F450147

General Info

Members Datasets Scaffolds Average Seq Length
468 288 936 440

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606384|2808973292
Length 490
Sequence IFSRTPRAAAWRVAMAAGVVAAAAALAWPALGASQDAVAVKPVPASSGVTAAPLAASAAAVAAPAAGHDAARAELLKRGEYLARAGDCIACHSAPNGKPFAGGLKFDTPIGAIYSTNITPDAKTGIGGWRFEDFDRAVRAGVRKNGDTLYPAMPYPSYARLSEEDVRAMYAYFSQGVAPVEQPNRAVDIVWPLSMRWPLAIWRKLYAPAPKPFEAASYADPVLARGAYLVQGLGHCGACHTPRAPTMQERALGDADGSDFLAGGAAIDGWVPTSLRGEPRTGLGTWSEQEIVRFLKTGRNLHTAAFGGMTDVVDHSMQYLSDADLSAIARYLKSLPPRASGETAYAYDDAAAQALRAGDAKRPGASVYVDNCMACHRSDGRGYTRVFPALGGNPVVQGADPTSLIHVVLEGAALNGTHEAPSSFTMPPFGWRLSDQEVADVANFVRTSWGNTGSTVTAAQVAKLRRAYPGKRPDAPPGADFARPSASRTN

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
175 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
176 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
177 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
178 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
179 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
180 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
181 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
182 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
183 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
184 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
185 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
186 2519103095 Burkholderia sp. KJ006 Isolate Nodule
187 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
188 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
189 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
190 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
191 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
192 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
193 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
194 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
195 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
196 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
197 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
198 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
199 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
200 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
201 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
202 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
203 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
204 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
205 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
206 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
207 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
208 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
209 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
210 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
211 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
212 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
213 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
214 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
215 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
216 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
217 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
218 2818991446 Variovorax sp. 1180 Isolate Unclassified
219 2818991452 Burkholderia cepacia 561 Isolate Unclassified
220 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
221 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
222 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
223 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
224 2847085930 Erwinia persicina B64 Isolate Bulb
225 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
226 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
227 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
228 2865014394 Pantoea sp. R-71966 Isolate Unclassified
229 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
230 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
231 2876601092 Pantoea endophytica 596 Isolate Unclassified
232 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
233 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
234 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
235 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
236 2899924645 Variovorax sp. 369 Isolate Unclassified
237 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
238 2904504865 Serratia marcescens 1822 Isolate Unclassified
239 2904564687 Burkholderia sp. 571 Isolate Unclassified
240 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
241 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
242 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
243 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
244 2928037797 Variovorax sp. 1126 Isolate Unclassified
245 2928044640 Variovorax sp. 1128 Isolate Unclassified
246 2928051484 Variovorax sp. 1133 Isolate Unclassified
247 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
248 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
249 2928163908 Burkholderia sp. 567 Isolate Unclassified
250 2928170801 Burkholderia sp. 572 Isolate Unclassified
251 2928536128 Burkholderia sola 565 Isolate Unclassified
252 2932406140 Serratia sp. 2723 Isolate Rhizosphere
253 2937967321 Serratia sp. YC16 Isolate Unclassified
254 2939577877 Serratia sp. 509 Isolate Rhizosphere
255 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
256 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
257 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
258 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
259 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
260 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
261 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
262 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
263 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
264 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
265 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
266 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
267 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
268 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
269 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
270 640753048 Serratia proteamaculans 568 Isolate Endosphere
271 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
272 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
273 8004592986 Serratia sp. S119 Isolate Unclassified
274 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
275 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
276 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
277 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
278 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
279 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
280 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
281 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
282 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
283 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
284 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
285 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
286 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
287 8052494512 Pseudomonas putida LD6 Isolate Unclassified
288 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.85
Metatranscriptomes 0
Isolates 24.15

