F450119

General Info

Members Datasets Scaffolds Average Seq Length
468 266 936 374

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000012|Ga0496126_0000012_475812_476891
Length 359
Sequence MLNRRDFVRLAAAASAATSLPANMLPQAPKKIRYAAVGLGRISCQHFMPGTKMSQFGQITGLVSGHPDKAAKFAAEYGIPQKNIYTYETYDQMKDNPDIDAVYIGLPNNMHAEYTIRAAKAGKHVLCEKPMANTVEDCKAMIEACRTANRKLMIAYRCQLEPTFLQARKMIQDGVIGKVQAIESANGFNIAPNEWRSDVKYAGGGPLMDVGIYSLNACRFLLREEPQEFSAHSYTDPTDPRFKGVEETIGWVMKFPSGVIAICNTTYGAGMESFIRLHGSKGTLEIFGFGYDGIHMTVKTRPAMEQPQPETSKDPHQFLVESDYFSRCIMDNTQPSLSGEEGLRDMEAITRIYAAAKKA

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
216 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
220 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
221 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
238 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
239 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
248 2738541278 Niastella sp. CF465 Isolate Unclassified
249 2738541284 Pedobacter sp. YR016 Isolate Unclassified
250 2738541302 Pedobacter sp. CF074 Isolate Unclassified
251 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
252 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
253 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
254 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
255 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
256 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
257 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
258 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
259 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
260 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
261 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
262 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
263 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
264 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
265 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
266 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 0.85
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0000012 3300048929 Bacteria 727789
2 SwRhRL2b_contig_3916980 2162886007 Bacteria 13112
3 JGI24740J21852_10000101 3300001979 Bacteria 30339
4 JGI24739J22299_10002093 3300001989 Bacteria 7643
5 JGI24737J22298_10000214 3300001990 Bacteria 18974
6 JGI24735J21928_10000044 3300002067 Bacteria 57824
7 JGI25162J39368_1000011 3300002737 Bacteria 379156
8 JGI25154J39366_1000023 3300002738 Bacteria 219569
9 rootH1_10017922 3300003316 Bacteria 31673
10 rootH2_10021864 3300003320 Bacteria 30597
11 rootH2_10041902 3300003320 Bacteria 11603
12 rootL2_10012522 3300003322 Bacteria 7464
13 rootL2_10033905 3300003322 Bacteria 4459
14 rootL2_10070742 3300003322 Bacteria 4568
15 rootL2_10074487 3300003322 Bacteria 19171
16 rootL2_10086738 3300003322 Bacteria 4997
17 rootH1_10004627 3300003323 Bacteria 103288
18 rootH1_10045448 3300003323 Bacteria 26461
19 rootH1_10047270 3300003323 Bacteria 8723
20 rootH1_10049363 3300003323 Bacteria 2348
21 JGI25160J50197_1002551 3300003354 Bacteria 8427
22 JGI25160J50197_1005442 3300003354 Bacteria 5297
23 Ga0055535_1007251 3300003761 Bacteria 2139
24 Ga0055526_1007835 3300003771 Bacteria 5462
25 Ga0055528_1005165 3300003790 Bacteria 6136
26 Ga0055530_10000570 3300003791 Bacteria 31968
27 Ga0055531_10000139 3300003794 Bacteria 82993
28 Ga0065165_1000012 3300005262 Bacteria 303241
29 Ga0065165_1008076 3300005262 Bacteria 5021
30 Ga0065704_10000436 3300005289 Bacteria 20960
31 Ga0065712_10009853 3300005290 Bacteria 3093
32 Ga0070683_100002599 3300005329 Bacteria 14433
33 Ga0070683_100026440 3300005329 Bacteria 5226
34 Ga0070690_100122386 3300005330 Bacteria 1748
35 Ga0070670_100003947 3300005331 Bacteria 12378
36 Ga0070670_100097618 3300005331 Bacteria 2527
37 Ga0070670_100271844 3300005331 Bacteria 1479
38 Ga0070677_10009815 3300005333 Bacteria 3256
39 Ga0068869_100014259 3300005334 Bacteria 5306
40 Ga0070666_10003274 3300005335 Bacteria 9833
41 Ga0070666_10043032 3300005335 Bacteria 3023
42 Ga0070680_100011225 3300005336 Bacteria 6929
43 Ga0070680_100096250 3300005336 Bacteria 2454
44 Ga0068868_100009679 3300005338 Bacteria 6954
45 Ga0068868_100070454 3300005338 Bacteria 2788
46 Ga0068868_100178660 3300005338 Bacteria 1760
47 Ga0070660_100000286 3300005339 Bacteria 33602
48 Ga0070691_10016752 3300005341 Unclassified 3370
49 Ga0070668_100006264 3300005347 Bacteria 8812
50 Ga0070668_100168820 3300005347 Bacteria 1780
51 Ga0070669_100017181 3300005353 Bacteria 5162
52 Ga0070669_100065750 3300005353 Bacteria 2671
53 Ga0070671_100039128 3300005355 Bacteria 3936
