019815 | Ga0466963_0019815_261_485 | 73 |
| 347 | 3300044694 | Ga0466963_0027175 | Ga0466963_0027175_1857_2081 | 73 |
| 348 | 3300044694 | Ga0466963_1000061 | Ga0466963_1000061_279_509 | 73 |
| 349 | 3300044719 | Ga0466971_0267239 | Ga0466971_0267239_428_658 | 73 |
| 350 | 3300044842 | Ga0466957_0398967 | Ga0466957_0398967_78_302 | 73 |
| 351 | 3300045976 | Ga0466967_0016414 | Ga0466967_0016414_812_1036 | 73 |
| 352 | 3300045976 | Ga0466967_0058248 | Ga0466967_0058248_2750_2974 | 73 |
| 353 | 3300045976 | Ga0466967_0465253 | Ga0466967_0465253_849_1073 | 73 |
| 354 | 3300046529 | Ga0495652_1038751 | Ga0495652_1038751_134_385 | 73 |
| 355 | 3300046559 | Ga0495667_0237748 | Ga0495667_0237748_560_814 | 73 |
| 356 | 3300046809 | Ga0495600_0567180 | Ga0495600_0567180_206_460 | 73 |
| 357 | 3300047317 | Ga0495604_0810485 | Ga0495604_0810485_300_554 | 73 |
| 358 | 3300047322 | Ga0495680_0395327 | Ga0495680_0395327_171_425 | 73 |
| 359 | 3300047471 | Ga0495684_0628110 | Ga0495684_0628110_335_589 | 73 |
| 360 | 3300047673 | Ga0495593_0376299 | Ga0495593_0376299_280_516 | 73 |
| 361 | 3300048903 | Ga0496100_0409799 | Ga0496100_0409799_547_786 | 73 |
| 362 | 3300048903 | Ga0496100_0488779 | Ga0496100_0488779_109_342 | 73 |
| 363 | 3300048903 | Ga0496100_0909778 | Ga0496100_0909778_176_403 | 73 |
| 364 | 3300048904 | Ga0496101_0250822 | Ga0496101_0250822_752_985 | 73 |
| 365 | 3300048904 | Ga0496101_0882498 | Ga0496101_0882498_444_683 | 73 |
| 366 | 3300048905 | Ga0496102_0755131 | Ga0496102_0755131_378_617 | 73 |
| 367 | 3300048905 | Ga0496102_0920772 | Ga0496102_0920772_115_351 | 73 |
| 368 | 3300048905 | Ga0496102_0930997 | Ga0496102_0930997_476_700 | 73 |
| 369 | 3300048906 | Ga0496103_0211746 | Ga0496103_0211746_625_864 | 73 |
| 370 | 3300048907 | Ga0496104_0386068 | Ga0496104_0386068_686_922 | 73 |
| 371 | 3300048908 | Ga0496105_0791462 | Ga0496105_0791462_290_526 | 73 |
| 372 | 3300048911 | Ga0496108_0264804 | Ga0496108_0264804_346_576 | 73 |
| 373 | 3300048912 | Ga0496109_1856818 | Ga0496109_1856818_196_426 | 73 |
| 374 | 3300048912 | Ga0496109_1893354 | Ga0496109_1893354_91_327 | 73 |
| 375 | 3300048913 | Ga0496110_0297706 | Ga0496110_0297706_664_894 | 73 |
| 376 | 3300048913 | Ga0496110_1149491 | Ga0496110_1149491_273_497 | 73 |
| 377 | 3300048915 | Ga0496112_0076295 | Ga0496112_0076295_2631_2867 | 73 |
| 378 | 3300048917 | Ga0496114_1172755 | Ga0496114_1172755_338_565 | 73 |
| 379 | 3300049568 | Ga0501031_0010913 | Ga0501031_0010913_1613_1846 | 73 |
| 380 | 3300049568 | Ga0501031_0038088 | Ga0501031_0038088_2124_2357 | 73 |
| 381 | 3300049568 | Ga0501031_0811598 | Ga0501031_0811598_101_337 | 73 |
| 382 | 3300049569 | Ga0501032_1061320 | Ga0501032_1061320_119_352 | 73 |