Biome Distribution

Category Percentage (%)
Aerial Root 1.07
Bulb 0.21
Endosphere 14.53
Nodule 1.71
Rhizoplane 4.06
Rhizosphere 55.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000600 3300001989 Bacteria 12983
2 JGI25156J39149_1000645 3300002705 Bacteria 19046
3 JGI25162J39368_1003138 3300002737 Bacteria 5207
4 Ga0055532_1000797 3300003758 Bacteria 10905
5 Ga0055532_1001574 3300003758 Bacteria 6085
6 Ga0055532_1001993 3300003758 Bacteria 4745
7 Ga0055527_1000083 3300003760 Bacteria 74444
8 Ga0055527_1000782 3300003760 Bacteria 8677
9 Ga0055535_1000093 3300003761 Bacteria 97771
10 Ga0055535_1000100 3300003761 Bacteria 93240
11 Ga0055535_1000182 3300003761 Bacteria 66852
12 Ga0055542_1000073 3300003762 Bacteria 145255
13 Ga0055542_1000106 3300003762 Bacteria 112713
14 Ga0055529_1000124 3300003763 Bacteria 112731
15 Ga0055526_1003445 3300003771 Bacteria 10035
16 Ga0055526_1004440 3300003771 Bacteria 8425
17 Ga0055537_1000395 3300003773 Bacteria 29266
18 Ga0055536_1010078 3300003781 Bacteria 3804
19 Ga0055536_1010080 3300003781 Bacteria 3804
20 Ga0055534_1000030 3300003784 Bacteria 121396
21 Ga0055528_1001256 3300003790 Bacteria 16084
22 Ga0055528_1003823 3300003790 Bacteria 7409
23 Ga0055530_10000021 3300003791 Bacteria 139383
24 Ga0055530_10000519 3300003791 Bacteria 33347
25 Ga0055540_1003000 3300003792 Bacteria 8446
26 Ga0055531_10013598 3300003794 Bacteria 3737
27 Ga0055531_10032330 3300003794 Bacteria 1711
28 Ga0058692_1000039 3300003856 Bacteria 133315
29 Ga0058692_1000096 3300003856 Bacteria 59941
30 Ga0058692_1000221 3300003856 Bacteria 33587
31 Ga0058692_1000575 3300003856 Bacteria 15598
32 Ga0058692_1002452 3300003856 Bacteria 6212
33 Ga0058692_1004768 3300003856 Bacteria 3964
34 Ga0058692_1018839 3300003856 Bacteria 1483
35 Ga0065703_1019383 3300005272 Bacteria 3061
36 Ga0065704_10071486 3300005289 Bacteria 10959
37 Ga0070658_10147733 3300005327 Bacteria 1967
38 Ga0070660_100000002 3300005339 Bacteria 177777
39 Ga0070668_100007954 3300005347 Bacteria 7876
40 Ga0070669_100196328 3300005353 Bacteria 1586
41 Ga0070659_100000007 3300005366 Bacteria 204358
42 Ga0070663_100002294 3300005455 Bacteria 10732
43 Ga0070662_100015571 3300005457 Bacteria 5096
44 Ga0070665_100146941 3300005548 Bacteria 2360
45 Ga0068855_100030340 3300005563 Bacteria 6467
46 Ga0068852_100005330 3300005616 Bacteria 9183
47 Ga0068851_10028415 3300005834 Bacteria 2763
48 Ga0075364_10048143 3300006051 Bacteria 2778
49 Ga0099823_1001983 3300006944 Bacteria 17933
50 Ga0079104_1002106 3300006946 Bacteria 11388
51 Ga0105251_10000095 3300009011 Bacteria 85705
52 Ga0105251_10000425 3300009011 Bacteria 41003
53 Ga0105251_10000638 3300009011 Bacteria 32168
54 Ga0105251_10002425 3300009011 Bacteria 14695
55 Ga0105251_10003450 3300009011 Bacteria 11476
56 Ga0105251_10042975 3300009011 Bacteria 2190
57 Ga0105244_10000585 3300009036 Bacteria 32701
58 Ga0105244_10001135 3300009036 Bacteria 22141
59 Ga0105244_10001418 3300009036 Bacteria 19417
60 Ga0105244_10003711 3300009036 Bacteria 10779
61 Ga0105244_10022437 3300009036 Bacteria 3474
62 Ga0105244_10029528 3300009036 Bacteria 2929
63 Ga0105244_10042451 3300009036 Bacteria 2351
64 Ga0105250_10000021 3300009092 Bacteria 239960
65 Ga0105250_10011907 3300009092 Bacteria 3604
66 Ga0105240_10000600 3300009093 Bacteria 66883
67 Ga0105247_10000048 3300009101 Bacteria 150745
68 Ga0105243_10012818 3300009148 Bacteria 6334
69 Ga0105241_10000011 3300009174 Bacteria 243033
70 Ga0105237_10046755 3300009545 Bacteria 4353
71 Ga0105237_10103757 3300009545 Bacteria 2835
72 Ga0105238_10045683 3300009551 Bacteria 4424
73 Ga0105246_10002608 3300011119 Bacteria 10908
74 Ga0105246_10011247 3300011119 Bacteria 5551
75 Ga0157373_10003739 3300013100 Bacteria 11511
76 Ga0157373_10004957 3300013100 Bacteria 10006
77 Ga0157373_10094497 3300013100 Bacteria 2105
78 Ga0157371_10004133 3300013102 Bacteria 12800
79 Ga0157371_10014190 3300013102 Bacteria 6023
80 Ga0157370_10000120 3300013104 Bacteria 91793
81 Ga0157370_10008002 3300013104 Bacteria 11458
82 Ga0157369_10010152 3300013105 Bacteria 10746
83 Ga0157369_10031881 3300013105 Bacteria 5799
84 Ga0157369_10176442 3300013105 Bacteria 2249
85 Ga0157372_10015558 3300013307 Bacteria 8154
86 Ga0157372_10022837 3300013307 Bacteria 6774
87 Ga0157372_10121755 3300013307 Bacteria 2997
88 Ga0157372_10136483 3300013307 Bacteria 2825
89 Ga0157372_10136592 3300013307 Bacteria 2824
90 Ga0182008_10002600 3300014497 Bacteria 11216
91 Ga0182008_10058430 3300014497 Bacteria 1904
92 Ga0182006_1033717 3300015261 Bacteria 2051
93 Ga0182007_10030276 3300015262 Bacteria 1851
94 Ga0163161_10000005 3300017792 Bacteria 327860
95 Ga0209566_100962 3300025225 Bacteria 12849
96 Ga0209674_103476 3300025226 Bacteria 2879
97 Ga0209672_100015 3300025228 Bacteria 529352
98 Ga0209672_100031 3300025228 Bacteria 332889
99 Ga0209672_100201 3300025228 Bacteria 47243
100 Ga0209147_100016 3300025229 Bacteria 527606
101 Ga0209147_100034 3300025229 Bacteria 346646
102 Ga0209147_100040 3300025229 Bacteria 307612
103 Ga0209147_102857 3300025229 Bacteria 3823
104 Ga0209437_100100 3300025233 Bacteria 228479
105 Ga0209258_100026 3300025242 Bacteria 527606
106 Ga0209258_100061 3300025242 Bacteria 313501
107 Ga0209258_100069 3300025242 Bacteria 280496
108 Ga0209148_1000070 3300025254 Bacteria 332889