54 Ga0070671_100142884 3300005355 Bacteria 2020
55 Ga0070673_100011930 3300005364 Bacteria 5951
56 Ga0070673_100023593 3300005364 Bacteria 4496
57 Ga0070688_100014614 3300005365 Bacteria 4451
58 Ga0070659_100009348 3300005366 Bacteria 7199
59 Ga0070667_100006079 3300005367 Bacteria 10023
60 Ga0070667_100037015 3300005367 Bacteria 4091
61 Ga0070667_100058852 3300005367 Bacteria 3249
62 Ga0070709_10012824 3300005434 Bacteria 4698
63 Ga0070714_100260287 3300005435 Bacteria 1606
64 Ga0070713_100122379 3300005436 Bacteria 2284
65 Ga0070713_100205505 3300005436 Bacteria 1780
66 Ga0070701_10018845 3300005438 Bacteria 3251
67 Ga0070678_100006577 3300005456 Bacteria 6831
68 Ga0070678_100012186 3300005456 Bacteria 5334
69 Ga0070662_100019774 3300005457 Bacteria 4578
70 Ga0070662_100019909 3300005457 Bacteria 4565
71 Ga0070662_100119980 3300005457 Bacteria 2014
72 Ga0070681_10066690 3300005458 Bacteria 3568
73 Ga0068867_100033420 3300005459 Bacteria 3725
74 Ga0068867_100058867 3300005459 Bacteria 2847
75 Ga0070679_100001139 3300005530 Bacteria 23239
76 Ga0070679_100358171 3300005530 Unclassified 1406
77 Ga0070684_100027232 3300005535 Bacteria 4822
78 Ga0070684_100057827 3300005535 Bacteria 3387
79 Ga0070684_100063355 3300005535 Bacteria 3241
80 Ga0070684_100199072 3300005535 Bacteria 1824
81 Ga0068853_100006260 3300005539 Bacteria 9435
82 Ga0068853_100032824 3300005539 Bacteria 4400
83 Ga0068853_100047245 3300005539 Bacteria 3694
84 Ga0068853_100051160 3300005539 Bacteria 3555
85 Ga0068853_100105152 3300005539 Unclassified 2500
86 Ga0070672_100242838 3300005543 Unclassified 1515
87 Ga0070672_100331074 3300005543 Bacteria 1296
88 Ga0070672_100347250 3300005543 Bacteria 1264
89 Ga0070686_100024201 3300005544 Bacteria 3638
90 Ga0068855_100001879 3300005563 Bacteria 26084
91 Ga0068855_100023944 3300005563 Bacteria 7310
92 Ga0068855_100295666 3300005563 Bacteria 1794
93 Ga0070664_100029014 3300005564 Bacteria 4609
94 Ga0070664_100062819 3300005564 Bacteria 3166
95 Ga0070664_100076572 3300005564 Unclassified 2875
96 Ga0068857_100067852 3300005577 Bacteria 3175
97 Ga0068857_100170079 3300005577 Bacteria 1980
98 Ga0068857_100184567 3300005577 Bacteria 1899
99 Ga0068854_100066266 3300005578 Bacteria 2628
100 Ga0068854_100125922 3300005578 Bacteria 1951
101 Ga0068854_100147908 3300005578 Bacteria 1809
102 Ga0068854_100157246 3300005578 Unclassified 1757
103 Ga0068856_100328220 3300005614 Bacteria 1548
104 Ga0070702_100171091 3300005615 Unclassified 1413
105 Ga0068852_100263267 3300005616 Bacteria 1656
106 Ga0068852_100347762 3300005616 Bacteria 1447
107 Ga0068852_100370714 3300005616 Bacteria 1402
108 Ga0068859_100026951 3300005617 Bacteria 5764
109 Ga0068866_10020392 3300005718 Bacteria 3036
110 Ga0068861_100298101 3300005719 Bacteria 1395
111 Ga0068858_100066075 3300005842 Bacteria 3348
112 Ga0068858_100081767 3300005842 Bacteria 3002
113 Ga0068862_100003850 3300005844 Bacteria 12780
114 Ga0068862_100028536 3300005844 Bacteria 4700
115 Ga0068862_100079536 3300005844 Unclassified 2842
116 Ga0081539_10016412 3300005985 Bacteria 5291
117 Ga0070717_10000566 3300006028 Bacteria 23601
118 Ga0070717_10010803 3300006028 Bacteria 6907
119 Ga0075366_10000660 3300006195 Bacteria 16235
120 Ga0075366_10060051 3300006195 Bacteria 2259
121 Ga0097621_100000092 3300006237 Bacteria 49439
122 Ga0097621_100213038 3300006237 Bacteria 1681
123 Ga0068871_100000032 3300006358 Bacteria 73078
124 Ga0068871_100073187 3300006358 Unclassified 2824
125 Ga0097620_100020800 3300006931 Bacteria 6586
126 Ga0097620_100026953 3300006931 Bacteria 5764
127 Ga0105240_10000119 3300009093 Bacteria 163675
128 Ga0105240_10009557 3300009093 Bacteria 13728
129 Ga0105240_10022863 3300009093 Bacteria 8284
130 Ga0105240_10136594 3300009093 Bacteria 2936
131 Ga0111539_10006460 3300009094 Bacteria 15103
132 Ga0111539_10166115 3300009094 Bacteria 2580
133 Ga0111539_10191879 3300009094 Bacteria 2384
134 Ga0105241_10004140 3300009174 Bacteria 10704
135 Ga0105241_10030188 3300009174 Unclassified 4049
136 Ga0105237_10004078 3300009545 Bacteria 17033
137 Ga0105237_10010887 3300009545 Bacteria 9650
138 Ga0105237_10011912 3300009545 Bacteria 9193
139 Ga0105237_10031181 3300009545 Bacteria 5407
140 Ga0105237_10349605 3300009545 Unclassified 1483
141 Ga0105237_10470891 3300009545 Bacteria 1262
142 Ga0105238_10028993 3300009551 Bacteria 5638
143 Ga0105249_10005603 3300009553 Bacteria 10858
144 Ga0105249_10044919 3300009553 Bacteria 4018
145 Ga0105249_10381958 3300009553 Bacteria 1435
146 Ga0105239_10000703 3300010375 Bacteria 47494
147 Ga0105239_10003477 3300010375 Bacteria 19270
148 Ga0105239_10005530 3300010375 Bacteria 14792
