F450127

General Info

Members Datasets Scaffolds Average Seq Length
468 264 936 276

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0031182|Ga0501076_0031182_1653_2501
Length 268
Sequence MKLLVTGAAGMLGRDVMLAAGNAGHDVVGFGRAELDITDPAVLERKLGLERPDVVINCAAWTDVDGAEEAEEAAFAVNGATVVHVSTDYVFDGAKGAPYVESDQPAPLSAYGRTKLAGEEAVAAANKRHFIVRSAGLFGIGGNNFVETMLQLAATRSEVLVVRDQIGSPTYTWHLAYGLVRLIEGLEYGIHHMAAAGQCSWYEFAREIFELAEVDCKVLSVTTAEFGRPAARPPFSALTSQREHAIRLPVWRDGLAAYLSQRKAEREE

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 11.32
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0031182 3300049592 Bacteria 4156
2 JGI24746J21847_1000342 3300001977 Bacteria 6727
3 JGI24740J21852_10002918 3300001979 Bacteria 7622
4 JGI24748J21848_1000384 3300002074 Bacteria 5014
5 JGI24034J26672_10000353 3300002239 Bacteria 5993
6 rootH2_10175980 3300003320 Bacteria 1156
7 Ga0070658_10039587 3300005327 Bacteria 3803
8 Ga0070683_100000207 3300005329 Bacteria 39723
9 Ga0070683_100031889 3300005329 Bacteria 4795
10 Ga0070683_100145395 3300005329 Bacteria 2246
11 Ga0070683_100293409 3300005329 Bacteria 1547
12 Ga0070690_100101432 3300005330 Bacteria 1909
13 Ga0070670_100093250 3300005331 Bacteria 2590
14 Ga0070677_10000019 3300005333 Bacteria 50177
15 Ga0070666_10012209 3300005335 Bacteria 5412
16 Ga0070666_10021591 3300005335 Bacteria 4174
17 Ga0070680_100537719 3300005336 Bacteria 1001
18 Ga0070682_100000038 3300005337 Bacteria 145670
19 Ga0070682_100000040 3300005337 Bacteria 143944
20 Ga0070682_100146084 3300005337 Bacteria 1617
21 Ga0068868_100000175 3300005338 Bacteria 42576
22 Ga0068868_100002533 3300005338 Bacteria 12693
23 Ga0070691_10000098 3300005341 Bacteria 25336
24 Ga0070691_10007033 3300005341 Bacteria 5158
25 Ga0070661_100000052 3300005344 Bacteria 89458
26 Ga0070668_100506305 3300005347 Bacteria 1046
27 Ga0070675_100000008 3300005354 Bacteria 250004
28 Ga0070671_100108004 3300005355 Bacteria 2337
29 Ga0070674_100000016 3300005356 Bacteria 91058
30 Ga0070674_100000105 3300005356 Bacteria 39263
31 Ga0070673_100004686 3300005364 Bacteria 8679
32 Ga0070688_100000151 3300005365 Bacteria 37674
33 Ga0070688_100000258 3300005365 Bacteria 27791
34 Ga0070667_100026099 3300005367 Bacteria 4858
35 Ga0070714_100210561 3300005435 Bacteria 1782
36 Ga0070713_100000055 3300005436 Bacteria 70759
37 Ga0070700_100011612 3300005441 Bacteria 4883
38 Ga0070700_100052817 3300005441 Bacteria 2535
39 Ga0070663_100000101 3300005455 Bacteria 39196
40 Ga0070678_100332482 3300005456 Bacteria 1301
41 Ga0070662_100000015 3300005457 Bacteria 109379
42 Ga0070685_10000092 3300005466 Bacteria 55484
43 Ga0070685_10000360 3300005466 Bacteria 27792
44 Ga0070679_100000156 3300005530 Bacteria 55265
45 Ga0070679_100000784 3300005530 Bacteria 27643
46 Ga0070679_100282042 3300005530 Bacteria 1614
47 Ga0070684_100001385 3300005535 Bacteria 17404
48 Ga0070684_100020009 3300005535 Bacteria 5547
49 Ga0070684_100021991 3300005535 Bacteria 5314
50 Ga0070684_100044565 3300005535 Bacteria 3838
51 Ga0070684_100412264 3300005535 Bacteria 1246
52 Ga0068853_100022191 3300005539 Bacteria 5299
53 Ga0070672_100000036 3300005543 Bacteria 59645
54 Ga0070686_100124532 3300005544 Bacteria 1774
55 Ga0070695_100295246 3300005545 Bacteria 1196
56 Ga0070693_100003601 3300005547 Bacteria 7234
57 Ga0070665_100000128 3300005548 Bacteria 142568
58 Ga0070665_100002491 3300005548 Bacteria 20261
59 Ga0070665_100070049 3300005548 Bacteria 3513
60 Ga0070665_100309719 3300005548 Bacteria 1582
61 Ga0070664_100005631 3300005564 Bacteria 10084
62 Ga0068854_100000123 3300005578 Bacteria 53446
63 Ga0068856_100003489 3300005614 Bacteria 15873
64 Ga0068856_100036766 3300005614 Bacteria 4802
65 Ga0068856_100664037 3300005614 Bacteria 1063
66 Ga0068852_100000195 3300005616 Bacteria 41405
67 Ga0068866_10000006 3300005718 Bacteria 176129
68 Ga0068866_10000220 3300005718 Bacteria 27117
69 Ga0068866_10016642 3300005718 Bacteria 3292
70 Ga0068861_100535186 3300005719 Bacteria 1065
71 Ga0068851_10000138 3300005834 Bacteria 39261
72 Ga0068851_10016790 3300005834 Bacteria 3508
73 Ga0068863_100000039 3300005841 Bacteria 161450
74 Ga0068863_100018094 3300005841 Bacteria 6747
75 Ga0068858_100000350 3300005842 Bacteria 48492
76 Ga0068858_100003595 3300005842 Bacteria 15344
77 Ga0068858_100417740 3300005842 Bacteria 1290
78 Ga0068860_100001352 3300005843 Bacteria 26645
79 Ga0068862_100002457 3300005844 Bacteria 16420