109 Ga0209148_1000076 3300025254 Bacteria 301449
110 Ga0209148_1001137 3300025254 Bacteria 15551
111 Ga0209759_1000052 3300025256 Bacteria 213964
112 Ga0209565_1000024 3300025263 Bacteria 379907
113 Ga0209455_1000069 3300025272 Bacteria 308247
114 Ga0209455_1000358 3300025272 Bacteria 42672
115 Ga0209673_1000026 3300025273 Bacteria 373739
116 Ga0209673_1001717 3300025273 Bacteria 18512
117 Ga0209675_1000107 3300025291 Bacteria 119593
118 Ga0209676_1000011 3300025292 Bacteria 860463
119 Ga0209676_1000442 3300025292 Bacteria 70671
120 Ga0209676_1000752 3300025292 Bacteria 43942
121 Ga0209676_1002346 3300025292 Bacteria 13683
122 Ga0209564_1002932 3300025295 Bacteria 12394
123 Ga0209050_1000032 3300025298 Bacteria 456335
124 Ga0209050_1000069 3300025298 Bacteria 297615
125 Ga0209256_1002137 3300025299 Bacteria 17087
126 Ga0209256_1015200 3300025299 Bacteria 2708
127 Ga0209051_1001088 3300025303 Bacteria 25185
128 Ga0209051_1001874 3300025303 Bacteria 16510
129 Ga0209257_1000014 3300025304 Bacteria 946850
130 Ga0209257_1000194 3300025304 Bacteria 150624
131 Ga0209257_1009404 3300025304 Bacteria 5249
132 Ga0207656_10090452 3300025321 Bacteria 1389
133 Ga0207696_1000006 3300025711 Bacteria 616498
134 Ga0207696_1000039 3300025711 Bacteria 324954
135 Ga0207696_1000061 3300025711 Bacteria 241730
136 Ga0207696_1000336 3300025711 Bacteria 48964
137 Ga0207696_1005029 3300025711 Bacteria 5566
138 Ga0207655_1000024 3300025728 Bacteria 459774
139 Ga0207655_1000078 3300025728 Bacteria 219360
140 Ga0207655_1001716 3300025728 Bacteria 19266
141 Ga0207655_1003934 3300025728 Bacteria 10772
142 Ga0207655_1005600 3300025728 Bacteria 8503
143 Ga0207655_1007535 3300025728 Bacteria 7048
144 Ga0207655_1038161 3300025728 Bacteria 2104
145 Ga0207655_1045047 3300025728 Bacteria 1846
146 Ga0207713_1000007 3300025735 Bacteria 564979
147 Ga0207713_1000086 3300025735 Bacteria 157106
148 Ga0207713_1000180 3300025735 Bacteria 91168
149 Ga0207713_1001512 3300025735 Bacteria 18341
150 Ga0207713_1003092 3300025735 Bacteria 11556
151 Ga0207713_1012808 3300025735 Bacteria 4458
152 Ga0207713_1020274 3300025735 Bacteria 3226
153 Ga0207710_10000026 3300025900 Bacteria 307644
154 Ga0207647_10015507 3300025904 Bacteria 5221
155 Ga0207705_10113654 3300025909 Bacteria 2002
156 Ga0207654_10000012 3300025911 Bacteria 243044
157 Ga0207695_10003274 3300025913 Bacteria 23026
158 Ga0207671_10010652 3300025914 Bacteria 7564
159 Ga0207657_10000012 3300025919 Bacteria 185417
160 Ga0207694_10006964 3300025924 Bacteria 8585
161 Ga0207690_10000008 3300025932 Bacteria 366090
162 Ga0207706_10023906 3300025933 Bacteria 5482
163 Ga0207668_10010817 3300025972 Bacteria 5527
164 Ga0207678_10020675 3300026067 Bacteria 5770
165 Ga0209281_1000184 3300027111 Bacteria 144981
166 Ga0209389_1001043 3300027296 Bacteria 18512
167 Ga0209371_1000069 3300027312 Bacteria 207967
168 Ga0209371_1000083 3300027312 Bacteria 184176
169 Ga0209371_1000119 3300027312 Bacteria 133367
170 Ga0209371_1000177 3300027312 Bacteria 94023
171 Ga0209371_1000203 3300027312 Bacteria 85883
172 Ga0209371_1000553 3300027312 Bacteria 34581
173 Ga0209371_1001088 3300027312 Bacteria 20305
174 Ga0209371_1001586 3300027312 Bacteria 14816
175 Ga0209371_1004501 3300027312 Bacteria 6015
176 Ga0209371_1005043 3300027312 Bacteria 5433
177 Ga0265338_10000058 3300028800 Bacteria 198555
178 Ga0268256_1000066 3300030500 Bacteria 199115
179 Ga0268256_1000074 3300030500 Bacteria 184102
180 Ga0268256_1000096 3300030500 Bacteria 139457
181 Ga0268256_1000479 3300030500 Bacteria 34371
182 Ga0268256_1000648 3300030500 Bacteria 26515
183 Ga0268256_1000799 3300030500 Bacteria 22634
184 Ga0268256_1001201 3300030500 Bacteria 16556
185 Ga0268256_1007079 3300030500 Bacteria 4062
186 Ga0268256_1009089 3300030500 Bacteria 3340
187 Ga0316183_1121986 3300030742 Bacteria 3919
188 Ga0265332_10058103 3300031238 Bacteria 1656
189 Ga0237819_08350 3300038705 Bacteria 1438
190 Ga0439438_002081 3300041405 Bacteria 8670
191 Ga0439447_001607 3300041407 Bacteria 8278
192 Ga0439466_0000002 3300041411 Bacteria 494198
193 Ga0439432_002905 3300042006 Bacteria 6383
194 Ga0439432_004037 3300042006 Bacteria 5382
195 Ga0439449_0028899 3300042007 Bacteria 2066
196 Ga0439452_000004 3300042010 Bacteria 764268
197 Ga0439452_001626 3300042010 Bacteria 8866
198 Ga0450905_007162 3300042142 Bacteria 1516
199 Ga0450907_000011 3300042146 Bacteria 90100
200 Ga0466977_0006091 3300044666 Bacteria 6379
201 Ga0495617_007419 3300046452 Bacteria 3805
202 Ga0495627_000531 3300046453 Bacteria 31517
203 Ga0495592_0071608 3300046454 Bacteria 2523
204 Ga0495603_0089748 3300046455 Bacteria 1798
205 Ga0495591_000002 3300046458 Bacteria 455013
206 Ga0495591_000010 3300046458 Bacteria 327794
207 Ga0495591_000854 3300046458 Bacteria 21440
208 Ga0495591_006612 3300046458 Bacteria 5088
209 Ga0495638_0002589 3300046460 Bacteria 14600
210 Ga0495638_0004932 3300046460 Bacteria 10027
211 Ga0495638_0010258 3300046460 Bacteria 6517
212 Ga0495651_0033064 3300046462 Bacteria 4035
213 Ga0495650_0000176 3300046471 Bacteria 139443
214 Ga0495650_0010957 3300046471 Bacteria 5016
215 Ga0495580_0000520 3300046472 Bacteria 32433
216 Ga0495580_0000801 3300046472 Bacteria 27182
217 Ga0495580_0066617 3300046472 Bacteria 2520
218 Ga0495582_0091805 3300046473 Bacteria 1693
219 Ga0495605_0032538 3300046474 Bacteria 2654
220 Ga0495605_0034086 3300046474 Bacteria 2580
221 Ga0495585_0041332 3300046492 Bacteria 2586
222 Ga0495596_0002162 3300046500 Bacteria 10716
223 Ga0495607_0002331 3300046501 Bacteria 15545
224 Ga0495607_0012206 3300046501 Bacteria 5679
225 Ga0495607_0067919 3300046501 Bacteria 2001
226 Ga0495606_0000748 3300046507 Bacteria 50196
227 Ga0495606_0000873 3300046507 Bacteria 45086
228 Ga0495610_0016885 3300046512 Bacteria 4182
229 Ga0495616_0017440 3300046513 Bacteria 3961
230 Ga0495620_0000006 3300046515 Bacteria 273098
231 Ga0495620_0010915 3300046515 Bacteria 4768
232 Ga0495628_0002359 3300046516 Bacteria 17042
233 Ga0495630_0014298 3300046517 Bacteria 5780
234 Ga0495631_0000698 3300046518 Bacteria 21708
235 Ga0495632_0000074 3300046519 Bacteria 103136
236 Ga0495637_0000143 3300046520 Bacteria 53795
237 Ga0495637_0030896 3300046520 Bacteria 2373
238 Ga0495643_0000086 3300046522 Bacteria 156793
239 Ga0495643_0001075 3300046522 Bacteria 27242
240 Ga0495644_0020545 3300046523 Bacteria 2519
241 Ga0495648_0000126 3300046524 Bacteria 90189
242 Ga0495648_0001640 3300046524 Bacteria 21739
243 Ga0495666_0003157 3300046526 Bacteria 8294
244 Ga0495654_0000036 3300046530 Bacteria 191434
245 Ga0495654_0000168 3300046530 Bacteria 64288
246 Ga0495654_0005014 3300046530 Bacteria 7771
247 Ga0495597_0000011 3300046542 Bacteria 221377
248 Ga0495597_0001072 3300046542 Bacteria 20847
249 Ga0495668_0007635 3300046616 Bacteria 6884
250 Ga0495625_0004394 3300046660 Bacteria 13368
251 Ga0495625_0115929 3300046660 Bacteria 1827
252 Ga0495661_0000010 3300046665 Bacteria 284261
253 Ga0495646_0000806 3300046680 Bacteria 17529
254 Ga0495646_0086474 3300046680 Bacteria 1818
255 Ga0495624_0001300 3300046690 Bacteria 19638
256 Ga0495624_0086156 3300046690 Bacteria 1940
257 Ga0495671_0033927 3300046692 Bacteria 2597
258 Ga0495649_0097976 3300046694 Bacteria 1560
259 Ga0495589_0000040 3300046794 Bacteria 140801
260 Ga0495589_0020328 3300046794 Bacteria 3397
261 Ga0495660_0000010 3300046810 Bacteria 370769
262 Ga0495660_0000296 3300046810 Bacteria 45599
263 Ga0495660_0030068 3300046810 Bacteria 3061
264 Ga0495660_0066321 3300046810 Bacteria 1925
265 Ga0495604_0109219 3300047317 Bacteria 2019
266 Ga0495674_0030403 3300047319 Bacteria 4910
267 Ga0495672_0000006 3300047320 Bacteria 589807
268 Ga0495672_0000085 3300047320 Bacteria 156067
269 Ga0495672_0000103 3300047320 Bacteria 136164
270 Ga0495672_0002513 3300047320 Bacteria 16767
271 Ga0495672_0036283 3300047320 Bacteria 3028
272 Ga0495672_0082948 3300047320 Bacteria 1781
273 Ga0495676_0157607 3300047321 Bacteria 1609
274 Ga0495680_0130682 3300047322 Bacteria 1845
275 Ga0495679_000040 3300047446 Bacteria 149550
276 Ga0495679_004856 3300047446 Bacteria 6072
277 Ga0495673_0000086 3300047469 Bacteria 192268
278 Ga0495673_0042123 3300047469 Bacteria 2051
279 Ga0495681_0009971 3300047470 Bacteria 5791
280 Ga0495686_0023365 3300047472 Bacteria 4078
281 Ga0495593_0008086 3300047673 Bacteria 6119
282 Ga0496100_0027150 3300048903 Bacteria 3518
283 Ga0496101_0000053 3300048904 Bacteria 139859
284 Ga0496102_0012595 3300048905 Bacteria 7326
285 Ga0496103_0014410 3300048906 Bacteria 4694
286 Ga0496105_0225968 3300048908 Bacteria 1522
287 Ga0496116_0000007 3300048919 Bacteria 795464
288 Ga0496116_0000103 3300048919 Bacteria 193529
289 Ga0496116_0000181 3300048919 Bacteria 126124
290 Ga0496116_0010990 3300048919 Bacteria 7534
291 Ga0496116_0014784 3300048919 Bacteria 6209
292 Ga0496116_0063372 3300048919 Bacteria 2382
293 Ga0496117_0000078 3300048920 Bacteria 227068
294 Ga0496117_0000116 3300048920 Bacteria 178919
295 Ga0496117_0000259 3300048920 Bacteria 99638
296 Ga0496117_0000272 3300048920 Bacteria 96736
297 Ga0496117_0002046 3300048920 Bacteria 26708
298 Ga0496117_0003188 3300048920 Bacteria 19479
299 Ga0496117_0006704 3300048920 Bacteria 11512
300 Ga0496117_0019461 3300048920 Bacteria 5574
301 Ga0496117_0046760 3300048920 Bacteria 3110
302 Ga0496118_0000059 3300048921 Bacteria 226336
303 Ga0496118_0000143 3300048921 Bacteria 126057
304 Ga0496118_0001728 3300048921 Bacteria 31777
305 Ga0496118_0001890 3300048921 Bacteria 29885
306 Ga0496118_0003680 3300048921 Bacteria 19017
307 Ga0496118_0058878 3300048921 Bacteria 2866
308 Ga0496119_0000016 3300048922 Bacteria 309806
309 Ga0496119_0000160 3300048922 Bacteria 93515
310 Ga0496119_0000216 3300048922 Bacteria 82190
311 Ga0496119_0000277 3300048922 Bacteria 72419
312 Ga0496119_0005164 3300048922 Bacteria 12637
313 Ga0496119_0006003 3300048922 Bacteria 11411
314 Ga0496119_0011878 3300048922 Bacteria 7149
315 Ga0496119_0012236 3300048922 Bacteria 6993
316 Ga0496120_0000038 3300048923 Bacteria 204168
317 Ga0496120_0000158 3300048923 Bacteria 112600
318 Ga0496120_0000178 3300048923 Bacteria 107847
319 Ga0496120_0000192 3300048923 Bacteria 104239
320 Ga0496120_0000303 3300048923 Bacteria 82190
321 Ga0496120_0000310 3300048923 Bacteria 81092
322 Ga0496120_0000901 3300048923 Bacteria 41594
323 Ga0496120_0001831 3300048923 Bacteria 23743
324 Ga0496120_0002240 3300048923 Bacteria 20245
325 Ga0496121_0000052 3300048924 Bacteria 313410
326 Ga0496122_0001490 3300048925 Bacteria 37513
327 Ga0496123_0001312 3300048926 Bacteria 35262
328 Ga0496123_0005283 3300048926 Bacteria 13086
329 Ga0496123_0033631 3300048926 Bacteria 3686
330 Ga0496123_0038058 3300048926 Bacteria 3386
331 Ga0496124_0000049 3300048927 Bacteria 269753
332 Ga0496124_0000056 3300048927 Bacteria 250907
333 Ga0496124_0000268 3300048927 Bacteria 100793
334 Ga0496124_0012004 3300048927 Bacteria 8611
335 Ga0496124_0014368 3300048927 Bacteria 7656
336 Ga0496124_0017686 3300048927 Bacteria 6710
337 Ga0496124_0030302 3300048927 Bacteria 4804
338 Ga0496124_0098450 3300048927 Bacteria 2373
339 Ga0496125_0002861 3300048928 Bacteria 21716
340 Ga0496125_0112707 3300048928 Bacteria 1964
341 Ga0496126_0019897 3300048929 Bacteria 6599
342 Ga0496126_0160085 3300048929 Bacteria 1924
343 Ga0495678_000382 3300049459 Bacteria 44896
344 Ga0495678_000451 3300049459 Bacteria 40783
345 Ga0495678_001507 3300049459 Bacteria 18126
346 Ga0495678_031058 3300049459 Bacteria 2231
347 Ga0495682_0000024 3300049460 Bacteria 153545
348 Ga0495682_0000069 3300049460 Bacteria 94250
349 Ga0501034_0000154 3300049571 Bacteria 129750
350 Ga0501083_0070202 3300049744 Bacteria 2330
351 nmdc:mga03n38_39025_c1 3300050490 Bacteria 2057
352 nmdc:mga00v17_12484_c1 3300050491 Bacteria 4690
353 nmdc:mga00v17_54609_c1 3300050491 Bacteria 2437
354 Ga0500621_000007 3300053126 Bacteria 214505
355 Ga0500659_0000983 3300053135 Bacteria 18393
356 2808973292 2808606384 Bacteria 8474373
357 2508853707 2508501071 Bacteria 5454741
358 2510294609 2510065055 Bacteria 5037935
359 2510311202 2510065058 Bacteria 5005894
360 2511088565 2510917013 Bacteria 9951648
361 2511100852 2510917014 Bacteria 8296963
362 2511107389 2510917015 Bacteria 7950052
363 2511380367 2511231025 Bacteria 5324661
364 2511434611 2511231035 Bacteria 5341610
365 2516023459 2515154189 Bacteria 9629850
366 2519461717 2519103095 Bacteria 6629912
367 2554815331 2554235132 Bacteria 6772433
368 2563057993 2562617112 Bacteria 10918404
369 2585293221 2582581311 Bacteria 6763856
370 2599735217 2599185239 Bacteria 8686614
371 2599743344 2599185240 Bacteria 7968121
372 2599927779 2599185299 Bacteria 4854625
373 2600023812 2599185316 Bacteria 6320029
374 2600032151 2599185317 Bacteria 6435722
375 2600077862 2599185325 Bacteria 6324919
376 2600205424 2599185355 Bacteria 7968906
377 2600359919 2600254930 Bacteria 6431253
378 2601623724 2600255283 Bacteria 6061572
379 2608384998 2606217733 Bacteria 6360972
380 2608670822 2608642108 Bacteria 4104624
381 2650898609 2648501693 Bacteria 5069560
382 2656275589 2654587920 Bacteria 5475511
383 2671128160 2667528176 Bacteria 6724917
384 2676740721 2675903129 Bacteria 7964495
385 2686354788 2684622997 Bacteria 4624240
386 2689446457 2687453601 Bacteria 5546041
387 2713473301 2711768613 Bacteria 11048459
388 2765579061 2765235840 Bacteria 4663337
389 2772440344 2772190666 Bacteria 5117644
390 2774129438 2773857672 Bacteria 4993178
391 2807178185 2806310673 Bacteria 4801221
392 2809008770 2808606390 Bacteria 8476311
393 2809014975 2808606391 Bacteria 8308166
394 2809125758 2808606414 Bacteria 4917181
395 2817258591 2816332253 Bacteria 6764532
396 2817280992 2816332256 Bacteria 6891714
397 2817453284 2816332286 Bacteria 6853759
398 2819598352 2818991446 Bacteria 7757362
399 2819632125 2818991452 Bacteria 8442785
400 2842329533 2842324504 Bacteria 9364110
401 2842354368 2842348783 Bacteria 9002918
402 2842456255 2842454564 Bacteria 8730687
403 2844531409 2844528606 Bacteria 4733806
404 2847089415 2847085930 Bacteria 5070450
405 2847801748 2847797336 Bacteria 5176640
406 2857367788 2857357740 Bacteria 9937880
407 2863422511 2863421361 Bacteria 7300805
408 2865016164 2865014394 Bacteria 4764573
409 2869555809 2869551831 Bacteria 5474685
410 2870072742 2870068957 Bacteria 8925310
411 2876605993 2876601092 Bacteria 5114497
412 2881413469 2881412998 Bacteria 6492157
413 2881613623 2881609920 Bacteria 4405319
414 2883094151 2883087390 Bacteria 9532701
415 2888370451 2888366609 Bacteria 5155009
416 2899926130 2899924645 Bacteria 7487985
417 2900638259 2900634093 Bacteria 10263517
418 2904506157 2904504865 Bacteria 5152820
419 2904565027 2904564687 Bacteria 7609577
420 2904572277 2904571731 Bacteria 7608790
421 2917836610 2917832318 Bacteria 5346010
422 2919126349 2919125081 Bacteria 5385106
423 2919156402 2919155634 Bacteria 4860545
424 2928044590 2928037797 Bacteria 7273642
425 2928051426 2928044640 Bacteria 7271509
426 2928057256 2928051484 Bacteria 7773759
427 2928069232 2928064002 Bacteria 7419480
428 2928157209 2928157003 Bacteria 7522202
429 2928169038 2928163908 Bacteria 7561269
430 2928172294 2928170801 Bacteria 8785406
431 2928537603 2928536128 Bacteria 7657547
432 2932409169 2932406140 Bacteria 5134491
433 2937971915 2937967321 Bacteria 5094075
434 2939580885 2939577877 Bacteria 5132791
435 2939591686 2939589442 Bacteria 4214238
436 2939605548 2939602548 Bacteria 4950493
437 2945954622 2945951305 Bacteria 4918162
438 2974302155 2974298342 Bacteria 4840922
439 2974308781 2974307012 Bacteria 4172388
440 2977249507 2977247770 Bacteria 4160543
441 2978977115 2978975091 Bacteria 4704313
442 2981995058 2981990288 Bacteria 7590678
443 2984498504 2984494565 Bacteria 5000175
444 2984500272 2984499530 Bacteria 5020881
445 2984506313 2984504281 Bacteria 5262371
446 2984516011 2984514374 Bacteria 4172479
447 2990263604 2990261002 Bacteria 4919493
448 3007422197 3007419365 Bacteria 7026924
449 3007809166 3007803356 Bacteria 5931491
450 640939191 640753048 Bacteria 5495657
451 642418296 641736154 Bacteria 7689995
452 642615725 642555113 Bacteria 8214658
453 8004594641 8004592986 Bacteria 5122074
454 8015399305 8015394850 Bacteria 5064660
455 8016731690 8016728285 Bacteria 5263933
456 8016737536 8016733728 Bacteria 5274317
457 8018852159 8018845410 Bacteria 8933938
458 8019502759 8019499862 Bacteria 5169538
459 8020810490 8020807995 Bacteria 6801506
460 8020939854 8020938398 Bacteria 7472757
461 8020946449 8020945358 Bacteria 8467355
462 8020955059 8020953355 Bacteria 7439080
463 8021120563 8021120328 Bacteria 8782274
464 8039101363 8039098773 Bacteria 6602928
465 8040167692 8040167225 Bacteria 6542727
466 8040177751 8040173305 Bacteria 6827067
467 8052497021 8052494512 Bacteria 5765634
468 8054934618 8054929484 Bacteria 5599761
469 JGI24739J22299_10000600
470 JGI25156J39149_1000645
471 JGI25162J39368_1003138
472 Ga0055532_1000797
473 Ga0055532_1001574
474 Ga0055532_1001993
475 Ga0055527_1000083
476 Ga0055527_1000782
477 Ga0055535_1000093
478 Ga0055535_1000100
479 Ga0055535_1000182
480 Ga0055542_1000073
481 Ga0055542_1000106
482 Ga0055529_1000124
483 Ga0055526_1003445
484 Ga0055526_1004440
485 Ga0055537_1000395
486 Ga0055536_1010078
487 Ga0055536_1010080
488 Ga0055534_1000030
489 Ga0055528_1001256
490 Ga0055528_1003823
491 Ga0055530_10000021
492 Ga0055530_10000519
493 Ga0055540_1003000
494 Ga0055531_10013598
495 Ga0055531_10032330
496 Ga0058692_1000039
497 Ga0058692_1000096
498 Ga0058692_1000221
499 Ga0058692_1000575
500 Ga0058692_1002452
501 Ga0058692_1004768
502 Ga0058692_1018839
503 Ga0065703_1019383
504 Ga0065704_10071486
505 Ga0070658_10147733
506 Ga0070660_100000002
507 Ga0070668_100007954
508 Ga0070669_100196328
509 Ga0070659_100000007
510 Ga0070663_100002294
511 Ga0070662_100015571
512 Ga0070665_100146941
513 Ga0068855_100030340
514 Ga0068852_100005330
515 Ga0068851_10028415
516 Ga0075364_10048143
517 Ga0099823_1001983
518 Ga0079104_1002106
519 Ga0105251_10000095
520 Ga0105251_10000425
521 Ga0105251_10000638
522 Ga0105251_10002425
523 Ga0105251_10003450
524 Ga0105251_10042975
525 Ga0105244_10000585
526 Ga0105244_10001135
527 Ga0105244_10001418
528 Ga0105244_10003711
529 Ga0105244_10022437
530 Ga0105244_10029528
531 Ga0105244_10042451
532 Ga0105250_10000021
533 Ga0105250_10011907
534 Ga0105240_10000600
535 Ga0105247_10000048
536 Ga0105243_10012818
537 Ga0105241_10000011
538 Ga0105237_10046755
539 Ga0105237_10103757
540 Ga0105238_10045683
541 Ga0105246_10002608
542 Ga0105246_10011247
543 Ga0157373_10003739
544 Ga0157373_10004957
545 Ga0157373_10094497
546 Ga0157371_10004133
547 Ga0157371_10014190
548 Ga0157370_10000120
549 Ga0157370_10008002
550 Ga0157369_10010152
551 Ga0157369_10031881
552 Ga0157369_10176442
553 Ga0157372_10015558
554 Ga0157372_10022837
555 Ga0157372_10121755
556 Ga0157372_10136483
557 Ga0157372_10136592
558 Ga0182008_10002600
559 Ga0182008_10058430
560 Ga0182006_1033717
561 Ga0182007_10030276
562 Ga0163161_10000005
563 Ga0209566_100962
564 Ga0209674_103476
565 Ga0209672_100015
566 Ga0209672_100031
567 Ga0209672_100201
568 Ga0209147_100016
569 Ga0209147_100034
570 Ga0209147_100040
571 Ga0209147_102857
572 Ga0209437_100100
573 Ga0209258_100026
574 Ga0209258_100061
575 Ga0209258_100069
576 Ga0209148_1000070
577 Ga0209148_1000076
578 Ga0209148_1001137
579 Ga0209759_1000052
580 Ga0209565_1000024
581 Ga0209455_1000069
582 Ga0209455_1000358
583 Ga0209673_1000026
584 Ga0209673_1001717
585 Ga0209675_1000107
586 Ga0209676_1000011
587 Ga0209676_1000442
588 Ga0209676_1000752
589 Ga0209676_1002346
590 Ga0209564_1002932
591 Ga0209050_1000032
592 Ga0209050_1000069
593 Ga0209256_1002137
594 Ga0209256_1015200
595 Ga0209051_1001088
596 Ga0209051_1001874
597 Ga0209257_1000014
598 Ga0209257_1000194
599 Ga0209257_1009404
600 Ga0207656_10090452
601 Ga0207696_1000006
602 Ga0207696_1000039
603 Ga0207696_1000061
604 Ga0207696_1000336
605 Ga0207696_1005029
606 Ga0207655_1000024
607 Ga0207655_1000078
608 Ga0207655_1001716
609 Ga0207655_1003934
610 Ga0207655_1005600
611 Ga0207655_1007535
612 Ga0207655_1038161
613 Ga0207655_1045047
614 Ga0207713_1000007
615 Ga0207713_1000086
616 Ga0207713_1000180
617 Ga0207713_1001512
618 Ga0207713_1003092
619 Ga0207713_1012808
620 Ga0207713_1020274
621 Ga0207710_10000026
622 Ga0207647_10015507
623 Ga0207705_10113654
624 Ga0207654_10000012
625 Ga0207695_10003274
626 Ga0207671_10010652
627 Ga0207657_10000012
628 Ga0207694_10006964
629 Ga0207690_10000008
630 Ga0207706_10023906
631 Ga0207668_10010817
632 Ga0207678_10020675
633 Ga0209281_1000184
634 Ga0209389_1001043
635 Ga0209371_1000069
636 Ga0209371_1000083
637 Ga0209371_1000119
638 Ga0209371_1000177
639 Ga0209371_1000203
640 Ga0209371_1000553
641 Ga0209371_1001088
642 Ga0209371_1001586
643 Ga0209371_1004501
644 Ga0209371_1005043
645 Ga0265338_10000058
646 Ga0268256_1000066
647 Ga0268256_1000074
648 Ga0268256_1000096
649 Ga0268256_1000479
650 Ga0268256_1000648
651 Ga0268256_1000799
652 Ga0268256_1001201
653 Ga0268256_1007079
654 Ga0268256_1009089
655 Ga0316183_1121986
656 Ga0265332_10058103
657 Ga0237819_08350
658 Ga0439438_002081
659 Ga0439447_001607
660 Ga0439466_0000002
661 Ga0439432_002905
662 Ga0439432_004037
663 Ga0439449_0028899
664 Ga0439452_000004
665 Ga0439452_001626
666 Ga0450905_007162
667 Ga0450907_000011
668 Ga0466977_0006091
669 Ga0495617_007419
670 Ga0495627_000531
671 Ga0495592_0071608
672 Ga0495603_0089748
673 Ga0495591_000002
674 Ga0495591_000010
675 Ga0495591_000854
676 Ga0495591_006612
677 Ga0495638_0002589
678 Ga0495638_0004932
679 Ga0495638_0010258
680 Ga0495651_0033064
681 Ga0495650_0000176
682 Ga0495650_0010957
683 Ga0495580_0000520
684 Ga0495580_0000801
685 Ga0495580_0066617
686 Ga0495582_0091805
687 Ga0495605_0032538
688 Ga0495605_0034086
689 Ga0495585_0041332
690 Ga0495596_0002162
691 Ga0495607_0002331
692 Ga0495607_0012206
693 Ga0495607_0067919
694 Ga0495606_0000748
695 Ga0495606_0000873
696 Ga0495610_0016885
697 Ga0495616_0017440
698 Ga0495620_0000006
699 Ga0495620_0010915
700 Ga0495628_0002359
701 Ga0495630_0014298
702 Ga0495631_0000698
703 Ga0495632_0000074
704 Ga0495637_0000143
705 Ga0495637_0030896
706 Ga0495643_0000086
707 Ga0495643_0001075
708 Ga0495644_0020545
709 Ga0495648_0000126
710 Ga0495648_0001640
711 Ga0495666_0003157
712 Ga0495654_0000036
713 Ga0495654_0000168
714 Ga0495654_0005014
715 Ga0495597_0000011
716 Ga0495597_0001072
717 Ga0495668_0007635
718 Ga0495625_0004394
719 Ga0495625_0115929
720 Ga0495661_0000010
721 Ga0495646_0000806
722 Ga0495646_0086474
723 Ga0495624_0001300
724 Ga0495624_0086156
725 Ga0495671_0033927
726 Ga0495649_0097976
727 Ga0495589_0000040
728 Ga0495589_0020328
729 Ga0495660_0000010
730 Ga0495660_0000296
731 Ga0495660_0030068
732 Ga0495660_0066321
733 Ga0495604_0109219
734 Ga0495674_0030403
735 Ga0495672_0000006
736 Ga0495672_0000085
737 Ga0495672_0000103
738 Ga0495672_0002513
739 Ga0495672_0036283
740 Ga0495672_0082948
741 Ga0495676_0157607
742 Ga0495680_0130682
743 Ga0495679_000040
744 Ga0495679_004856
745 Ga0495673_0000086
746 Ga0495673_0042123
747 Ga0495681_0009971
748 Ga0495686_0023365
749 Ga0495593_0008086
750 Ga0496100_0027150
751 Ga0496101_0000053
752 Ga0496102_0012595
753 Ga0496103_0014410
754 Ga0496105_0225968
755 Ga0496116_0000007
756 Ga0496116_0000103
757 Ga0496116_0000181
758 Ga0496116_0010990
759 Ga0496116_0014784
760 Ga0496116_0063372
761 Ga0496117_0000078
762 Ga0496117_0000116
763 Ga0496117_0000259
764 Ga0496117_0000272
765 Ga0496117_0002046
766 Ga0496117_0003188
767 Ga0496117_0006704
768 Ga0496117_0019461
769 Ga0496117_0046760
770 Ga0496118_0000059
771 Ga0496118_0000143
772 Ga0496118_0001728
773 Ga0496118_0001890
774 Ga0496118_0003680
775 Ga0496118_0058878
776 Ga0496119_0000016
777 Ga0496119_0000160
778 Ga0496119_0000216
779 Ga0496119_0000277
780 Ga0496119_0005164
781 Ga0496119_0006003
782 Ga0496119_0011878
783 Ga0496119_0012236
784 Ga0496120_0000038
785 Ga0496120_0000158
786 Ga0496120_0000178
787 Ga0496120_0000192
788 Ga0496120_0000303
789 Ga0496120_0000310
790 Ga0496120_0000901
791 Ga0496120_0001831
792 Ga0496120_0002240
793 Ga0496121_0000052
794 Ga0496122_0001490
795 Ga0496123_0001312
796 Ga0496123_0005283
797 Ga0496123_0033631
798 Ga0496123_0038058
799 Ga0496124_0000049
800 Ga0496124_0000056
801 Ga0496124_0000268
802 Ga0496124_0012004
803 Ga0496124_0014368
804 Ga0496124_0017686
805 Ga0496124_0030302
806 Ga0496124_0098450
807 Ga0496125_0002861
808 Ga0496125_0112707
809 Ga0496126_0019897
810 Ga0496126_0160085
811 Ga0495678_000382
812 Ga0495678_000451
813 Ga0495678_001507
814 Ga0495678_031058
815 Ga0495682_0000024
816 Ga0495682_0000069
817 Ga0501034_0000154
818 Ga0501083_0070202
819 nmdc:mga03n38_39025_c1
820 nmdc:mga00v17_12484_c1
821 nmdc:mga00v17_54609_c1
822 Ga0500621_000007
823 Ga0500659_0000983
824 2808973292
825 2508853707
826 2510294609
827 2510311202
828 2511088565
829 2511100852
830 2511107389
831 2511380367
832 2511434611
833 2516023459
834 2519461717
835 2554815331
836 2563057993
837 2585293221
838 2599735217
839 2599743344
840 2599927779
841 2600023812
842 2600032151
843 2600077862
844 2600205424
845 2600359919
846 2601623724
847 2608384998
848 2608670822
849 2650898609
850 2656275589
851 2671128160
852 2676740721
853 2686354788
854 2689446457
855 2713473301
856 2765579061
857 2772440344
858 2774129438
859 2807178185
860 2809008770
861 2809014975
862 2809125758
863 2817258591
864 2817280992
865 2817453284
866 2819598352
867 2819632125
868 2842329533
869 2842354368
870 2842456255
871 2844531409
872 2847089415
873 2847801748
874 2857367788
875 2863422511
876 2865016164
877 2869555809
878 2870072742
879 2876605993
880 2881413469
881 2881613623
882 2883094151
883 2888370451
884 2899926130
885 2900638259
886 2904506157
887 2904565027
888 2904572277
889 2917836610
890 2919126349
891 2919156402
892 2928044590
893 2928051426
894 2928057256
895 2928069232
896 2928157209
897 2928169038
898 2928172294
899 2928537603
900 2932409169
901 2937971915
902 2939580885
903 2939591686
904 2939605548
905 2945954622
906 2974302155
907 2974308781
908 2977249507
909 2978977115
910 2981995058
911 2984498504
912 2984500272
913 2984506313
914 2984516011
915 2990263604
916 3007422197
917 3007809166
918 640939191
919 642418296
920 642615725
921 8004594641
922 8015399305
923 8016731690
924 8016737536
925 8018852159
926 8019502759
927 8020810490
928 8020939854
929 8020946449
930 8020955059
931 8021120563
932 8039101363
933 8040167692
934 8040177751
935 8052497021
936 8054934618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

362

449

0.94

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

359

445

0.83

PF00034

Cytochrom_C

Cytochrome c

76

176

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.9451 23 419
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.8672 23 419
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8493 29 418
7w2j-assembly1.cif.gz_C cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8119 29 433
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8026 29 418
ID Description Score Start End Superfamily
af_O80512_64_129_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7355 386 423 1.10.10.60
5oboA03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7273 302 419 1.10.760.10
af_I1KQI5_43_108_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7225 386 423 1.10.10.60
1r0qA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6988 315 433 1.10.760.10
5oboA03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6736 302 419 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A367MAS2-F1-model_v4 Cytochrome c 0.992 25 170 GO:0009055
GO:0020037
GO:0046872
AF-A0A379ALW1-F1-model_v4 Gluconate 2-dehydrogenase cytochrome c subunit (EC 1.1.99.3) 0.9765 174 435 GO:0005506
GO:0009055
GO:0020037
GO:0033717
AF-A0A854C7S5-F1-model_v4 deleted 0.9749 19 136
AF-A0A367M3S2-F1-model_v4 Cytochrome c 0.9745 220 421 GO:0005506
GO:0009055
GO:0020037
AF-P0A388-F1-model_v4 Alcohol dehydrogenase (quinone), cytochrome c subunit (ADH) (EC 1.1.5.5) (Alcohol dehydrogenase (quinone), subunit II) (Cytochrome c-553) (Cytochrome c553) (Ethanol:Q2 reductase) (G3-ADH subunit II) (Quinohemoprotein-cytochrome c complex) (Ubiquinol oxidase) 0.968 23 418 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037

Map