149 Ga0105239_10006482 3300010375 Bacteria 13572
150 Ga0105239_10078788 3300010375 Bacteria 3626
151 Ga0105239_10116790 3300010375 Bacteria 2961
152 Ga0105239_10468994 3300010375 Bacteria 1430
153 Ga0157373_10000698 3300013100 Bacteria 26281
154 Ga0157373_10013282 3300013100 Bacteria 6044
155 Ga0157373_10055583 3300013100 Bacteria 2812
156 Ga0157373_10157558 3300013100 Bacteria 1597
157 Ga0157371_10000691 3300013102 Bacteria 39752
158 Ga0157371_10004886 3300013102 Bacteria 11520
159 Ga0157371_10010447 3300013102 Bacteria 7232
160 Ga0157371_10012639 3300013102 Bacteria 6442
161 Ga0157371_10045498 3300013102 Unclassified 3123
162 Ga0157371_10101718 3300013102 Bacteria 2038
163 Ga0157370_10018122 3300013104 Bacteria 7089
164 Ga0157370_10033249 3300013104 Bacteria 5027
165 Ga0157370_10039909 3300013104 Bacteria 4534
166 Ga0157370_10145318 3300013104 Bacteria 2209
167 Ga0157370_10347725 3300013104 Bacteria 1367
168 Ga0157369_10006884 3300013105 Bacteria 13120
169 Ga0157369_10008337 3300013105 Bacteria 11880
170 Ga0157369_10031379 3300013105 Bacteria 5851
171 Ga0157374_10026550 3300013296 Bacteria 5211
172 Ga0157374_10063627 3300013296 Bacteria 3460
173 Ga0157374_10096558 3300013296 Bacteria 2826
174 Ga0157374_10124035 3300013296 Bacteria 2495
175 Ga0157374_10126005 3300013296 Bacteria 2476
176 Ga0157378_10019267 3300013297 Bacteria 5997
177 Ga0157378_10036081 3300013297 Unclassified 4376
178 Ga0157378_10071328 3300013297 Bacteria 3120
179 Ga0157378_10220520 3300013297 Unclassified 1803
180 Ga0163162_10000431 3300013306 Bacteria 38724
181 Ga0163162_10002896 3300013306 Bacteria 16339
182 Ga0163162_10007541 3300013306 Bacteria 10596
183 Ga0163162_10027268 3300013306 Bacteria 5647
184 Ga0163162_10184442 3300013306 Bacteria 2213
185 Ga0157372_10008031 3300013307 Bacteria 11224
186 Ga0157372_10020395 3300013307 Bacteria 7150
187 Ga0157372_10023469 3300013307 Bacteria 6687
188 Ga0157372_10038401 3300013307 Bacteria 5283
189 Ga0157372_10073464 3300013307 Bacteria 3855
190 Ga0157372_10110619 3300013307 Bacteria 3147
191 Ga0157372_10218052 3300013307 Bacteria 2212
192 Ga0157375_10000253 3300013308 Bacteria 48558
193 Ga0157375_10019892 3300013308 Bacteria 6120
194 Ga0157375_10031065 3300013308 Bacteria 5042
195 Ga0157375_10057690 3300013308 Bacteria 3838
196 Ga0157375_10098463 3300013308 Unclassified 3001
197 Ga0163163_10001380 3300014325 Bacteria 20505
198 Ga0157380_10000293 3300014326 Bacteria 30049
199 Ga0157380_10000383 3300014326 Bacteria 26712
200 Ga0182008_10000014 3300014497 Bacteria 263844
201 Ga0182008_10000346 3300014497 Bacteria 36122
202 Ga0157377_10010889 3300014745 Bacteria 4519
203 Ga0157377_10011006 3300014745 Bacteria 4499
204 Ga0157377_10034759 3300014745 Bacteria 2759
205 Ga0157379_10080924 3300014968 Unclassified 2910
206 Ga0157376_10000714 3300014969 Bacteria 21474
207 Ga0157376_10004610 3300014969 Bacteria 9599
208 Ga0157376_10225697 3300014969 Bacteria 1737
209 Ga0157376_10327134 3300014969 Bacteria 1459
210 Ga0182006_1002249 3300015261 Bacteria 10660
211 Ga0163161_10005101 3300017792 Bacteria 9139
212 Ga0163161_10008802 3300017792 Bacteria 6978
213 Ga0209437_100017 3300025233 Bacteria 694471
214 Ga0209258_100326 3300025242 Bacteria 72066
215 Ga0207425_1012166 3300025245 Bacteria 2028
216 Ga0209646_1000004 3300025246 Bacteria 786587
217 Ga0209026_1000136 3300025250 Bacteria 116507
218 Ga0209148_1000157 3300025254 Bacteria 142367
219 Ga0209673_1000016 3300025273 Bacteria 506202
220 Ga0209673_1000111 3300025273 Bacteria 180094
221 Ga0209130_1005495 3300025284 Bacteria 4373
222 Ga0209564_1001725 3300025295 Bacteria 20505
223 Ga0209564_1001936 3300025295 Bacteria 18486
224 Ga0209758_1002575 3300025297 Bacteria 18208
225 Ga0209758_1009939 3300025297 Bacteria 5796
226 Ga0209050_1000444 3300025298 Bacteria 74945
227 Ga0209050_1003311 3300025298 Bacteria 12037
228 Ga0207426_1000073 3300025302 Bacteria 323756
229 Ga0207426_1000093 3300025302 Bacteria 277663
230 Ga0207426_1000606 3300025302 Bacteria 46465
231 Ga0207426_1001338 3300025302 Bacteria 20922
232 Ga0207426_1003414 3300025302 Bacteria 8661
233 Ga0209257_1000025 3300025304 Bacteria 724838
234 Ga0209257_1002031 3300025304 Bacteria 21584
235 Ga0207699_10022361 3300025906 Bacteria 3425
236 Ga0207645_10004294 3300025907 Bacteria 10575
237 Ga0207645_10022149 3300025907 Bacteria 4136
238 Ga0207705_10010454 3300025909 Bacteria 6748
239 Ga0207705_10022201 3300025909 Bacteria 4527
240 Ga0207654_10052550 3300025911 Bacteria 2349
241 Ga0207707_10002524 3300025912 Bacteria 16446
242 Ga0207695_10000053 3300025913 Bacteria 396740
243 Ga0207695_10000060 3300025913 Bacteria 360217
244 Ga0207695_10000139 3300025913 Bacteria 216873
245 Ga0207695_10038033 3300025913 Bacteria 5187
246 Ga0207695_10043835 3300025913 Bacteria 4763
247 Ga0207695_10099906 3300025913 Bacteria 2898
248 Ga0207695_10222027 3300025913 Bacteria 1797
249 Ga0207671_10007252 3300025914 Bacteria 9654
250 Ga0207671_10012292 3300025914 Bacteria 6893
251 Ga0207671_10028831 3300025914 Bacteria 4147
252 Ga0207671_10066516 3300025914 Bacteria 2683
253 Ga0207660_10012008 3300025917 Bacteria 5657
254 Ga0207662_10049483 3300025918 Bacteria 2494
255 Ga0207657_10016319 3300025919 Bacteria 7165
256 Ga0207657_10018474 3300025919 Bacteria 6653
257 Ga0207652_10013876 3300025921 Bacteria 6520
258 Ga0207652_10017662 3300025921 Bacteria 5840
259 Ga0207652_10086965 3300025921 Unclassified 2741
260 Ga0207681_10016334 3300025923 Bacteria 4642
261 Ga0207694_10081376 3300025924 Bacteria 2544
262 Ga0207650_10003972 3300025925 Bacteria 10124
263 Ga0207650_10005272 3300025925 Bacteria 8817
264 Ga0207650_10132916 3300025925 Bacteria 1949
265 Ga0207659_10115755 3300025926 Bacteria 2046
266 Ga0207659_10300359 3300025926 Unclassified 1318
267 Ga0207664_10115486 3300025929 Bacteria 2238
268 Ga0207644_10050788 3300025931 Bacteria 2974
269 Ga0207644_10117380 3300025931 Bacteria 2021
270 Ga0207690_10075638 3300025932 Bacteria 2335
271 Ga0207706_10002076 3300025933 Bacteria 19622
272 Ga0207706_10070672 3300025933 Bacteria 3070
273 Ga0207704_10089393 3300025938 Bacteria 2018
274 Ga0207691_10169566 3300025940 Bacteria 1912
275 Ga0207689_10015740 3300025942 Bacteria 6404
276 Ga0207689_10051137 3300025942 Unclassified 3406
277 Ga0207661_10018356 3300025944 Bacteria 5197
278 Ga0207661_10193646 3300025944 Bacteria 1784
279 Ga0207679_10076139 3300025945 Unclassified 2548
280 Ga0207679_10211960 3300025945 Unclassified 1625
281 Ga0207667_10023124 3300025949 Bacteria 6847
282 Ga0207667_10025906 3300025949 Bacteria 6415
283 Ga0207667_10026614 3300025949 Bacteria 6314
284 Ga0207712_10019270 3300025961 Bacteria 4454
285 Ga0207712_10283999 3300025961 Bacteria 1352
286 Ga0207668_10048351 3300025972 Bacteria 2919
287 Ga0207640_10034337 3300025981 Unclassified 3165
288 Ga0207640_10041435 3300025981 Bacteria 2929
289 Ga0207640_10079630 3300025981 Unclassified 2234
290 Ga0207640_10270996 3300025981 Bacteria 1328
291 Ga0207658_10013694 3300025986 Bacteria 5547
292 Ga0207658_10150807 3300025986 Bacteria 1894
293 Ga0207677_10030871 3300026023 Bacteria 3426
294 Ga0207677_10077558 3300026023 Bacteria 2370
295 Ga0207677_10097715 3300026023 Bacteria 2152
296 Ga0207639_10019764 3300026041 Bacteria 4810
297 Ga0207639_10024118 3300026041 Bacteria 4398
298 Ga0207639_10172696 3300026041 Unclassified 1832
299 Ga0207639_10385022 3300026041 Bacteria 1260
300 Ga0207678_10130632 3300026067 Bacteria 2142
301 Ga0207702_10035616 3300026078 Unclassified 4162
302 Ga0207648_10129864 3300026089 Bacteria 2218
303 Ga0207648_10202517 3300026089 Bacteria 1761
304 Ga0207676_10330252 3300026095 Bacteria 1403
305 Ga0207674_10008940 3300026116 Bacteria 11511
306 Ga0207674_10033665 3300026116 Bacteria 5363
307 Ga0207674_10038365 3300026116 Bacteria 4973
308 Ga0207675_100003057 3300026118 Bacteria 16412
309 Ga0207675_100357523 3300026118 Unclassified 1432
310 Ga0207683_10025976 3300026121 Bacteria 5056
311 Ga0207683_10126348 3300026121 Bacteria 2298
312 Ga0207683_10216009 3300026121 Bacteria 1746
313 Ga0207698_10008026 3300026142 Bacteria 6655
314 Ga0207698_10015922 3300026142 Bacteria 5056
315 Ga0207698_10025901 3300026142 Bacteria 4141
316 Ga0207698_10042757 3300026142 Bacteria 3389
317 Ga0207698_10244323 3300026142 Bacteria 1638
318 Ga0207698_10285281 3300026142 Bacteria 1529
319 Ga0207428_10079771 3300027907 Unclassified 2558
320 Ga0207428_10102977 3300027907 Unclassified 2204
321 Ga0268265_10208958 3300028380 Bacteria 1699
322 Ga0268264_10021978 3300028381 Bacteria 5206
323 Ga0307515_10000318 3300028794 Bacteria 118891
324 Ga0307515_10017059 3300028794 Bacteria 13257
325 Ga0316177_1160081 3300030731 Bacteria 7348
326 Ga0316176_1159253 3300030732 Bacteria 2512
327 Ga0316183_1166136 3300030742 Bacteria 44041
328 Ga0316181_1203439 3300030744 Bacteria 31400
329 Ga0265327_10000117 3300031251 Bacteria 173075
330 Ga0307513_10095393 3300031456 Bacteria 3016
331 Ga0307509_10043345 3300031507 Bacteria 4869
332 Ga0307405_10043700 3300031731 Bacteria 2736
333 Ga0307407_10046687 3300031903 Bacteria 2454
334 Ga0307412_10002270 3300031911 Bacteria 10634
335 Ga0307412_10146851 3300031911 Bacteria 1735
336 Ga0307416_100000510 3300032002 Bacteria 19836
337 Ga0307414_10000056 3300032004 Bacteria 113603