80 Ga0081455_10019516 3300005937 Bacteria 6412
81 Ga0081455_10070831 3300005937 Bacteria 2893
82 Ga0081540_1000419 3300005983 Bacteria 41957
83 Ga0081539_10000615 3300005985 Bacteria 72134
84 Ga0070715_10000003 3300006163 Bacteria 345282
85 Ga0070712_100000142 3300006175 Bacteria 37397
86 Ga0075431_100087667 3300006847 Bacteria 3212
87 Ga0075433_10000307 3300006852 Bacteria 29603
88 Ga0075433_10003841 3300006852 Bacteria 11629
89 Ga0068865_100000009 3300006881 Bacteria 168291
90 Ga0105245_10000012 3300009098 Bacteria 267151
91 Ga0105245_10000067 3300009098 Bacteria 107929
92 Ga0105245_10000246 3300009098 Bacteria 51410
93 Ga0105245_10137444 3300009098 Bacteria 2298
94 Ga0105247_10000110 3300009101 Bacteria 83499
95 Ga0105247_10247032 3300009101 Bacteria 1218
96 Ga0105242_10000010 3300009176 Bacteria 151649
97 Ga0105242_10000904 3300009176 Bacteria 23037
98 Ga0105242_10256676 3300009176 Bacteria 1577
99 Ga0105248_10000307 3300009177 Bacteria 58221
100 Ga0105238_10000014 3300009551 Bacteria 241954
101 Ga0105238_10317327 3300009551 Bacteria 1544
102 Ga0105249_10000159 3300009553 Bacteria 82172
103 Ga0105249_10035006 3300009553 Bacteria 4552
104 Ga0105249_10347919 3300009553 Bacteria 1501
105 Ga0105249_10520326 3300009553 Bacteria 1237
106 Ga0157371_10006368 3300013102 Bacteria 9763
107 Ga0157370_10007054 3300013104 Bacteria 12266
108 Ga0157370_10024314 3300013104 Bacteria 6000
109 Ga0157369_10000222 3300013105 Bacteria 78413
110 Ga0157374_10110668 3300013296 Bacteria 2642
111 Ga0157374_10113022 3300013296 Bacteria 2614
112 Ga0157378_10009467 3300013297 Bacteria 8488
113 Ga0157372_10000150 3300013307 Bacteria 75963
114 Ga0157375_10000095 3300013308 Bacteria 88952
115 Ga0157375_10266217 3300013308 Bacteria 1875
116 Ga0157375_10350246 3300013308 Bacteria 1643
117 Ga0157375_10639532 3300013308 Bacteria 1221
118 Ga0157375_10691736 3300013308 Bacteria 1174
119 Ga0163163_10119347 3300014325 Bacteria 2670
120 Ga0163163_10181360 3300014325 Bacteria 2153
121 Ga0163163_10456340 3300014325 Bacteria 1338
122 Ga0157380_10000300 3300014326 Bacteria 29844
123 Ga0157379_10112677 3300014968 Bacteria 2445
124 Ga0157376_10065771 3300014969 Bacteria 3063
125 Ga0157376_10495894 3300014969 Bacteria 1199
126 Ga0163161_10000192 3300017792 Bacteria 56160
127 Ga0163161_10098365 3300017792 Bacteria 2174
128 Ga0206354_11259931 3300020081 Bacteria 1839
129 Ga0207656_10000377 3300025321 Bacteria 14945
130 Ga0207656_10003944 3300025321 Bacteria 5137
131 Ga0207682_10000090 3300025893 Bacteria 41635
132 Ga0207642_10000001 3300025899 Bacteria 714030
133 Ga0207642_10000003 3300025899 Bacteria 650651
134 Ga0207642_10000004 3300025899 Bacteria 407822
135 Ga0207642_10001124 3300025899 Bacteria 8272
136 Ga0207642_10097099 3300025899 Bacteria 1470
137 Ga0207710_10000138 3300025900 Bacteria 83652
138 Ga0207680_10002321 3300025903 Bacteria 8854
139 Ga0207680_10003763 3300025903 Bacteria 7142
140 Ga0207685_10000003 3300025905 Bacteria 344527
141 Ga0207705_10033101 3300025909 Bacteria 3694
142 Ga0207707_10246398 3300025912 Bacteria 1552
143 Ga0207693_10002948 3300025915 Bacteria 14731
144 Ga0207663_10240160 3300025916 Bacteria 1328
145 Ga0207657_10336698 3300025919 Bacteria 1191
146 Ga0207649_10000024 3300025920 Bacteria 183104
147 Ga0207652_10000119 3300025921 Bacteria 86757
148 Ga0207652_10000303 3300025921 Bacteria 50549
149 Ga0207694_10000008 3300025924 Bacteria 484902
150 Ga0207694_10119832 3300025924 Bacteria 2100
151 Ga0207650_10100924 3300025925 Bacteria 2221
152 Ga0207659_10000049 3300025926 Bacteria 82923
153 Ga0207687_10000011 3300025927 Bacteria 388349
154 Ga0207687_10000012 3300025927 Bacteria 370729
155 Ga0207687_10000325 3300025927 Bacteria 32487
156 Ga0207687_10001447 3300025927 Bacteria 16263
157 Ga0207700_10000009 3300025928 Bacteria 314953
158 Ga0207664_10085531 3300025929 Bacteria 2574
159 Ga0207644_10072072 3300025931 Bacteria 2529
160 Ga0207690_10004070 3300025932 Bacteria 8636
161 Ga0207706_10000062 3300025933 Bacteria 109344
162 Ga0207686_10001002 3300025934 Bacteria 16774
163 Ga0207686_10009806 3300025934 Bacteria 5204
164 Ga0207686_10026625 3300025934 Bacteria 3376
165 Ga0207709_10002634 3300025935 Bacteria 11158
166 Ga0207669_10000037 3300025937 Bacteria 77494
167 Ga0207669_10000070 3300025937 Bacteria 51898
168 Ga0207704_10000009 3300025938 Bacteria 198266
169 Ga0207691_10000323 3300025940 Bacteria 47571