| 383 | 3300049570 | Ga0501033_0160590 | Ga0501033_0160590_1324_1557 | 73 |
| 384 | 3300049572 | Ga0501036_0047341 | Ga0501036_0047341_130_363 | 73 |
| 385 | 3300049572 | Ga0501036_0108780 | Ga0501036_0108780_1350_1583 | 73 |
| 386 | 3300049572 | Ga0501036_1083028 | Ga0501036_1083028_29_259 | 73 |
| 387 | 3300049573 | Ga0501037_0098688 | Ga0501037_0098688_1503_1736 | 73 |
| 388 | 3300049574 | Ga0501038_0303573 | Ga0501038_0303573_24_257 | 73 |
| 389 | 3300049574 | Ga0501038_0379203 | Ga0501038_0379203_845_1078 | 73 |
| 390 | 3300049575 | Ga0501039_0011222 | Ga0501039_0011222_2906_3139 | 73 |
| 391 | 3300049575 | Ga0501039_0102954 | Ga0501039_0102954_819_1052 | 73 |
| 392 | 3300049576 | Ga0501040_0000959 | Ga0501040_0000959_4986_5219 | 73 |
| 393 | 3300049576 | Ga0501040_0051137 | Ga0501040_0051137_642_875 | 73 |
| 394 | 3300049577 | Ga0501041_0021465 | Ga0501041_0021465_2612_2845 | 73 |
| 395 | 3300049578 | Ga0501042_0010114 | Ga0501042_0010114_1002_1235 | 73 |
| 396 | 3300049578 | Ga0501042_0011961 | Ga0501042_0011961_1660_1893 | 73 |
| 397 | 3300049579 | Ga0501043_0170638 | Ga0501043_0170638_743_976 | 73 |
| 398 | 3300049580 | Ga0501046_0045585 | Ga0501046_0045585_2065_2298 | 73 |
| 399 | 3300049582 | Ga0501048_0014367 | Ga0501048_0014367_1744_1977 | 73 |
| 400 | 3300049582 | Ga0501048_0016605 | Ga0501048_0016605_1932_2165 | 73 |
| 401 | 3300049582 | Ga0501048_0954305 | Ga0501048_0954305_96_335 | 73 |
| 402 | 3300049583 | Ga0501067_0060413 | Ga0501067_0060413_1043_1273 | 73 |
| 403 | 3300049584 | Ga0501068_0006738 | Ga0501068_0006738_4664_4894 | 73 |
| 404 | 3300049584 | Ga0501068_0063187 | Ga0501068_0063187_189_422 | 73 |
| 405 | 3300049585 | Ga0501069_0300699 | Ga0501069_0300699_232_465 | 73 |
| 406 | 3300049587 | Ga0501071_0021135 | Ga0501071_0021135_1013_1246 | 73 |
| 407 | 3300049587 | Ga0501071_0021276 | Ga0501071_0021276_2001_2234 | 73 |
| 408 | 3300049587 | Ga0501071_1383884 | Ga0501071_1383884_155_394 | 73 |
| 409 | 3300049588 | Ga0501072_0003784 | Ga0501072_0003784_7506_7739 | 73 |
| 410 | 3300049588 | Ga0501072_0009880 | Ga0501072_0009880_3180_3413 | 73 |
| 411 | 3300049589 | Ga0501073_0319930 | Ga0501073_0319930_317_550 | 73 |
| 412 | 3300049589 | Ga0501073_0489873 | Ga0501073_0489873_408_641 | 73 |
| 413 | 3300049590 | Ga0501074_0015108 | Ga0501074_0015108_1983_2216 | 73 |
| 414 | 3300049590 | Ga0501074_0018328 | Ga0501074_0018328_3710_3943 | 73 |
| 415 | 3300049591 | Ga0501075_0024962 | Ga0501075_0024962_1235_1468 | 73 |
| 416 | 3300049591 | Ga0501075_0038975 | Ga0501075_0038975_1575_1808 | 73 |
| 417 | 3300049591 | Ga0501075_1438077 | Ga0501075_1438077_255_491 | 73 |
| 418 | 3300049592 | Ga0501076_0003617 | Ga0501076_0003617_6776_7009 | 73 |