338 Ga0307414_10001617 3300032004 Bacteria 11716
339 Ga0307510_10095583 3300033180 Bacteria 2790
340 Ga0373925_0325308 3300037068 Bacteria 1245
341 Ga0395899_0039704 3300037312 Bacteria 3521
342 Ga0395900_0046267 3300037418 Bacteria 4480
343 Ga0395898_0056933 3300037466 Bacteria 3809
344 Ga0395898_0198050 3300037466 Bacteria 1918
345 Ga0395905_0024236 3300037471 Bacteria 5727
346 Ga0395905_0231897 3300037471 Unclassified 1726
347 Ga0395901_0089631 3300038443 Bacteria 3218
348 Ga0395901_0119642 3300038443 Bacteria 2767
349 Ga0439436_0027358 3300041404 Bacteria 1668
350 Ga0439453_0010793 3300041408 Unclassified 1513
351 Ga0451833_1270960 3300041491 Unclassified 1797
352 Ga0439457_000466 3300042014 Bacteria 11673
353 Ga0439462_0002461 3300042015 Bacteria 4304
354 Ga0451577_0020158 3300042876 Bacteria 6123
355 Ga0451577_0371180 3300042876 Bacteria 1298
356 Ga0466972_0000074 3300044658 Bacteria 95327
357 Ga0466972_0000097 3300044658 Bacteria 76894
358 Ga0466982_0074588 3300044672 Unclassified 2097
359 Ga0466965_0019687 3300044683 Unclassified 3241
360 Ga0453684_0004618 3300044712 Bacteria 28664
361 Ga0466970_0000370 3300044765 Bacteria 21830
362 Ga0451576_0093116 3300045051 Bacteria 3133
363 Ga0495638_0000020 3300046460 Bacteria 372434
364 Ga0495653_0107624 3300046463 Bacteria 2009
365 Ga0495606_0000060 3300046507 Bacteria 185907
366 Ga0495608_0039065 3300046511 Bacteria 3183
367 Ga0495610_0001375 3300046512 Bacteria 21610
368 Ga0495616_0000540 3300046513 Bacteria 28554
369 Ga0495630_0008494 3300046517 Bacteria 7372
370 Ga0495648_0003227 3300046524 Bacteria 14462
371 Ga0495652_0115910 3300046529 Bacteria 2146
372 Ga0495654_0042953 3300046530 Bacteria 2242
373 Ga0495609_0002454 3300046538 Bacteria 11402
374 Ga0495609_0010910 3300046538 Bacteria 4341
375 Ga0495622_0038693 3300046557 Bacteria 2221
376 Ga0495633_0000500 3300046558 Bacteria 39535
377 Ga0495633_0001938 3300046558 Bacteria 15044
378 Ga0495668_0000055 3300046616 Bacteria 199412
379 Ga0495625_0000018 3300046660 Bacteria 299567
380 Ga0495625_0001033 3300046660 Bacteria 36654
381 Ga0495625_0001326 3300046660 Bacteria 30769
382 Ga0495625_0141551 3300046660 Bacteria 1622
383 Ga0495649_0000111 3300046694 Bacteria 71877
384 Ga0495604_0226434 3300047317 Bacteria 1285
385 Ga0495680_0067988 3300047322 Bacteria 2723
386 Ga0495687_000220 3300047443 Bacteria 80993
387 Ga0495686_0000083 3300047472 Bacteria 198933
388 Ga0495686_0000102 3300047472 Bacteria 177525
389 Ga0495686_0010072 3300047472 Bacteria 6752
390 Ga0495686_0013857 3300047472 Bacteria 5580
391 Ga0495614_0028008 3300048089 Bacteria 2429
392 Ga0496101_0012680 3300048904 Bacteria 5633
393 Ga0496104_0174376 3300048907 Unclassified 2061
394 Ga0496110_0128843 3300048913 Bacteria 2284
395 Ga0496126_0077420 3300048929 Bacteria 2948
396 Ga0495682_0009004 3300049460 Bacteria 3917
397 Ga0501032_0041553 3300049569 Bacteria 3121
398 Ga0501033_0029825 3300049570 Bacteria 4100
399 Ga0501033_0237374 3300049570 Bacteria 1294
400 Ga0501034_0006727 3300049571 Bacteria 12313
401 Ga0501034_0025272 3300049571 Bacteria 6045
402 Ga0501034_0053147 3300049571 Bacteria 4081
403 Ga0501037_0108930 3300049573 Bacteria 1996
404 Ga0501037_0206312 3300049573 Bacteria 1387
405 Ga0501047_0059062 3300049581 Bacteria 3703
406 Ga0501047_0068939 3300049581 Bacteria 3407
407 Ga0501048_0060113 3300049582 Bacteria 2693
408 Ga0501067_0038970 3300049583 Bacteria 2638
409 Ga0501069_0080231 3300049585 Bacteria 1837
410 Ga0501198_000507 3300049649 Bacteria 4826
411 Ga0501202_002525 3300049652 Bacteria 3080
412 Ga0501206_001890 3300049653 Bacteria 2631
413 Ga0501217_002522 3300049661 Bacteria 3614
414 Ga0501223_002569 3300049663 Bacteria 4010
415 Ga0501224_000324 3300049664 Bacteria 5597
416 Ga0501240_002262 3300049673 Bacteria 2018
417 Ga0501243_001132 3300049675 Bacteria 3787
418 Ga0501249_005835 3300049679 Bacteria 2518
419 Ga0501221_002549 3300049704 Bacteria 3002
420 Ga0501225_0002951 3300049705 Bacteria 5213
421 Ga0501234_000708 3300049707 Bacteria 5125
422 Ga0501279_001573 3300049775 Bacteria 3007
423 Ga0501035_0062025 3300049822 Bacteria 3326
424 Ga0501044_0006387 3300049823 Bacteria 13035
425 Ga0501044_0028771 3300049823 Bacteria 5863
426 Ga0501044_0029405 3300049823 Bacteria 5794
427 Ga0501044_0057415 3300049823 Bacteria 3994
428 Ga0501044_0060492 3300049823 Bacteria 3878
429 Ga0501212_003440 3300049851 Bacteria 1986
430 nmdc:mga0k408_171127_c1 3300050493 Bacteria 1295
431 nmdc:mga0k408_67490_c1 3300050493 Bacteria 2084
432 nmdc:mga0k408_710_c1 3300050493 Bacteria 18223
433 nmdc:mga08y16_40154_c1 3300050511 Bacteria 4906
434 Ga0500635_0000305 3300053080 Bacteria 17216
435 Ga0495619_0019222 3300053085 Bacteria 4342
436 Ga0500578_0000324 3300053086 Bacteria 58297
437 Ga0500644_0000396 3300053088 Bacteria 20728
438 Ga0500646_0006132 3300053090 Bacteria 3055
439 Ga0500583_0000087 3300053092 Bacteria 51328
440 Ga0500557_050242 3300053105 Bacteria 1335
441 Ga0500569_000230 3300053109 Bacteria 8922
442 Ga0500658_0026967 3300053134 Bacteria 2217
443 Ga0500559_0088314 3300053136 Bacteria 1417
444 Ga0500589_065398 3300053147 Bacteria 1658
445 Ga0500616_0000007 3300053153 Bacteria 836875
446 Ga0500622_0000222 3300053156 Bacteria 59404
447 Ga0500611_000048 3300053727 Bacteria 56160
448 Ga0466962_0015766 3300061719 Bacteria 3645
449 2599481485 2599185184 Bacteria 6430550
450 2738728504 2738541278 Bacteria 9755573
451 2738760104 2738541284 Bacteria 5199923
452 2738855930 2738541302 Bacteria 5944758
453 2819678821 2818991460 Bacteria 7595395
454 2821138572 2821136567 Bacteria 8080116
455 2842904099 2842903701 Bacteria 6986368
456 2857628392 2857627736 Bacteria 5625397
457 2896318446 2896317667 Bacteria 4606601
458 2904449280 2904445276 Bacteria 5310396
459 2904469365 2904467357 Bacteria 8057758
460 2910249319 2910245624 Bacteria 6935613
461 2928082810 2928078545 Bacteria 6534839
462 2928149828 2928147474 Bacteria 6512076
463 2929245554 2929239360 Bacteria 7745570
464 2929921763 2929921140 Bacteria 8649150
465 2932086521 2932082852 Bacteria 6563563
466 2946002663 2945997725 Bacteria 6404843
467 8003154315 8003151029 Bacteria 8187759
468 8055589403 8055588893 Bacteria 3619545
469 Ga0496126_0000012
470 SwRhRL2b_contig_3916980
471 JGI24740J21852_10000101
472 JGI24739J22299_10002093
473 JGI24737J22298_10000214
474 JGI24735J21928_10000044
475 JGI25162J39368_1000011
476 JGI25154J39366_1000023
477 rootH1_10017922
478 rootH2_10021864
479 rootH2_10041902
480 rootL2_10012522
481 rootL2_10033905
482 rootL2_10070742
483 rootL2_10074487
484 rootL2_10086738
485 rootH1_10004627
486 rootH1_10045448
487 rootH1_10047270
488 rootH1_10049363
489 JGI25160J50197_1002551
490 JGI25160J50197_1005442
491 Ga0055535_1007251
492 Ga0055526_1007835
493 Ga0055528_1005165
494 Ga0055530_10000570
495 Ga0055531_10000139
496 Ga0065165_1000012
497 Ga0065165_1008076
498 Ga0065704_10000436
499 Ga0065712_10009853
500 Ga0070683_100002599
501 Ga0070683_100026440
502 Ga0070690_100122386
503 Ga0070670_100003947
504 Ga0070670_100097618
505 Ga0070670_100271844
506 Ga0070677_10009815
507 Ga0068869_100014259
508 Ga0070666_10003274
509 Ga0070666_10043032
510 Ga0070680_100011225
511 Ga0070680_100096250
512 Ga0068868_100009679
513 Ga0068868_100070454
514 Ga0068868_100178660
515 Ga0070660_100000286
516 Ga0070691_10016752
517 Ga0070668_100006264
518 Ga0070668_100168820
519 Ga0070669_100017181
520 Ga0070669_100065750
521 Ga0070671_100039128
522 Ga0070671_100142884
523 Ga0070673_100011930
524 Ga0070673_100023593
525 Ga0070688_100014614
526 Ga0070659_100009348
527 Ga0070667_100006079
528 Ga0070667_100037015
529 Ga0070667_100058852
530 Ga0070709_10012824
531 Ga0070714_100260287
532 Ga0070713_100122379
533 Ga0070713_100205505
534 Ga0070701_10018845
535 Ga0070678_100006577
536 Ga0070678_100012186
537 Ga0070662_100019774
538 Ga0070662_100019909
539 Ga0070662_100119980
540 Ga0070681_10066690
541 Ga0068867_100033420
542 Ga0068867_100058867
543 Ga0070679_100001139
544 Ga0070679_100358171
545 Ga0070684_100027232
546 Ga0070684_100057827
547 Ga0070684_100063355
548 Ga0070684_100199072
549 Ga0068853_100006260
550 Ga0068853_100032824
551 Ga0068853_100047245
552 Ga0068853_100051160
553 Ga0068853_100105152
554 Ga0070672_100242838
555 Ga0070672_100331074
556 Ga0070672_100347250
557 Ga0070686_100024201
558 Ga0068855_100001879
559 Ga0068855_100023944
560 Ga0068855_100295666
561 Ga0070664_100029014
562 Ga0070664_100062819
563 Ga0070664_100076572
564 Ga0068857_100067852
565 Ga0068857_100170079
566 Ga0068857_100184567
567 Ga0068854_100066266
568 Ga0068854_100125922
569 Ga0068854_100147908
570 Ga0068854_100157246
571 Ga0068856_100328220
572 Ga0070702_100171091
573 Ga0068852_100263267
574 Ga0068852_100347762
575 Ga0068852_100370714
576 Ga0068859_100026951
577 Ga0068866_10020392
578 Ga0068861_100298101
579 Ga0068858_100066075
580 Ga0068858_100081767
581 Ga0068862_100003850
582 Ga0068862_100028536
583 Ga0068862_100079536
584 Ga0081539_10016412
585 Ga0070717_10000566
586 Ga0070717_10010803
587 Ga0075366_10000660
588 Ga0075366_10060051
589 Ga0097621_100000092
590 Ga0097621_100213038
591 Ga0068871_100000032
592 Ga0068871_100073187
593 Ga0097620_100020800
594 Ga0097620_100026953
595 Ga0105240_10000119
596 Ga0105240_10009557
597 Ga0105240_10022863
598 Ga0105240_10136594
599 Ga0111539_10006460
600 Ga0111539_10166115
601 Ga0111539_10191879
602 Ga0105241_10004140
603 Ga0105241_10030188
604 Ga0105237_10004078
605 Ga0105237_10010887
606 Ga0105237_10011912
607 Ga0105237_10031181
608 Ga0105237_10349605
609 Ga0105237_10470891
610 Ga0105238_10028993
611 Ga0105249_10005603
612 Ga0105249_10044919
613 Ga0105249_10381958
614 Ga0105239_10000703
615 Ga0105239_10003477
616 Ga0105239_10005530
617 Ga0105239_10006482
618 Ga0105239_10078788
619 Ga0105239_10116790
620 Ga0105239_10468994
621 Ga0157373_10000698
622 Ga0157373_10013282
623 Ga0157373_10055583
624 Ga0157373_10157558
625 Ga0157371_10000691
626 Ga0157371_10004886
627 Ga0157371_10010447
628 Ga0157371_10012639
629 Ga0157371_10045498
630 Ga0157371_10101718
631 Ga0157370_10018122
632 Ga0157370_10033249
633 Ga0157370_10039909
634 Ga0157370_10145318
635 Ga0157370_10347725
636 Ga0157369_10006884
637 Ga0157369_10008337
638 Ga0157369_10031379
639 Ga0157374_10026550
640 Ga0157374_10063627
641 Ga0157374_10096558
642 Ga0157374_10124035
643 Ga0157374_10126005
644 Ga0157378_10019267
645 Ga0157378_10036081
646 Ga0157378_10071328
647 Ga0157378_10220520
648 Ga0163162_10000431
649 Ga0163162_10002896
650 Ga0163162_10007541
651 Ga0163162_10027268
652 Ga0163162_10184442
653 Ga0157372_10008031
654 Ga0157372_10020395
655 Ga0157372_10023469
656 Ga0157372_10038401
657 Ga0157372_10073464
658 Ga0157372_10110619
659 Ga0157372_10218052
660 Ga0157375_10000253
661 Ga0157375_10019892
662 Ga0157375_10031065
663 Ga0157375_10057690
664 Ga0157375_10098463
665 Ga0163163_10001380
666 Ga0157380_10000293
667 Ga0157380_10000383
668 Ga0182008_10000014
669 Ga0182008_10000346
670 Ga0157377_10010889
671 Ga0157377_10011006
672 Ga0157377_10034759
673 Ga0157379_10080924
674 Ga0157376_10000714
675 Ga0157376_10004610
676 Ga0157376_10225697
677 Ga0157376_10327134
678 Ga0182006_1002249
679 Ga0163161_10005101
680 Ga0163161_10008802
681 Ga0209437_100017
682 Ga0209258_100326
683 Ga0207425_1012166
684 Ga0209646_1000004
685 Ga0209026_1000136
686 Ga0209148_1000157
687 Ga0209673_1000016
688 Ga0209673_1000111
689 Ga0209130_1005495
690 Ga0209564_1001725
691 Ga0209564_1001936
692 Ga0209758_1002575
693 Ga0209758_1009939
694 Ga0209050_1000444
695 Ga0209050_1003311
696 Ga0207426_1000073
697 Ga0207426_1000093
698 Ga0207426_1000606
699 Ga0207426_1001338
700 Ga0207426_1003414
701 Ga0209257_1000025
702 Ga0209257_1002031
703 Ga0207699_10022361
704 Ga0207645_10004294
705 Ga0207645_10022149
706 Ga0207705_10010454
707 Ga0207705_10022201
708 Ga0207654_10052550
709 Ga0207707_10002524
710 Ga0207695_10000053
711 Ga0207695_10000060
712 Ga0207695_10000139
713 Ga0207695_10038033
714 Ga0207695_10043835
715 Ga0207695_10099906
716 Ga0207695_10222027
717 Ga0207671_10007252
718 Ga0207671_10012292
719 Ga0207671_10028831
720 Ga0207671_10066516
721 Ga0207660_10012008
722 Ga0207662_10049483
723 Ga0207657_10016319
724 Ga0207657_10018474
725 Ga0207652_10013876
726 Ga0207652_10017662
727 Ga0207652_10086965
728 Ga0207681_10016334
729 Ga0207694_10081376
730 Ga0207650_10003972
731 Ga0207650_10005272
732 Ga0207650_10132916
733 Ga0207659_10115755
734 Ga0207659_10300359
735 Ga0207664_10115486
736 Ga0207644_10050788
737 Ga0207644_10117380
738 Ga0207690_10075638
739 Ga0207706_10002076
740 Ga0207706_10070672
741 Ga0207704_10089393
742 Ga0207691_10169566
743 Ga0207689_10015740
744 Ga0207689_10051137
745 Ga0207661_10018356
746 Ga0207661_10193646
747 Ga0207679_10076139
748 Ga0207679_10211960
749 Ga0207667_10023124
750 Ga0207667_10025906
751 Ga0207667_10026614
752 Ga0207712_10019270
753 Ga0207712_10283999
754 Ga0207668_10048351
755 Ga0207640_10034337
756 Ga0207640_10041435
757 Ga0207640_10079630
758 Ga0207640_10270996
759 Ga0207658_10013694
760 Ga0207658_10150807
761 Ga0207677_10030871
762 Ga0207677_10077558
763 Ga0207677_10097715
764 Ga0207639_10019764
765 Ga0207639_10024118
766 Ga0207639_10172696
767 Ga0207639_10385022
768 Ga0207678_10130632
769 Ga0207702_10035616
770 Ga0207648_10129864
771 Ga0207648_10202517
772 Ga0207676_10330252
773 Ga0207674_10008940
774 Ga0207674_10033665
775 Ga0207674_10038365
776 Ga0207675_100003057
777 Ga0207675_100357523
778 Ga0207683_10025976
779 Ga0207683_10126348
780 Ga0207683_10216009
781 Ga0207698_10008026
782 Ga0207698_10015922
783 Ga0207698_10025901
784 Ga0207698_10042757
785 Ga0207698_10244323
786 Ga0207698_10285281
787 Ga0207428_10079771
788 Ga0207428_10102977
789 Ga0268265_10208958
790 Ga0268264_10021978
791 Ga0307515_10000318
792 Ga0307515_10017059
793 Ga0316177_1160081
794 Ga0316176_1159253
795 Ga0316183_1166136
796 Ga0316181_1203439
797 Ga0265327_10000117
798 Ga0307513_10095393
799 Ga0307509_10043345
800 Ga0307405_10043700
801 Ga0307407_10046687
802 Ga0307412_10002270
803 Ga0307412_10146851
804 Ga0307416_100000510
805 Ga0307414_10000056
806 Ga0307414_10001617
807 Ga0307510_10095583
808 Ga0373925_0325308
809 Ga0395899_0039704
810 Ga0395900_0046267
811 Ga0395898_0056933
812 Ga0395898_0198050
813 Ga0395905_0024236
814 Ga0395905_0231897
815 Ga0395901_0089631
816 Ga0395901_0119642
817 Ga0439436_0027358
818 Ga0439453_0010793
819 Ga0451833_1270960
820 Ga0439457_000466
821 Ga0439462_0002461
822 Ga0451577_0020158
823 Ga0451577_0371180
824 Ga0466972_0000074
825 Ga0466972_0000097
826 Ga0466982_0074588
827 Ga0466965_0019687
828 Ga0453684_0004618
829 Ga0466970_0000370
830 Ga0451576_0093116
831 Ga0495638_0000020
832 Ga0495653_0107624
833 Ga0495606_0000060
834 Ga0495608_0039065
835 Ga0495610_0001375
836 Ga0495616_0000540
837 Ga0495630_0008494
838 Ga0495648_0003227
839 Ga0495652_0115910
840 Ga0495654_0042953
841 Ga0495609_0002454
842 Ga0495609_0010910
843 Ga0495622_0038693
844 Ga0495633_0000500
845 Ga0495633_0001938
846 Ga0495668_0000055
847 Ga0495625_0000018
848 Ga0495625_0001033
849 Ga0495625_0001326
850 Ga0495625_0141551
851 Ga0495649_0000111
852 Ga0495604_0226434
853 Ga0495680_0067988
854 Ga0495687_000220
855 Ga0495686_0000083
856 Ga0495686_0000102
857 Ga0495686_0010072
858 Ga0495686_0013857
859 Ga0495614_0028008
860 Ga0496101_0012680
861 Ga0496104_0174376
862 Ga0496110_0128843
863 Ga0496126_0077420
864 Ga0495682_0009004
865 Ga0501032_0041553
866 Ga0501033_0029825
867 Ga0501033_0237374
868 Ga0501034_0006727
869 Ga0501034_0025272
870 Ga0501034_0053147
871 Ga0501037_0108930
872 Ga0501037_0206312
873 Ga0501047_0059062
874 Ga0501047_0068939
875 Ga0501048_0060113
876 Ga0501067_0038970
877 Ga0501069_0080231
878 Ga0501198_000507
879 Ga0501202_002525
880 Ga0501206_001890
881 Ga0501217_002522
882 Ga0501223_002569
883 Ga0501224_000324
884 Ga0501240_002262
885 Ga0501243_001132
886 Ga0501249_005835
887 Ga0501221_002549
888 Ga0501225_0002951
889 Ga0501234_000708
890 Ga0501279_001573
891 Ga0501035_0062025
892 Ga0501044_0006387
893 Ga0501044_0028771
894 Ga0501044_0029405
895 Ga0501044_0057415
896 Ga0501044_0060492
897 Ga0501212_003440
898 nmdc:mga0k408_171127_c1
899 nmdc:mga0k408_67490_c1
900 nmdc:mga0k408_710_c1
901 nmdc:mga08y16_40154_c1
902 Ga0500635_0000305
903 Ga0495619_0019222
904 Ga0500578_0000324
905 Ga0500644_0000396
906 Ga0500646_0006132
907 Ga0500583_0000087
908 Ga0500557_050242
909 Ga0500569_000230
910 Ga0500658_0026967
911 Ga0500559_0088314
912 Ga0500589_065398
913 Ga0500616_0000007
914 Ga0500622_0000222
915 Ga0500611_000048
916 Ga0466962_0015766
917 2599481485
918 2738728504
919 2738760104
920 2738855930
921 2819678821
922 2821138572
923 2842904099
924 2857628392
925 2896318446
926 2904449280
927 2904469365
928 2910249319
929 2928082810
930 2928149828
931 2929245554
932 2929921763
933 2932086521
934 2946002663
935 8003154315
936 8055589403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

32

156

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

164

285

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

168

359

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1evj-assembly2.cif.gz_B crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9505 40 367
1evj-assembly1.cif.gz_C crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9479 40 367
1evj-assembly1.cif.gz_A crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9457 40 367
5a06-assembly1.cif.gz_C crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol 0.9455 37 368
1rye-assembly1.cif.gz_C crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.9441 40 369
ID Description Score Start End Superfamily
1h6aA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9395 34 167 3.40.50.720
1evjA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9235 168 367 3.30.360.10
5a02A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9174 172 368 3.30.360.10
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9117 39 174 3.40.50.720
af_Q9VJH7_91_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8935 39 159 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1V9YUG1-F1-model_v4 D-xylose 1-dehydrogenase (NADP(+), D-xylono-1,5-lactone-forming) (EC 1.1.1.179) (D-xylose-NADP dehydrogenase) 0.9408 38 263 GO:0000166
GO:0016491
AF-A0A2D7V819-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9388 39 185 GO:0000166
GO:0016491
AF-A0A3B8YIG3-F1-model_v4 deleted 0.9333 35 245
AF-A0A2I9CW33-F1-model_v4 Oxidoreductase-like protein 0.932 39 369 GO:0000166
GO:0016491
AF-A0A659YI87-F1-model_v4 deleted 0.9226 78 277

Map