170 Ga0207711_10000024 3300025941 Bacteria 293596
171 Ga0207661_10000136 3300025944 Bacteria 46409
172 Ga0207661_10003104 3300025944 Bacteria 11502
173 Ga0207661_10007210 3300025944 Bacteria 7902
174 Ga0207661_10009813 3300025944 Bacteria 6874
175 Ga0207661_10105814 3300025944 Bacteria 2371
176 Ga0207679_10010479 3300025945 Bacteria 5969
177 Ga0207679_10119409 3300025945 Bacteria 2096
178 Ga0207651_10019743 3300025960 Bacteria 4048
179 Ga0207712_10000003 3300025961 Bacteria 615314
180 Ga0207712_10018791 3300025961 Bacteria 4507
181 Ga0207668_10275868 3300025972 Bacteria 1376
182 Ga0207640_10000040 3300025981 Bacteria 106134
183 Ga0207658_10007739 3300025986 Bacteria 7322
184 Ga0207658_10010669 3300025986 Bacteria 6244
185 Ga0207658_10029902 3300025986 Bacteria 3853
186 Ga0207677_10000239 3300026023 Bacteria 42724
187 Ga0207677_10000605 3300026023 Bacteria 22116
188 Ga0207703_10000028 3300026035 Bacteria 208682
189 Ga0207703_10000185 3300026035 Bacteria 72988
190 Ga0207703_10139145 3300026035 Bacteria 2105
191 Ga0207639_10532896 3300026041 Bacteria 1076
192 Ga0207678_10000174 3300026067 Bacteria 54529
193 Ga0207708_10064920 3300026075 Bacteria 2790
194 Ga0207702_10001236 3300026078 Bacteria 25851
195 Ga0207702_10019132 3300026078 Bacteria 5666
196 Ga0207641_10000072 3300026088 Bacteria 151067
197 Ga0207641_10013003 3300026088 Bacteria 6827
198 Ga0207683_10087729 3300026121 Bacteria 2767
199 Ga0207698_10000009 3300026142 Bacteria 281300
200 Ga0207698_10304150 3300026142 Bacteria 1486
201 Ga0268266_10000023 3300028379 Bacteria 501899
202 Ga0268266_10001090 3300028379 Bacteria 34068
203 Ga0268266_10001616 3300028379 Bacteria 26283
204 Ga0268266_10265022 3300028379 Bacteria 1593
205 Ga0268266_10266425 3300028379 Bacteria 1589
206 Ga0268265_10064217 3300028380 Bacteria 2827
207 Ga0265337_1000041 3300028556 Bacteria 56264
208 Ga0265326_10000015 3300028558 Bacteria 159279
209 Ga0265326_10042834 3300028558 Bacteria 1285
210 Ga0265319_1000269 3300028563 Bacteria 39050
211 Ga0265322_10000003 3300028654 Bacteria 468671
212 Ga0265336_10001926 3300028666 Bacteria 8960
213 Ga0265336_10035101 3300028666 Bacteria 1548
214 Ga0265338_10000383 3300028800 Bacteria 79248
215 Ga0265324_10000453 3300029957 Bacteria 28979
216 Ga0265324_10010022 3300029957 Bacteria 3675
217 Ga0307511_10093350 3300030521 Bacteria 2023
218 Ga0265328_10000317 3300031239 Bacteria 22474
219 Ga0265320_10000001 3300031240 Bacteria 847191
220 Ga0265325_10003689 3300031241 Bacteria 9915
221 Ga0265329_10031923 3300031242 Bacteria 1708
222 Ga0265339_10026918 3300031249 Bacteria 3289
223 Ga0265331_10000931 3300031250 Bacteria 23417
224 Ga0265327_10000003 3300031251 Bacteria 852750
225 Ga0265316_10026849 3300031344 Bacteria 4780
226 Ga0265314_10000356 3300031711 Bacteria 63799
227 Ga0373957_0042502 3300035120 Bacteria 1715
228 Ga0451807_0881530 3300041486 Bacteria 3428
229 Ga0451807_2523630 3300041486 Bacteria 1359
230 Ga0451853_2595654 3300041512 Bacteria 2781
231 Ga0466963_0000002 3300044694 Bacteria 108477
232 Ga0466963_0012604 3300044694 Bacteria 5179
233 Ga0466963_0264025 3300044694 Unclassified 1209
234 Ga0466957_0000232 3300044842 Bacteria 26291
235 Ga0466958_0131390 3300045836 Bacteria 1572
236 Ga0466967_0000020 3300045976 Bacteria 78851
237 Ga0466967_0346537 3300045976 Bacteria 1437
238 Ga0495592_0000749 3300046454 Bacteria 22661
239 Ga0495603_0000022 3300046455 Bacteria 64108
240 Ga0495603_0010022 3300046455 Bacteria 5732
241 Ga0495629_0000028 3300046459 Bacteria 127409
242 Ga0495629_0000674 3300046459 Bacteria 27697
243 Ga0495629_0097265 3300046459 Bacteria 2053
244 Ga0495629_0160924 3300046459 Bacteria 1559
245 Ga0495638_0040453 3300046460 Bacteria 2954
246 Ga0495641_0000298 3300046461 Bacteria 39640
247 Ga0495641_0021785 3300046461 Bacteria 3218
248 Ga0495653_0023800 3300046463 Bacteria 4944
249 Ga0495582_0000048 3300046473 Bacteria 60887
250 Ga0495662_0000006 3300046476 Bacteria 79206
251 Ga0495662_0004617 3300046476 Bacteria 6907
252 Ga0495594_0000021 3300046499 Bacteria 74679
253 Ga0495606_0000219 3300046507 Bacteria 101614
254 Ga0495608_0000301 3300046511 Bacteria 34659
255 Ga0495608_0021310 3300046511 Bacteria 4449
256 Ga0495608_0024578 3300046511 Bacteria 4117
257 Ga0495618_0000003 3300046514 Bacteria 256269
258 Ga0495618_0168828 3300046514 Bacteria 1393
259 Ga0495620_0000060 3300046515 Bacteria 95642