| 419 | 3300049592 | Ga0501076_0015559 | Ga0501076_0015559_2689_2922 | 73 |
| 420 | 3300049592 | Ga0501076_1090823 | Ga0501076_1090823_340_576 | 73 |
| 421 | 3300049592 | Ga0501076_1150136 | Ga0501076_1150136_224_451 | 73 |
| 422 | 3300049593 | Ga0501077_0013154 | Ga0501077_0013154_3007_3240 | 73 |
| 423 | 3300049593 | Ga0501077_0015744 | Ga0501077_0015744_1787_2020 | 73 |
| 424 | 3300049741 | Ga0501079_0006065 | Ga0501079_0006065_1808_2041 | 73 |
| 425 | 3300049741 | Ga0501079_0094918 | Ga0501079_0094918_790_1023 | 73 |
| 426 | 3300049741 | Ga0501079_0715156 | Ga0501079_0715156_225_458 | 73 |
| 427 | 3300049742 | Ga0501080_0081274 | Ga0501080_0081274_1596_1829 | 73 |
| 428 | 3300049742 | Ga0501080_0332643 | Ga0501080_0332643_479_712 | 73 |
| 429 | 3300049743 | Ga0501081_0015524 | Ga0501081_0015524_1721_1954 | 73 |
| 430 | 3300049743 | Ga0501081_0021810 | Ga0501081_0021810_561_794 | 73 |
| 431 | 3300049770 | Ga0501273_097382 | Ga0501273_097382_234_470 | 73 |
| 432 | 3300049822 | Ga0501035_0048076 | Ga0501035_0048076_2676_2909 | 73 |
| 433 | 3300049822 | Ga0501035_0057276 | Ga0501035_0057276_1184_1417 | 73 |
| 434 | 3300049823 | Ga0501044_0475688 | Ga0501044_0475688_181_414 | 73 |
| 435 | 3300049824 | Ga0501045_0005803 | Ga0501045_0005803_4556_4789 | 73 |
| 436 | 3300049824 | Ga0501045_0024513 | Ga0501045_0024513_949_1182 | 73 |
| 437 | 3300050490 | nmdc:mga03n38_422983_c1 | nmdc:mga03n38_422983_c1_308_538 | 73 |
| 438 | 3300050491 | nmdc:mga00v17_11892_c1 | nmdc:mga00v17_11892_c1_3021_3251 | 73 |
| 439 | 3300050492 | nmdc:mga0yw44_295304_c1 | nmdc:mga0yw44_295304_c1_319_549 | 73 |
| 440 | 3300050492 | nmdc:mga0yw44_5302_c1 | nmdc:mga0yw44_5302_c1_5483_5713 | 73 |
| 441 | 3300050494 | nmdc:mga06z11_54166_c1 | nmdc:mga06z11_54166_c1_417_647 | 73 |
| 442 | 3300050507 | nmdc:mga05p37_106964_c1 | nmdc:mga05p37_106964_c1_227_463 | 73 |
| 443 | 3300050507 | nmdc:mga05p37_1970528_c1 | nmdc:mga05p37_1970528_c1_224_454 | 73 |
| 444 | 3300050509 | nmdc:mga0qj67_410542_c1 | nmdc:mga0qj67_410542_c1_394_621 | 73 |
| 445 | 3300050510 | nmdc:mga06r32_1289846_c1 | nmdc:mga06r32_1289846_c1_165_401 | 73 |
| 446 | 3300050511 | nmdc:mga08y16_1683057_c1 | nmdc:mga08y16_1683057_c1_217_447 | 73 |
| 447 | 3300050511 | nmdc:mga08y16_193507_c1 | nmdc:mga08y16_193507_c1_454_693 | 73 |
| 448 | 3300050511 | nmdc:mga08y16_33642_c1 | nmdc:mga08y16_33642_c1_3636_3872 | 73 |
| 449 | 3300050511 | nmdc:mga08y16_399047_c1 | nmdc:mga08y16_399047_c1_468_695 | 73 |
| 450 | 3300050512 | nmdc:mga0n895_866175_c1 | nmdc:mga0n895_866175_c1_181_417 | 73 |
| 451 | 3300050513 | nmdc:mga0rr50_871929_c1 | nmdc:mga0rr50_871929_c1_182_418 | 73 |
| 452 | 3300053085 | Ga0495619_0666409 | Ga0495619_0666409_261_515 | 73 |