260 Ga0495628_0002027 3300046516 Bacteria 18361
261 Ga0495628_0003567 3300046516 Bacteria 13932
262 Ga0495628_0029184 3300046516 Bacteria 4475
263 Ga0495628_0041977 3300046516 Bacteria 3650
264 Ga0495630_0000115 3300046517 Bacteria 63124
265 Ga0495630_0010343 3300046517 Bacteria 6733
266 Ga0495630_0023139 3300046517 Bacteria 4591
267 Ga0495630_0134323 3300046517 Bacteria 1880
268 Ga0495644_0000528 3300046523 Bacteria 16226
269 Ga0495652_0000003 3300046529 Bacteria 597094
270 Ga0495640_0001957 3300046533 Bacteria 16433
271 Ga0495586_0000210 3300046535 Bacteria 39196
272 Ga0495587_0004142 3300046536 Bacteria 9593
273 Ga0495598_0010040 3300046537 Bacteria 2256
274 Ga0495621_0005188 3300046539 Bacteria 3728
275 Ga0495645_0118686 3300046543 Bacteria 1864
276 Ga0495645_0406056 3300046543 Bacteria 867
277 Ga0495622_0000325 3300046557 Bacteria 35075
278 Ga0495667_0000057 3300046559 Bacteria 100656
279 Ga0495656_0000195 3300046615 Bacteria 21694
280 Ga0495634_0000974 3300046642 Bacteria 26986
281 Ga0495634_0003817 3300046642 Bacteria 11969
282 Ga0495634_0049023 3300046642 Bacteria 2841
283 Ga0495635_0000006 3300046663 Bacteria 301820
284 Ga0495635_0040276 3300046663 Bacteria 3229
285 Ga0495588_0000195 3300046674 Bacteria 64337
286 Ga0495657_0000002 3300046675 Bacteria 411958
287 Ga0495657_0037844 3300046675 Bacteria 3322
288 Ga0495599_0026189 3300046678 Bacteria 3654
289 Ga0495646_0077125 3300046680 Bacteria 1950
290 Ga0495647_0000858 3300046681 Bacteria 9100
291 Ga0495647_0001270 3300046681 Bacteria 7775
292 Ga0495658_0000031 3300046683 Bacteria 71165
293 Ga0495658_0207796 3300046683 Bacteria 1222
294 Ga0495669_0000064 3300046684 Bacteria 70549
295 Ga0495669_0018302 3300046684 Bacteria 3011
296 Ga0495613_0000003 3300046689 Bacteria 248826
297 Ga0495613_0117392 3300046689 Bacteria 1913
298 Ga0495613_0128974 3300046689 Bacteria 1812
299 Ga0495624_0000002 3300046690 Bacteria 189957
300 Ga0495624_0000149 3300046690 Bacteria 51112
301 Ga0495624_0006553 3300046690 Bacteria 8249
302 Ga0495670_0004840 3300046691 Bacteria 6611
303 Ga0495649_0005180 3300046694 Bacteria 8358
304 Ga0495600_0001113 3300046809 Bacteria 14646
305 Ga0495600_0011652 3300046809 Bacteria 5484
306 Ga0495604_0000056 3300047317 Bacteria 100110
307 Ga0495604_0098430 3300047317 Bacteria 2155
308 Ga0495674_0000007 3300047319 Bacteria 336257
309 Ga0495672_0087420 3300047320 Bacteria 1721
310 Ga0495676_0001589 3300047321 Bacteria 19708
311 Ga0495676_0084081 3300047321 Bacteria 2402
312 Ga0495680_0000185 3300047322 Bacteria 66139
313 Ga0495680_0000324 3300047322 Bacteria 53748
314 Ga0495680_0001393 3300047322 Bacteria 26081
315 Ga0495680_0031381 3300047322 Bacteria 4326
316 Ga0495680_0083808 3300047322 Bacteria 2403
317 Ga0495675_0000104 3300047444 Bacteria 60748
318 Ga0495679_005000 3300047446 Bacteria 5971
319 Ga0495685_004428 3300047447 Bacteria 4539
320 Ga0495684_0084173 3300047471 Bacteria 2413
321 Ga0495686_0166144 3300047472 Bacteria 1286
322 Ga0495593_0078002 3300047673 Bacteria 1716
323 Ga0495602_0000063 3300048088 Bacteria 104915
324 Ga0495602_0023176 3300048088 Bacteria 6055
325 Ga0495602_0042963 3300048088 Bacteria 4114
326 Ga0495602_0177795 3300048088 Bacteria 1644
327 Ga0496100_0000004 3300048903 Bacteria 321778
328 Ga0496100_0000027 3300048903 Bacteria 115829
329 Ga0496101_0000007 3300048904 Bacteria 321778
330 Ga0496101_0000012 3300048904 Bacteria 268127
331 Ga0496102_0000533 3300048905 Bacteria 41239
332 Ga0496102_0215817 3300048905 Bacteria 1808
333 Ga0496103_0000001 3300048906 Bacteria 643471
334 Ga0496103_0104391 3300048906 Bacteria 1796
335 Ga0496104_0000002 3300048907 Bacteria 686017
336 Ga0496104_0000003 3300048907 Bacteria 669219
337 Ga0496104_0000243 3300048907 Bacteria 48237
338 Ga0496105_0000001 3300048908 Bacteria 1328178
339 Ga0496105_0000008 3300048908 Bacteria 335652
340 Ga0496105_0000622 3300048908 Bacteria 23722
341 Ga0496105_0027357 3300048908 Bacteria 4658
342 Ga0496106_0000004 3300048909 Bacteria 279896
343 Ga0496106_0000020 3300048909 Bacteria 169168
344 Ga0496106_0000096 3300048909 Bacteria 67122
345 Ga0496106_0316147 3300048909 Bacteria 1253
346 Ga0496107_0000001 3300048910 Bacteria 321778
347 Ga0496107_0000014 3300048910 Bacteria 176738
348 Ga0496107_0054505 3300048910 Bacteria 2886
349 Ga0496107_0105292 3300048910 Bacteria 2071
350 Ga0496108_0000002 3300048911 Bacteria 700890
351 Ga0496108_0000012 3300048911 Bacteria 258433
352 Ga0496108_0000795 3300048911 Bacteria 24608
353 Ga0496108_0007459 3300048911 Bacteria 8866
354 Ga0496109_0000001 3300048912 Bacteria 700852
355 Ga0496109_0000035 3300048912 Bacteria 159744
356 Ga0496109_0000057 3300048912 Bacteria 120274
357 Ga0496109_0000058 3300048912 Bacteria 118556
358 Ga0496109_0099399 3300048912 Bacteria 2698
359 Ga0496110_0000170 3300048913 Bacteria 39947
360 Ga0496110_0003956 3300048913 Bacteria 11398
361 Ga0496110_0064445 3300048913 Bacteria 3239
362 Ga0496110_0188650 3300048913 Bacteria 1872
363 Ga0496111_0000001 3300048914 Bacteria 194837
364 Ga0496111_0125460 3300048914 Bacteria 1897
365 Ga0496111_0204560 3300048914 Bacteria 1467
366 Ga0496112_0000002 3300048915 Bacteria 782039
367 Ga0496112_0009465 3300048915 Bacteria 8781
368 Ga0496112_0085741 3300048915 Bacteria 3116
369 Ga0496113_0000010 3300048916 Bacteria 86561
370 Ga0496113_0012576 3300048916 Bacteria 5693
371 Ga0496113_0029642 3300048916 Bacteria 3955
372 Ga0496114_0000080 3300048917 Bacteria 68701
373 Ga0496114_0087006 3300048917 Bacteria 2649
374 Ga0496114_0162632 3300048917 Bacteria 1942
375 Ga0496114_0395680 3300048917 Bacteria 1224
376 Ga0496115_0000004 3300048918 Bacteria 319734
377 Ga0496115_0000104 3300048918 Bacteria 79824
378 Ga0496116_0000500 3300048919 Bacteria 53809
379 Ga0496116_0145244 3300048919 Bacteria 1327
380 Ga0496117_0001638 3300048920 Bacteria 31520
381 Ga0496117_0175804 3300048920 Bacteria 1237
382 Ga0496118_0001976 3300048921 Bacteria 29112
383 Ga0496118_0162191 3300048921 Bacteria 1380
384 Ga0496119_0001539 3300048922 Bacteria 27538
385 Ga0496119_0022615 3300048922 Bacteria 4492
386 Ga0496119_0025847 3300048922 Bacteria 4089
387 Ga0496119_0087729 3300048922 Bacteria 1775
388 Ga0496119_0095568 3300048922 Bacteria 1678
389 Ga0496120_0000528 3300048923 Bacteria 59001
390 Ga0496120_0084417 3300048923 Bacteria 1712
391 Ga0496121_0004909 3300048924 Bacteria 17553
392 Ga0496121_0033008 3300048924 Bacteria 4694
393 Ga0496124_0038160 3300048927 Bacteria 4172
394 Ga0496124_0220159 3300048927 Bacteria 1428
395 Ga0496124_0417140 3300048927 Bacteria 926
396 Ga0496125_0073869 3300048928 Bacteria 2648
397 Ga0496125_0131065 3300048928 Bacteria 1765
398 Ga0496126_0006214 3300048929 Bacteria 13364
399 Ga0496126_0015574 3300048929 Bacteria 7641
400 Ga0496126_0044024 3300048929 Bacteria 4113
401 Ga0501031_0000326 3300049568 Bacteria 27423
402 Ga0501032_0000701 3300049569 Bacteria 27295
403 Ga0501033_0000890 3300049570 Bacteria 27318
404 Ga0501034_0002987 3300049571 Bacteria 19578
405 Ga0501036_0000131 3300049572 Bacteria 48019
406 Ga0501037_0000621 3300049573 Bacteria 27506
407 Ga0501038_0000835 3300049574 Bacteria 27413
408 Ga0501042_0014841 3300049578 Bacteria 5322
409 Ga0501043_0000841 3300049579 Bacteria 27283
410 Ga0501043_0280769 3300049579 Bacteria 1276
411 Ga0501046_0001019 3300049580 Bacteria 27339
412 Ga0501047_0000177 3300049581 Bacteria 78448
413 Ga0501047_0001093 3300049581 Bacteria 26985
414 Ga0501048_0000094 3300049582 Bacteria 48036
415 Ga0501068_0009320 3300049584 Bacteria 5489
416 Ga0501069_0003674 3300049585 Bacteria 7897
417 Ga0501069_0005225 3300049585 Bacteria 6748
418 Ga0501070_0000184 3300049586 Bacteria 58715
419 Ga0501070_0005259 3300049586 Bacteria 11036
420 Ga0501070_0023596 3300049586 Bacteria 5154
421 Ga0501070_0471454 3300049586 Bacteria 1010
422 Ga0501071_0129846 3300049587 Bacteria 1871
423 Ga0501072_0181685 3300049588 Bacteria 1678
424 Ga0501072_0546427 3300049588 Bacteria 915
425 Ga0501073_0010593 3300049589 Bacteria 6745
426 Ga0501074_0004638 3300049590 Bacteria 9843
427 Ga0501074_0097407 3300049590 Bacteria 2105
428 Ga0501074_0103775 3300049590 Bacteria 2035
429 Ga0501075_0004618 3300049591 Bacteria 9344
430 Ga0501075_0289639 3300049591 Bacteria 1248
431 Ga0501079_0009133 3300049741 Bacteria 7505
432 Ga0501079_0013430 3300049741 Bacteria 6246
433 Ga0501080_0087516 3300049742 Bacteria 2894
434 Ga0501083_0000414 3300049744 Bacteria 27277
435 Ga0501083_0010953 3300049744 Bacteria 6376
436 Ga0501035_0006508 3300049822 Bacteria 10974
437 Ga0501035_0253168 3300049822 Bacteria 1495
438 Ga0501044_0001862 3300049823 Bacteria 24452
439 Ga0501044_0111608 3300049823 Bacteria 2741
440 Ga0501044_0585665 3300049823 Bacteria 1010
441 Ga0501045_0072891 3300049824 Bacteria 2528
442 Ga0501045_0310436 3300049824 Bacteria 1174
443 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
444 nmdc:mga0a205_5429_c1 3300050515 Bacteria 11491
445 Ga0495601_0000246 3300053077 Bacteria 28887
446 Ga0495601_0017636 3300053077 Bacteria 4336
447 Ga0495601_0036328 3300053077 Bacteria 3076
448 Ga0495601_0086343 3300053077 Bacteria 2016
449 Ga0495612_0001971 3300053078 Bacteria 8452
450 Ga0495612_0012977 3300053078 Bacteria 3356
451 Ga0495612_0042441 3300053078 Bacteria 1856
452 Ga0495655_0000012 3300053083 Bacteria 92485
453 Ga0495595_0000001 3300053084 Bacteria 495226
454 Ga0495595_0000084 3300053084 Bacteria 45392
455 Ga0495619_0000018 3300053085 Bacteria 209943
456 Ga0495619_0000041 3300053085 Bacteria 112824
457 Ga0495619_0000094 3300053085 Bacteria 67416
458 Ga0495619_0000745 3300053085 Bacteria 21209
459 Ga0495619_0001141 3300053085 Bacteria 17453
460 Ga0495619_0025976 3300053085 Bacteria 3765
461 Ga0500566_0010766 3300053094 Bacteria 5391
462 Ga0500641_0006108 3300053096 Bacteria 4269
463 Ga0500595_035468 3300053119 Bacteria 1642
464 Ga0500614_000483 3300053123 Bacteria 10349
465 Ga0500628_000014 3300053129 Bacteria 102838
466 Ga0500658_0016258 3300053134 Bacteria 2771
467 Ga0501082_0005208 3300060353 Bacteria 11305
468 Ga0530510_0561944 3300061734 Bacteria 867
469 Ga0501076_0031182
470 JGI24746J21847_1000342
471 JGI24740J21852_10002918
472 JGI24748J21848_1000384
473 JGI24034J26672_10000353
474 rootH2_10175980
475 Ga0070658_10039587
476 Ga0070683_100000207
477 Ga0070683_100031889
478 Ga0070683_100145395
479 Ga0070683_100293409
480 Ga0070690_100101432
481 Ga0070670_100093250
482 Ga0070677_10000019
483 Ga0070666_10012209
484 Ga0070666_10021591
485 Ga0070680_100537719
486 Ga0070682_100000038
487 Ga0070682_100000040
488 Ga0070682_100146084
489 Ga0068868_100000175
490 Ga0068868_100002533
491 Ga0070691_10000098
492 Ga0070691_10007033
493 Ga0070661_100000052
494 Ga0070668_100506305
495 Ga0070675_100000008
496 Ga0070671_100108004
497 Ga0070674_100000016
498 Ga0070674_100000105
499 Ga0070673_100004686
500 Ga0070688_100000151
501 Ga0070688_100000258
502 Ga0070667_100026099
503 Ga0070714_100210561
504 Ga0070713_100000055
505 Ga0070700_100011612
506 Ga0070700_100052817
507 Ga0070663_100000101
508 Ga0070678_100332482
509 Ga0070662_100000015
510 Ga0070685_10000092
511 Ga0070685_10000360
512 Ga0070679_100000156
513 Ga0070679_100000784
514 Ga0070679_100282042
515 Ga0070684_100001385
516 Ga0070684_100020009
517 Ga0070684_100021991
518 Ga0070684_100044565
519 Ga0070684_100412264
520 Ga0068853_100022191
521 Ga0070672_100000036
522 Ga0070686_100124532
523 Ga0070695_100295246
524 Ga0070693_100003601
525 Ga0070665_100000128
526 Ga0070665_100002491
527 Ga0070665_100070049
528 Ga0070665_100309719
529 Ga0070664_100005631
530 Ga0068854_100000123
531 Ga0068856_100003489
532 Ga0068856_100036766
533 Ga0068856_100664037
534 Ga0068852_100000195
535 Ga0068866_10000006
536 Ga0068866_10000220
537 Ga0068866_10016642
538 Ga0068861_100535186
539 Ga0068851_10000138
540 Ga0068851_10016790
541 Ga0068863_100000039
542 Ga0068863_100018094
543 Ga0068858_100000350
544 Ga0068858_100003595
545 Ga0068858_100417740
546 Ga0068860_100001352
547 Ga0068862_100002457
548 Ga0081455_10019516
549 Ga0081455_10070831
550 Ga0081540_1000419
551 Ga0081539_10000615
552 Ga0070715_10000003
553 Ga0070712_100000142
554 Ga0075431_100087667
555 Ga0075433_10000307
556 Ga0075433_10003841
557 Ga0068865_100000009
558 Ga0105245_10000012
559 Ga0105245_10000067
560 Ga0105245_10000246
561 Ga0105245_10137444
562 Ga0105247_10000110
563 Ga0105247_10247032
564 Ga0105242_10000010
565 Ga0105242_10000904
566 Ga0105242_10256676
567 Ga0105248_10000307
568 Ga0105238_10000014
569 Ga0105238_10317327
570 Ga0105249_10000159
571 Ga0105249_10035006
572 Ga0105249_10347919
573 Ga0105249_10520326
574 Ga0157371_10006368
575 Ga0157370_10007054
576 Ga0157370_10024314
577 Ga0157369_10000222
578 Ga0157374_10110668
579 Ga0157374_10113022
580 Ga0157378_10009467
581 Ga0157372_10000150
582 Ga0157375_10000095
583 Ga0157375_10266217
584 Ga0157375_10350246
585 Ga0157375_10639532
586 Ga0157375_10691736
587 Ga0163163_10119347
588 Ga0163163_10181360
589 Ga0163163_10456340
590 Ga0157380_10000300
591 Ga0157379_10112677
592 Ga0157376_10065771
593 Ga0157376_10495894
594 Ga0163161_10000192
595 Ga0163161_10098365
596 Ga0206354_11259931
597 Ga0207656_10000377
598 Ga0207656_10003944
599 Ga0207682_10000090
600 Ga0207642_10000001
601 Ga0207642_10000003
602 Ga0207642_10000004
603 Ga0207642_10001124
604 Ga0207642_10097099
605 Ga0207710_10000138
606 Ga0207680_10002321
607 Ga0207680_10003763
608 Ga0207685_10000003
609 Ga0207705_10033101
610 Ga0207707_10246398
611 Ga0207693_10002948
612 Ga0207663_10240160
613 Ga0207657_10336698
614 Ga0207649_10000024
615 Ga0207652_10000119
616 Ga0207652_10000303
617 Ga0207694_10000008
618 Ga0207694_10119832
619 Ga0207650_10100924
620 Ga0207659_10000049
621 Ga0207687_10000011
622 Ga0207687_10000012
623 Ga0207687_10000325
624 Ga0207687_10001447
625 Ga0207700_10000009
626 Ga0207664_10085531
627 Ga0207644_10072072
628 Ga0207690_10004070
629 Ga0207706_10000062
630 Ga0207686_10001002
631 Ga0207686_10009806
632 Ga0207686_10026625
633 Ga0207709_10002634
634 Ga0207669_10000037
635 Ga0207669_10000070
636 Ga0207704_10000009
637 Ga0207691_10000323
638 Ga0207711_10000024
639 Ga0207661_10000136
640 Ga0207661_10003104
641 Ga0207661_10007210
642 Ga0207661_10009813
643 Ga0207661_10105814
644 Ga0207679_10010479
645 Ga0207679_10119409
646 Ga0207651_10019743
647 Ga0207712_10000003
648 Ga0207712_10018791
649 Ga0207668_10275868
650 Ga0207640_10000040
651 Ga0207658_10007739
652 Ga0207658_10010669
653 Ga0207658_10029902
654 Ga0207677_10000239
655 Ga0207677_10000605
656 Ga0207703_10000028
657 Ga0207703_10000185
658 Ga0207703_10139145
659 Ga0207639_10532896
660 Ga0207678_10000174
661 Ga0207708_10064920
662 Ga0207702_10001236
663 Ga0207702_10019132
664 Ga0207641_10000072
665 Ga0207641_10013003
666 Ga0207683_10087729
667 Ga0207698_10000009
668 Ga0207698_10304150
669 Ga0268266_10000023
670 Ga0268266_10001090
671 Ga0268266_10001616
672 Ga0268266_10265022
673 Ga0268266_10266425
674 Ga0268265_10064217
675 Ga0265337_1000041
676 Ga0265326_10000015
677 Ga0265326_10042834
678 Ga0265319_1000269
679 Ga0265322_10000003
680 Ga0265336_10001926
681 Ga0265336_10035101
682 Ga0265338_10000383
683 Ga0265324_10000453
684 Ga0265324_10010022
685 Ga0307511_10093350
686 Ga0265328_10000317
687 Ga0265320_10000001
688 Ga0265325_10003689
689 Ga0265329_10031923
690 Ga0265339_10026918
691 Ga0265331_10000931
692 Ga0265327_10000003
693 Ga0265316_10026849
694 Ga0265314_10000356
695 Ga0373957_0042502
696 Ga0451807_0881530
697 Ga0451807_2523630
698 Ga0451853_2595654
699 Ga0466963_0000002
700 Ga0466963_0012604
701 Ga0466963_0264025
702 Ga0466957_0000232
703 Ga0466958_0131390
704 Ga0466967_0000020
705 Ga0466967_0346537
706 Ga0495592_0000749
707 Ga0495603_0000022
708 Ga0495603_0010022
709 Ga0495629_0000028
710 Ga0495629_0000674
711 Ga0495629_0097265
712 Ga0495629_0160924
713 Ga0495638_0040453
714 Ga0495641_0000298
715 Ga0495641_0021785
716 Ga0495653_0023800
717 Ga0495582_0000048
718 Ga0495662_0000006
719 Ga0495662_0004617
720 Ga0495594_0000021
721 Ga0495606_0000219
722 Ga0495608_0000301
723 Ga0495608_0021310
724 Ga0495608_0024578
725 Ga0495618_0000003
726 Ga0495618_0168828
727 Ga0495620_0000060
728 Ga0495628_0002027
729 Ga0495628_0003567
730 Ga0495628_0029184
731 Ga0495628_0041977
732 Ga0495630_0000115
733 Ga0495630_0010343
734 Ga0495630_0023139
735 Ga0495630_0134323
736 Ga0495644_0000528
737 Ga0495652_0000003
738 Ga0495640_0001957
739 Ga0495586_0000210
740 Ga0495587_0004142
741 Ga0495598_0010040
742 Ga0495621_0005188
743 Ga0495645_0118686
744 Ga0495645_0406056
745 Ga0495622_0000325
746 Ga0495667_0000057
747 Ga0495656_0000195
748 Ga0495634_0000974
749 Ga0495634_0003817
750 Ga0495634_0049023
751 Ga0495635_0000006
752 Ga0495635_0040276
753 Ga0495588_0000195
754 Ga0495657_0000002
755 Ga0495657_0037844
756 Ga0495599_0026189
757 Ga0495646_0077125
758 Ga0495647_0000858
759 Ga0495647_0001270
760 Ga0495658_0000031
761 Ga0495658_0207796
762 Ga0495669_0000064
763 Ga0495669_0018302
764 Ga0495613_0000003
765 Ga0495613_0117392
766 Ga0495613_0128974
767 Ga0495624_0000002
768 Ga0495624_0000149
769 Ga0495624_0006553
770 Ga0495670_0004840
771 Ga0495649_0005180
772 Ga0495600_0001113
773 Ga0495600_0011652
774 Ga0495604_0000056
775 Ga0495604_0098430
776 Ga0495674_0000007
777 Ga0495672_0087420
778 Ga0495676_0001589
779 Ga0495676_0084081
780 Ga0495680_0000185
781 Ga0495680_0000324
782 Ga0495680_0001393
783 Ga0495680_0031381
784 Ga0495680_0083808
785 Ga0495675_0000104
786 Ga0495679_005000
787 Ga0495685_004428
788 Ga0495684_0084173
789 Ga0495686_0166144
790 Ga0495593_0078002
791 Ga0495602_0000063
792 Ga0495602_0023176
793 Ga0495602_0042963
794 Ga0495602_0177795
795 Ga0496100_0000004
796 Ga0496100_0000027
797 Ga0496101_0000007
798 Ga0496101_0000012
799 Ga0496102_0000533
800 Ga0496102_0215817
801 Ga0496103_0000001
802 Ga0496103_0104391
803 Ga0496104_0000002
804 Ga0496104_0000003
805 Ga0496104_0000243
806 Ga0496105_0000001
807 Ga0496105_0000008
808 Ga0496105_0000622
809 Ga0496105_0027357
810 Ga0496106_0000004
811 Ga0496106_0000020
812 Ga0496106_0000096
813 Ga0496106_0316147
814 Ga0496107_0000001
815 Ga0496107_0000014
816 Ga0496107_0054505
817 Ga0496107_0105292
818 Ga0496108_0000002
819 Ga0496108_0000012
820 Ga0496108_0000795
821 Ga0496108_0007459
822 Ga0496109_0000001
823 Ga0496109_0000035
824 Ga0496109_0000057
825 Ga0496109_0000058
826 Ga0496109_0099399
827 Ga0496110_0000170
828 Ga0496110_0003956
829 Ga0496110_0064445
830 Ga0496110_0188650
831 Ga0496111_0000001
832 Ga0496111_0125460
833 Ga0496111_0204560
834 Ga0496112_0000002
835 Ga0496112_0009465
836 Ga0496112_0085741
837 Ga0496113_0000010
838 Ga0496113_0012576
839 Ga0496113_0029642
840 Ga0496114_0000080
841 Ga0496114_0087006
842 Ga0496114_0162632
843 Ga0496114_0395680
844 Ga0496115_0000004
845 Ga0496115_0000104
846 Ga0496116_0000500
847 Ga0496116_0145244
848 Ga0496117_0001638
849 Ga0496117_0175804
850 Ga0496118_0001976
851 Ga0496118_0162191
852 Ga0496119_0001539
853 Ga0496119_0022615
854 Ga0496119_0025847
855 Ga0496119_0087729
856 Ga0496119_0095568
857 Ga0496120_0000528
858 Ga0496120_0084417
859 Ga0496121_0004909
860 Ga0496121_0033008
861 Ga0496124_0038160
862 Ga0496124_0220159
863 Ga0496124_0417140
864 Ga0496125_0073869
865 Ga0496125_0131065
866 Ga0496126_0006214
867 Ga0496126_0015574
868 Ga0496126_0044024
869 Ga0501031_0000326
870 Ga0501032_0000701
871 Ga0501033_0000890
872 Ga0501034_0002987
873 Ga0501036_0000131
874 Ga0501037_0000621
875 Ga0501038_0000835
876 Ga0501042_0014841
877 Ga0501043_0000841
878 Ga0501043_0280769
879 Ga0501046_0001019
880 Ga0501047_0000177
881 Ga0501047_0001093
882 Ga0501048_0000094
883 Ga0501068_0009320
884 Ga0501069_0003674
885 Ga0501069_0005225
886 Ga0501070_0000184
887 Ga0501070_0005259
888 Ga0501070_0023596
889 Ga0501070_0471454
890 Ga0501071_0129846
891 Ga0501072_0181685
892 Ga0501072_0546427
893 Ga0501073_0010593
894 Ga0501074_0004638
895 Ga0501074_0097407
896 Ga0501074_0103775
897 Ga0501075_0004618
898 Ga0501075_0289639
899 Ga0501079_0009133
900 Ga0501079_0013430
901 Ga0501080_0087516
902 Ga0501083_0000414
903 Ga0501083_0010953
904 Ga0501035_0006508
905 Ga0501035_0253168
906 Ga0501044_0001862
907 Ga0501044_0111608
908 Ga0501044_0585665
909 Ga0501045_0072891
910 Ga0501045_0310436
911 nmdc:mga0a205_1_c2
912 nmdc:mga0a205_5429_c1
913 Ga0495601_0000246
914 Ga0495601_0017636
915 Ga0495601_0036328
916 Ga0495601_0086343
917 Ga0495612_0001971
918 Ga0495612_0012977
919 Ga0495612_0042441
920 Ga0495655_0000012
921 Ga0495595_0000001
922 Ga0495595_0000084
923 Ga0495619_0000018
924 Ga0495619_0000041
925 Ga0495619_0000094
926 Ga0495619_0000745
927 Ga0495619_0001141
928 Ga0495619_0025976
929 Ga0500566_0010766
930 Ga0500641_0006108
931 Ga0500595_035468
932 Ga0500614_000483
933 Ga0500628_000014
934 Ga0500658_0016258
935 Ga0501082_0005208
936 Ga0530510_0561944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

264

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpq-assembly1.cif.gz_A crystal structure of ctde in complex with fad 0.9682 1 30
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9676 2 29
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9672 2 30
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9659 2 30
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9429 2 32
ID Description Score Start End Superfamily
af_P77337_1_424_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9279 2 29 3.50.50.60
3ihgC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9138 2 29 3.50.50.60
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9035 2 29 3.50.50.60
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.885 1 30 3.50.50.60
2vouC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8844 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A858RJT1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9128 2 56 GO:0016616
GO:0030497
AF-A0A357CVY4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9055 2 61 GO:0016616
AF-A0A353KDK4-F1-model_v4 deleted 0.8951 2 60
AF-A0A414LVQ2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.885 2 62 GO:0016616
AF-A0A538BTA0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.8831 1 61 GO:0050577

Map