| 453 | 3300054114 | Ga0501084_0008866 | Ga0501084_0008866_3698_3931 | 73 |
| 454 | 3300054114 | Ga0501084_1092270 | Ga0501084_1092270_303_542 | 73 |
| 455 | 3300059421 | Ga0590071_056467 | Ga0590071_056467_521_754 | 73 |
| 456 | 3300059424 | Ga0590075_025527 | Ga0590075_025527_53_286 | 73 |
| 457 | 3300060353 | Ga0501082_0007521 | Ga0501082_0007521_7125_7358 | 73 |
| 458 | 3300061719 | Ga0466962_0168806 | Ga0466962_0168806_150_380 | 73 |
| 459 | 3300061734 | Ga0530510_0008919 | Ga0530510_0008919_3027_3260 | 73 |
| 460 | 3300061734 | Ga0530510_0014386 | Ga0530510_0014386_3392_3625 | 73 |
| 461 | 3300061734 | Ga0530510_0098694 | Ga0530510_0098694_435_659 | 73 |
| 462 | 3300003320 | rootH2_10204812 | rootH2_102048122 | 74 |
| 463 | 3300005546 | Ga0070696_100879762 | Ga0070696_1008797621 | 74 |
| 464 | 3300025920 | Ga0207649_10575921 | Ga0207649_105759211 | 74 |
| 465 | 3300049583 | Ga0501067_0024545 | Ga0501067_0024545_1710_1934 | 74 |
| 466 | 3300049585 | Ga0501069_0037789 | Ga0501069_0037789_777_1001 | 74 |
| 467 | 3300049586 | Ga0501070_0560655 | Ga0501070_0560655_280_528 | 74 |
| 468 | 3300049591 | Ga0501075_0735535 | Ga0501075_0735535_335_652 | 74 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.5685 | 28 | 74 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.5406 | 30 | 72 |
| 2ouw-assembly1.cif.gz_B | crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution | 0.5076 | 3 | 73 |
| 2ouw-assembly1.cif.gz_B | crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution | 0.4758 | 3 | 73 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.443 | 30 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5AAR0_149_292_1.20.930.10 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 | 0.5425 | 23 | 54 | 1.20.930.10 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.5406 | 30 | 72 | 1.10.10.1320 |
| af_A8JV07_554_695_1.20.930.10 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 | 0.5348 | 25 | 55 | 1.20.930.10 |
| af_D3ZAI0_403_485_1.10.10.790 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module | 0.5017 | 1 | 74 | 1.10.10.790 |
| af_D3ZAI0_403_485_1.10.10.790 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module | 0.4958 | 1 | 74 | 1.10.10.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1YN45-F1-model_v4 | Zinc-finger domain-containing protein | 0.9613 | 25 | 71 |
|
| AF-A0A847FN81-F1-model_v4 | Zinc-finger domain-containing protein | 0.9393 | 18 | 73 |
|
| AF-A0A1F8U7R0-F1-model_v4 | Zinc-finger domain-containing protein | 0.9391 | 19 | 74 |
|
| AF-A0A6P2C7M5-F1-model_v4 | Zf-HC2 domain-containing protein | 0.9334 | 19 | 72 |
|
| AF-A0A661W3Z6-F1-model_v4 | Zinc-finger domain-containing protein | 0.9319 | 17 | 69 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar