F450161

General Info

Members Datasets Scaffolds Average Seq Length
469 298 252 147

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000993|JGI25151J46595_1000099319
Length 168
Sequence MMVIHDFQIDFYIIRGGILMDTSISKTTVDVLNKQIADWNVLFVKLHNYHWYVKGSDFFTLHAKFEELYNEAILHIDVLAERVLIIGGKPIATMREYLDASGIEEANQRATSKEMVQDIVHNFNYLIEELKNGMEITTQESDFVTHDILSAIRKNLSKHIWMLNAYLS

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
6 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
7 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
8 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
9 2554235283 Bacillus safensis VK Isolate Rhizosphere
10 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
11 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
12 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
13 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
14 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
15 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
16 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
17 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
18 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
19 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
20 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
21 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
22 2643221729 Bacillus sp. Root11 Isolate Unclassified
23 2643221730 Bacillus sp. Root131 Isolate Unclassified
24 2643221731 Bacillus sp. Root147 Isolate Unclassified
25 2643221732 Bacillus sp. Root239 Isolate Unclassified
26 2643221735 Bacillus sp. Root920 Isolate Unclassified
27 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
28 2671180694 Paenibacillus sp. A3 Isolate Unclassified
29 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
30 2684622632 Bacillus cereus 905 Isolate Unclassified
31 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
32 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
33 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
34 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
35 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
36 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
37 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
38 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
39 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
40 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
41 2738541295 Bacillus sp. OK085 Isolate Unclassified
42 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
43 2738541358 Bacillus sp. OV752 Isolate Unclassified
44 2738543006 Bacillus sp. OK077 Isolate Unclassified
45 2738543010 Bacillus sp. YR335 Isolate Unclassified
46 2738543017 Bacillus sp. OV186 Isolate Unclassified
47 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
48 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
49 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
50 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
51 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
52 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
53 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
54 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
55 2811994870 Bacillus sp. JB4 Isolate Unclassified
56 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
57 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
58 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
59 2818991459 Paenibacillus sp. 597 Isolate Unclassified
60 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
61 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
62 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
63 2842882022 Bacillus sp. R-71893 Isolate Unclassified
64 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
65 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
66 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
67 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
68 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
69 2857586860 Bacillus sp. R-71935 Isolate Unclassified
70 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
71 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
72 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
73 2860837431 Bacillus sp. WR11 Isolate Unclassified
74 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
75 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
76 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
77 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
78 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
79 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
80 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
81 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
82 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
83 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
84 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
85 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
86 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
87 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
88 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
89 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
90 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
91 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
92 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
93 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
94 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
95 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
96 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
97 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
98 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
99 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
100 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
101 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
102 2919720352 Priestia megaterium 4340 Isolate Unclassified
103 2919726948 Bacillus pumilus 4489 Isolate Unclassified
104 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
105 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
106 2929004312 Priestia megaterium 1104 Isolate Unclassified
107 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
108 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
109 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
110 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
111 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
112 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
113 2938917290 Bacillus sp. CR71 Isolate Unclassified
114 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
115 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
116 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
117 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
118 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
119 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
120 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
121 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
122 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
123 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
124 2965761152 Bacillus sp. COPE52 Isolate Unclassified
125 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
126 2969141011 Bacillus velezensis MH25 Isolate Unclassified
127 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
128 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
129 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
130 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
131 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
132 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
133 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
134 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
135 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
136 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
137 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
138 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
139 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
140 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
141 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
142 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
143 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
144 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
145 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
146 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
147 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
148 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
149 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
150 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
151 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
152 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
153 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
154 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
155 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
156 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
157 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
158 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
159 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
160 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
161 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
162 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
163 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
164 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
165 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
166 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
167 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
168 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
171 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
172 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
173 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
180 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
218 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
274 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
275 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
276 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
277 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
278 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
279 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
280 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
281 8022653035 Bacillus sp. Rc4 Isolate Unclassified
282 8022792930 Bacillus sp. Xin Isolate Rhizosphere
283 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
284 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
285 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
286 8023438354 Bacillus sp. BH2 Isolate Unclassified
287 8023444577 Bacillus sp. BH32 Isolate Unclassified
288 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
289 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
290 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
291 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
292 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
293 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
294 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
295 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
296 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
297 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
298 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 51.81
Metatranscriptomes 2.13
Isolates 46.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 13.43
Nodule 0.43
Rhizoplane 6.4
Rhizosphere 47.12
Stem 0
Stem Tuber 0
Unclassified 32.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1009471 3300002987 Bacteria 2566
2 JGI25151J46595_10000302 3300003187 Bacteria 54102
3 JGI25151J46595_10000747 3300003187 Bacteria 26539
4 JGI25151J46595_10000993 3300003187 Bacteria 21429
5 JGI25151J46595_10012089 3300003187 Bacteria 3937
6 JGI25151J46595_10013071 3300003187 Bacteria 3747
7 JGI25151J46595_10022227 3300003187 Unclassified 2637
8 JGI25151J46595_10023653 3300003187 Bacteria 2526
9 JGI25151J46595_10076031 3300003187 Bacteria 994
10 JGI25151J46595_10082623 3300003187 Bacteria 924
11 JGI25151J46595_10137708 3300003187 Bacteria 599
12 rootH2_10041601 3300003320 Bacteria 4322
13 rootL2_10013974 3300003322 Bacteria 148551
14 rootH1_10364009 3300003323 Bacteria 4424
15 Ga0006562J51391_1000700 3300003578 Bacteria 6310
16 Ga0006562J51391_1010313 3300003578 Bacteria 611
17 Ga0006562J51391_1017394 3300003578 Bacteria 1268
18 Ga0055538_1000108 3300003751 Bacteria 65433
19 Ga0055532_1000024 3300003758 Bacteria 244166
20 Ga0055532_1000060 3300003758 Bacteria 150321
21 Ga0055532_1000610 3300003758 Bacteria 14303
22 Ga0055532_1000756 3300003758 Bacteria 11602
23 Ga0055532_1002278 3300003758 Bacteria 4158
24 Ga0055536_1002691 3300003781 Bacteria 9864
25 Ga0055536_1009624 3300003781 Bacteria 3963
26 Ga0055536_1014101 3300003781 Bacteria 2831
27 Ga0055528_1003904 3300003790 Bacteria 7324
28 Ga0070669_100176684 3300005353 Bacteria 1668
29 Ga0070669_100551787 3300005353 Bacteria 961
30 Ga0070675_100528416 3300005354 Bacteria 1065
31 Ga0070671_100038401 3300005355 Bacteria 3975
32 Ga0070715_10545523 3300006163 Bacteria 671
33 Ga0075431_101171014 3300006847 Bacteria 732
34 Ga0105251_10008147 3300009011 Bacteria 6340
35 Ga0105251_10088663 3300009011 Bacteria 1423
36 Ga0105244_10002902 3300009036 Bacteria 12656
37 Ga0105244_10018217 3300009036 Bacteria 3947
38 Ga0105244_10065935 3300009036 Bacteria 1813
39 Ga0105244_10114274 3300009036 Bacteria 1311
40 Ga0105244_10364364 3300009036 Bacteria 666
41 Ga0105250_10005299 3300009092 Bacteria 5791
42 Ga0105250_10141303 3300009092 Bacteria 998
43 Ga0105250_10530617 3300009092 Bacteria 537
44 Ga0105245_10292446 3300009098 Bacteria 1596
45 Ga0105247_10018143 3300009101 Bacteria 4220
46 Ga0105243_10001879 3300009148 Bacteria 17893
47 Ga0105243_10373872 3300009148 Bacteria 1316
48 Ga0105242_10079962 3300009176 Bacteria 2731
49 Ga0105249_10295242 3300009553 Bacteria 1623
50 Ga0105239_10201252 3300010375 Bacteria 2231
51 Ga0105246_10008815 3300011119 Bacteria 6208
52 Ga0105246_10018365 3300011119 Bacteria 4457
53 Ga0105246_11786271 3300011119 Bacteria 587
54 Ga0157378_10002050 3300013297 Bacteria 18043
55 Ga0163163_11551489 3300014325 Bacteria 723
56 Ga0157377_10007811 3300014745 Bacteria 5183
57 Ga0157376_10064061 3300014969 Bacteria 3099
58 Ga0209784_100100 3300025224 Bacteria 101657
59 Ga0209566_100139 3300025225 Bacteria 89273
60 Ga0209566_109691 3300025225 Unclassified 995
61 Ga0209147_100020 3300025229 Bacteria 474055
62 Ga0209147_100054 3300025229 Bacteria 266796
63 Ga0209147_100080 3300025229 Bacteria 196308
64 Ga0209147_100312 3300025229 Bacteria 37771
65 Ga0209147_103242 3300025229 Bacteria 3302
66 Ga0209147_110966 3300025229 Bacteria 1017
67 Ga0209437_101010 3300025233 Bacteria 9730
68 Ga0209673_1008737 3300025273 Bacteria 4477
69 Ga0209130_1000320 3300025284 Bacteria 56333
70 Ga0209130_1004430 3300025284 Bacteria 5331
71 Ga0209130_1026010 3300025284 Bacteria 1260
72 Ga0209675_1007411 3300025291 Bacteria 4212
73 Ga0209675_1010349 3300025291 Bacteria 3193
74 Ga0209675_1054879 3300025291 Bacteria 807
75 Ga0209676_1000274 3300025292 Bacteria 107505
76 Ga0209676_1000597 3300025292 Bacteria 53358
77 Ga0209676_1009235 3300025292 Bacteria 4281
78 Ga0209676_1054856 3300025292 Bacteria 1024
79 Ga0209676_1090739 3300025292 Bacteria 672
80 Ga0209025_1000001 3300025294 Bacteria 1888151
81 Ga0209025_1000043 3300025294 Bacteria 350458
82 Ga0209025_1000170 3300025294 Bacteria 160659
83 Ga0209025_1000262 3300025294 Bacteria 123617
84 Ga0209025_1000433 3300025294 Bacteria 82715
85 Ga0209025_1001857 3300025294 Bacteria 24772
86 Ga0209025_1002061 3300025294 Bacteria 22834
87 Ga0209025_1002449 3300025294 Bacteria 19620
88 Ga0209025_1003052 3300025294 Bacteria 16484
89 Ga0209025_1005266 3300025294 Bacteria 10643
90 Ga0209025_1006096 3300025294 Bacteria 9524
91 Ga0209025_1008528 3300025294 Bacteria 7362
92 Ga0209025_1009239 3300025294 Bacteria 6911
93 Ga0209025_1009914 3300025294 Bacteria 6547
94 Ga0209025_1014353 3300025294 Bacteria 4881
95 Ga0209025_1035613 3300025294 Bacteria 2246
96 Ga0209025_1073727 3300025294 Bacteria 1195
97 Ga0209025_1089466 3300025294 Bacteria 1012
98 Ga0207426_1060439 3300025302 Bacteria 1092
99 Ga0207696_1000479 3300025711 Bacteria 33975
100 Ga0207696_1001916 3300025711 Bacteria 10585
101 Ga0207696_1002758 3300025711 Bacteria 8349
102 Ga0207655_1017140 3300025728 Bacteria 3920
103 Ga0207655_1033821 3300025728 Bacteria 2310
104 Ga0207655_1073141 3300025728 Bacteria 1265
105 Ga0207713_1004372 3300025735 Bacteria 9182
106 Ga0207713_1034826 3300025735 Bacteria 2182
107 Ga0207713_1040714 3300025735 Bacteria 1947
108 Ga0207713_1048472 3300025735 Bacteria 1710
109 Ga0207713_1064818 3300025735 Bacteria 1374
110 Ga0207710_10033695 3300025900 Bacteria 2248
111 Ga0207645_10559827 3300025907 Bacteria 776
112 Ga0207681_10060786 3300025923 Bacteria 2595
113 Ga0207681_10394181 3300025923 Bacteria 1117
114 Ga0207650_10293087 3300025925 Bacteria 1327
115 Ga0207659_10281347 3300025926 Bacteria 1360
116 Ga0207659_10982227 3300025926 Bacteria 726
117 Ga0207687_10435845 3300025927 Bacteria 1084
118 Ga0207686_10048175 3300025934 Bacteria 2639
119 Ga0207709_10016523 3300025935 Bacteria 4103
120 Ga0207709_11097608 3300025935 Bacteria 653
121 Ga0207712_10451146 3300025961 Bacteria 1090
122 Ga0268266_10884380 3300028379 Bacteria 864
123 Ga0237817_10024 3300030083 Bacteria 61782
124 Ga0237817_10986 3300030083 Bacteria 1758
125 Ga0237817_11186 3300030083 Bacteria 1449
126 Ga0307408_100354316 3300031548 Bacteria 1246
127 Ga0307408_101729494 3300031548 Bacteria 596
128 Ga0307405_11541321 3300031731 Bacteria 585
129 Ga0307410_11635480 3300031852 Bacteria 570
130 Ga0307409_100011167 3300031995 Bacteria 5642
131 Ga0307409_100779355 3300031995 Bacteria 962
132 Ga0307416_100014947 3300032002 Bacteria 5341
133 Ga0307416_100242127 3300032002 Bacteria 1749
134 Ga0395900_0787099 3300037418 Bacteria 880
135 Ga0395898_1123493 3300037466 Unclassified 719
136 Ga0237819_00348 3300038705 Bacteria 16676
137 Ga0237819_00577 3300038705 Bacteria 12294
138 Ga0439436_0003912 3300041404 Bacteria 4566
139 Ga0439439_0001486 3300041406 Bacteria 4687
140 Ga0439433_0019101 3300041999 Bacteria 1526
141 Ga0439449_0001726 3300042007 Bacteria 8592
142 Ga0439449_0031323 3300042007 Bacteria 1982
143 Ga0439457_006140 3300042014 Bacteria 2964
144 Ga0439462_0009116 3300042015 Bacteria 2509
145 Ga0439462_0049205 3300042015 Bacteria 1131
146 Ga0466969_0001169 3300044656 Bacteria 14137
147 Ga0466967_0009686 3300045976 Bacteria 7169
148 Ga0466967_0212078 3300045976 Bacteria 1837
149 Ga0466967_1236348 3300045976 Bacteria 744
150 Ga0495603_0064131 3300046455 Bacteria 2166
151 Ga0495584_0044049 3300046491 Bacteria 2252
152 Ga0495585_0008512 3300046492 Bacteria 6215
153 Ga0495637_0138253 3300046520 Bacteria 926
154 Ga0495654_0074503 3300046530 Bacteria 1603
155 Ga0495597_0275085 3300046542 Bacteria 657
156 Ga0495633_0234228 3300046558 Bacteria 839
157 Ga0495611_0199652 3300046648 Bacteria 933
158 Ga0495661_0051259 3300046665 Bacteria 2493
159 Ga0495661_0068887 3300046665 Bacteria 2075
160 Ga0495661_0107384 3300046665 Bacteria 1561
161 Ga0495670_0039371 3300046691 Bacteria 2358
162 Ga0495649_0287622 3300046694 Bacteria 839
163 Ga0495660_0031812 3300046810 Bacteria 2965
164 Ga0495676_0058790 3300047321 Bacteria 3023
165 Ga0495683_0096267 3300047323 Bacteria 1428
166 Ga0495626_0124350 3300048091 Unclassified 1106
167 Ga0495626_0191172 3300048091 Bacteria 844
168 Ga0495626_0300586 3300048091 Bacteria 634
169 Ga0496100_0000519 3300048903 Bacteria 18430
170 Ga0496101_0007109 3300048904 Bacteria 7237
171 Ga0496102_0001666 3300048905 Bacteria 19511
172 Ga0496102_0018785 3300048905 Bacteria 6080
173 Ga0496102_0058745 3300048905 Bacteria 3515
174 Ga0496102_0841706 3300048905 Bacteria 840
175 Ga0496103_0001204 3300048906 Bacteria 17760
176 Ga0496103_0122348 3300048906 Bacteria 1658
177 Ga0496104_0000832 3300048907 Bacteria 26638
178 Ga0496105_0000067 3300048908 Bacteria 82959
179 Ga0496106_0002301 3300048909 Bacteria 14244
180 Ga0496106_1050127 3300048909 Bacteria 640
181 Ga0496107_0000724 3300048910 Bacteria 18866
182 Ga0496108_0003318 3300048911 Bacteria 12929
183 Ga0496109_0000906 3300048912 Bacteria 24668
184 Ga0496110_0009002 3300048913 Bacteria 8053
185 Ga0496110_0014535 3300048913 Bacteria 6541
186 Ga0496110_0487214 3300048913 Bacteria 1123
187 Ga0496110_1566952 3300048913 Bacteria 569
188 Ga0496111_0002271 3300048914 Bacteria 11544
189 Ga0496111_0593968 3300048914 Bacteria 811
190 Ga0496111_0807238 3300048914 Bacteria 679
191 Ga0496112_0000487 3300048915 Bacteria 26669
192 Ga0496112_0093707 3300048915 Bacteria 2973
193 Ga0496113_0003580 3300048916 Bacteria 9323
194 Ga0496116_0005397 3300048919 Bacteria 11893
195 Ga0496116_0017773 3300048919 Bacteria 5507
196 Ga0496116_0117296 3300048919 Bacteria 1549
197 Ga0496116_0124041 3300048919 Bacteria 1487
198 Ga0496116_0299540 3300048919 Bacteria 766
199 Ga0496116_0326914 3300048919 Bacteria 715
200 Ga0496116_0379933 3300048919 Bacteria 634
201 Ga0496117_0020517 3300048920 Bacteria 5382
202 Ga0496117_0048432 3300048920 Bacteria 3036
203 Ga0496118_0008899 3300048921 Bacteria 10261
204 Ga0496119_0000670 3300048922 Bacteria 45979
205 Ga0496119_0022894 3300048922 Bacteria 4452
206 Ga0496120_0022182 3300048923 Bacteria 3997
207 Ga0496120_0024343 3300048923 Bacteria 3777
208 Ga0496121_0060975 3300048924 Bacteria 3098
209 Ga0496121_0081829 3300048924 Bacteria 2554
210 Ga0496121_0752508 3300048924 Bacteria 579
211 Ga0496122_0048200 3300048925 Bacteria 3279
212 Ga0496122_0058381 3300048925 Bacteria 2857
213 Ga0496122_0067091 3300048925 Bacteria 2586
214 Ga0496122_0074795 3300048925 Bacteria 2394
215 Ga0496122_0078545 3300048925 Bacteria 2311
216 Ga0496122_0162524 3300048925 Bacteria 1359
217 Ga0496122_0190162 3300048925 Bacteria 1213
218 Ga0496122_0197788 3300048925 Bacteria 1179
219 Ga0496122_0205444 3300048925 Bacteria 1147
220 Ga0496122_0338720 3300048925 Unclassified 791
221 Ga0496123_0002651 3300048926 Bacteria 21637
222 Ga0496123_0133558 3300048926 Bacteria 1370
223 Ga0496123_0142086 3300048926 Bacteria 1310
224 Ga0496124_0001526 3300048927 Bacteria 33706
225 Ga0496124_0027966 3300048927 Bacteria 5050
226 Ga0496124_0029177 3300048927 Bacteria 4921
227 Ga0496124_0032984 3300048927 Bacteria 4564
228 Ga0496124_0041193 3300048927 Bacteria 3989
229 Ga0496124_0084868 3300048927 Bacteria 2596
230 Ga0496125_0001139 3300048928 Bacteria 40438
231 Ga0496125_0004357 3300048928 Bacteria 16406
232 Ga0496125_0060292 3300048928 Bacteria 3051
233 Ga0496125_0304031 3300048928 Bacteria 976
234 Ga0496126_0004828 3300048929 Bacteria 15811
235 Ga0496126_0028467 3300048929 Bacteria 5324
236 Ga0501343_003373 3300049132 Bacteria 1172
237 Ga0501305_058946 3300049161 Bacteria 657
238 Ga0501291_101265 3300049514 Bacteria 601
239 Ga0501315_003493 3300049531 Bacteria 1578
240 Ga0501315_074638 3300049531 Bacteria 568
241 Ga0501317_105235 3300049533 Bacteria 513
242 Ga0501332_03837 3300049548 Bacteria 878
243 Ga0501337_022057 3300049553 Bacteria 523
244 Ga0501031_0501427 3300049568 Bacteria 783
245 Ga0501042_0988864 3300049578 Bacteria 613
246 Ga0501076_1636551 3300049592 Bacteria 528
247 Ga0501077_0671615 3300049593 Bacteria 666
248 Ga0501198_032177 3300049649 Bacteria 880
249 Ga0501217_010691 3300049661 Bacteria 2016
250 Ga0501217_114150 3300049661 Bacteria 778
251 Ga0501253_157496 3300049683 Bacteria 577
252 Ga0501221_008626 3300049704 Bacteria 1776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_101171014 Ga0075431_1011710142 123
2 3300049553 Ga0501337_022057 Ga0501337_022057_68_502 129
3 3300031852 Ga0307410_11635480 Ga0307410_116354801 135
4 3300049578 Ga0501042_0988864 Ga0501042_0988864_18_455 137
5 iso_pu_bacteria 2857357740 2857362322 139
6 iso_pu_bacteria 2791355222 2793183571 140
7 iso_pu_bacteria 8057473075 8057478016 140
8 iso_pu_bacteria 2510917027 2511177942 141
9 iso_pu_bacteria 2511231119 2511700728 141
10 iso_pu_bacteria 2512564013 2512638344 141
11 iso_pu_bacteria 2512564039 2512731828 141
12 iso_pu_bacteria 2540341094 2540607946 141
13 iso_pu_bacteria 2545555800 2545557425 141
14 iso_pu_bacteria 2554235283 2555470013 141
15 iso_pu_bacteria 2576861599 2578931692 141
16 iso_pu_bacteria 2593339198 2595317335 141
17 iso_pu_bacteria 2630968484 2631986333 141
18 iso_pu_bacteria 2643221676 2644426140 141
19 iso_pu_bacteria 2643221735 2644740374 141
20 iso_pu_bacteria 2648501850 2651532554 141
21 iso_pu_bacteria 2671180844 2674418449 141
22 iso_pu_bacteria 2684623153 2686998021 141
23 iso_pu_bacteria 2687453109 2687499367 141
24 iso_pu_bacteria 2695420354 2695628718 141
25 iso_pu_bacteria 2716884898 2717915587 141
26 iso_pu_bacteria 2808606399 2809056314 141
27 iso_pu_bacteria 2811994870 2812317220 141
28 iso_pu_bacteria 2816332295 2817481314 141
29 iso_pu_bacteria 2818991468 2819724296 141
30 iso_pu_bacteria 2823526263 2823529185 141
31 iso_pu_bacteria 2857586860 2857588023 141
32 iso_pu_bacteria 2860837431 2860840728 141
33 iso_pu_bacteria 2877768649 2877771644 141
34 iso_pu_bacteria 2880169592 2880172488 141
35 iso_pu_bacteria 2897109615 2897112761 141
36 iso_pu_bacteria 2904560550 2904564088 141
37 iso_pu_bacteria 2908665501 2908667612 141
38 iso_pu_bacteria 2915597211 2915599703 141
39 iso_pu_bacteria 2915606848 2915609293 141
40 iso_pu_bacteria 2919093281 2919095406 141
41 iso_pu_bacteria 2919726948 2919728886 141
42 iso_pu_bacteria 2929183550 2929184863 141
43 iso_pu_bacteria 2954773129 2954773274 141
44 iso_pu_bacteria 2962290636 2962293949 141
45 iso_pu_bacteria 2969136845 2969139934 141
46 iso_pu_bacteria 2969141011 2969144087 141
47 iso_pu_bacteria 2969765954 2969769598 141
48 iso_pu_bacteria 2969770375 2969772662 141
49 iso_pu_bacteria 2971893375 2971896310 141
50 iso_pu_bacteria 2980492589 2980495722 141
51 iso_pu_bacteria 3006858327 3006861738 141
52 iso_pu_bacteria 3006879489 3006882098 141
53 iso_pu_bacteria 3006978542 3006982369 141
54 iso_pu_bacteria 3006978542 3006983284 141
55 iso_pu_bacteria 8002317523 8002317760 141
56 iso_pu_bacteria 8022630665 8022632369 141
57 iso_pu_bacteria 8022653035 8022654888 141
58 iso_pu_bacteria 8022792930 8022797811 141
59 iso_pu_bacteria 8046991243 8046997057 141
60 iso_pu_bacteria 8051952484 8051954739 141
61 iso_pu_bacteria 8052174270 8052175118 141
62 iso_pu_bacteria 8055632911 8055632991 141
63 iso_pu_bacteria 8057632132 8057635906 141
64 iso_pu_bacteria 8057977335 8057981342 141
65 iso_pu_bacteria 2551306519 2553397059 142
66 iso_pu_bacteria 2599185353 2600199721 142
67 iso_pu_bacteria 2643221729 2644707359 142
68 iso_pu_bacteria 2643221730 2644714316 142
69 iso_pu_bacteria 2643221731 2644715446 142
70 iso_pu_bacteria 2643221732 2644726749 142
71 iso_pu_bacteria 2671180694 2673818086 142
72 iso_pu_bacteria 2684622632 2685153020 142
73 iso_pu_bacteria 2695420987 2698320161 142
74 iso_pu_bacteria 2703719227 2705996949 142
75 iso_pu_bacteria 2718218445 2721508168 142
76 iso_pu_bacteria 2738541299 2738840596 142
77 iso_pu_bacteria 2738541358 2739157205 142
78 iso_pu_bacteria 2738543006 2739209045 142
79 iso_pu_bacteria 2738543010 2739234552 142
80 iso_pu_bacteria 2788500588 2791212899 142
81 iso_pu_bacteria 2818991443 2819582482 142
82 iso_pu_bacteria 2818991451 2819625265 142
83 iso_pu_bacteria 2818991465 2819708914 142
84 iso_pu_bacteria 2842882022 2842884851 142
85 iso_pu_bacteria 2852673933 2852676331 142
86 iso_pu_bacteria 2857460504 2857460618 142
87 iso_pu_bacteria 2857604169 2857604668 142
88 iso_pu_bacteria 2857609550 2857610475 142
89 iso_pu_bacteria 2864997549 2864998124 142
90 iso_pu_bacteria 2889295896 2889299086 142
91 iso_pu_bacteria 2904524088 2904524119 142
92 iso_pu_bacteria 2904606771 2904607229 142
93 iso_pu_bacteria 2919143609 2919147304 142
94 iso_pu_bacteria 2919414237 2919419540 142
95 iso_pu_bacteria 2919517244 2919519209 142
96 iso_pu_bacteria 2919720352 2919723578 142
97 iso_pu_bacteria 2928093941 2928095896 142
98 iso_pu_bacteria 2928510474 2928513765 142
99 iso_pu_bacteria 2929004312 2929006733 142
100 iso_pu_bacteria 2929233124 2929238740 142
101 iso_pu_bacteria 2936361878 2936362319 142
102 iso_pu_bacteria 2938917290 2938922945 142
103 iso_pu_bacteria 2939593269 2939594317 142
104 iso_pu_bacteria 2947426588 2947431822 142
105 iso_pu_bacteria 2960319331 2960319515 142
106 iso_pu_bacteria 2960375949 2960381274 142
107 iso_pu_bacteria 2965761152 2965766348 142
108 iso_pu_bacteria 2979083700 2979088728 142
109 iso_pu_bacteria 2980125574 2980126069 142
110 iso_pu_bacteria 2981284811 2981288524 142
111 iso_pu_bacteria 2981289755 2981293345 142
112 iso_pu_bacteria 2981980479 2981983970 142
113 iso_pu_bacteria 2981985349 2981988893 142
114 iso_pu_bacteria 2990275345 2990276997 142
115 iso_pu_bacteria 8022621104 8022626531 142
116 iso_pu_bacteria 8022893055 8022898555 142
117 iso_pu_bacteria 8022914991 8022917705 142
118 iso_pu_bacteria 8023438354 8023441171 142
119 iso_pu_bacteria 8023444577 8023448718 142
120 iso_pu_bacteria 8054280661 8054280694 142
121 iso_pu_bacteria 8055531788 8055533782 142
122 iso_pu_bacteria 8057582654 8057587482 142
123 iso_pu_bacteria 2524023129 2524188752 143
124 iso_pu_bacteria 2593339131 2595091392 143
125 iso_pu_bacteria 2738541295 2738816877 143
126 iso_pu_bacteria 2738543017 2739269076 143
127 iso_pu_bacteria 2757320391 2757566718 143
128 iso_pu_bacteria 2775507177 2777761925 143
129 iso_pu_bacteria 2775507192 2777838981 143
130 iso_pu_bacteria 2888578766 2888579622 143
131 iso_pu_bacteria 2889049205 2889051758 143
132 iso_pu_bacteria 2936340661 2936345180 143
133 iso_pu_bacteria 2977254563 2977256116 143
134 iso_pu_bacteria 2996336353 2996339999 143
135 iso_pu_bacteria 3001267043 3001268851 143
136 iso_pu_bacteria 8022948649 8022950246 143
137 3300006163 Ga0070715_10545523 Ga0070715_105455231 144
138 3300046665 Ga0495661_0107384 Ga0495661_0107384_920_1354 144
139 3300048913 Ga0496110_0014535 Ga0496110_0014535_691_1125 144
140 3300048914 Ga0496111_0807238 Ga0496111_0807238_160_594 144
141 3300048915 Ga0496112_0093707 Ga0496112_0093707_1361_1795 144
142 3300048919 Ga0496116_0117296 Ga0496116_0117296_238_672 144
143 3300048925 Ga0496122_0048200 Ga0496122_0048200_1946_2380 144
144 3300048925 Ga0496122_0338720 Ga0496122_0338720_99_533 144
145 3300048926 Ga0496123_0002651 Ga0496123_0002651_1072_1506 144
146 3300048927 Ga0496124_0001526 Ga0496124_0001526_14110_14544 144
147 3300048928 Ga0496125_0004357 Ga0496125_0004357_8702_9136 144
148 iso_pu_bacteria 2585428059 2587739673 144
149 iso_pu_bacteria 2600254943 2600402702 144
150 iso_pu_bacteria 3006988479 3006988514 144
151 3300003187 JGI25151J46595_10000302 JGI25151J46595_1000030222 145
152 3300003187 JGI25151J46595_10000993 JGI25151J46595_1000099319 145
153 3300003187 JGI25151J46595_10013071 JGI25151J46595_100130713 145
154 3300003187 JGI25151J46595_10022227 JGI25151J46595_100222273 145
155 3300003578 Ga0006562J51391_1000700 Ga0006562J51391_10007009 145
156 3300003578 Ga0006562J51391_1017394 Ga0006562J51391_10173941 145
157 3300003758 Ga0055532_1000024 Ga0055532_1000024107 145
158 3300003758 Ga0055532_1000610 Ga0055532_10006108 145
159 3300003781 Ga0055536_1002691 Ga0055536_10026912 145
160 3300003781 Ga0055536_1009624 Ga0055536_10096242 145
161 3300025225 Ga0209566_100139 Ga0209566_10013977 145
162 3300025225 Ga0209566_109691 Ga0209566_1096912 145
163 3300025229 Ga0209147_100020 Ga0209147_100020257 145
164 3300025229 Ga0209147_100054 Ga0209147_100054204 145
165 3300025229 Ga0209147_103242 Ga0209147_1032424 145
166 3300025284 Ga0209130_1026010 Ga0209130_10260101 145
167 3300025291 Ga0209675_1007411 Ga0209675_10074115 145
168 3300025291 Ga0209675_1054879 Ga0209675_10548792 145
169 3300025292 Ga0209676_1000274 Ga0209676_100027453 145
170 3300025294 Ga0209025_1000001 Ga0209025_100000134 145
171 3300025294 Ga0209025_1000043 Ga0209025_1000043179 145
172 3300025294 Ga0209025_1000262 Ga0209025_1000262128 145
173 3300025294 Ga0209025_1005266 Ga0209025_10052663 145
174 3300025294 Ga0209025_1008528 Ga0209025_10085286 145
175 3300025294 Ga0209025_1073727 Ga0209025_10737271 145
176 3300037418 Ga0395900_0787099 Ga0395900_0787099_64_513 145
177 3300037466 Ga0395898_1123493 Ga0395898_1123493_50_499 145
178 3300041404 Ga0439436_0003912 Ga0439436_0003912_1939_2376 145
179 3300041406 Ga0439439_0001486 Ga0439439_0001486_1492_1929 145
180 3300041999 Ga0439433_0019101 Ga0439433_0019101_359_796 145
181 3300042007 Ga0439449_0001726 Ga0439449_0001726_4548_4985 145
182 3300042007 Ga0439449_0031323 Ga0439449_0031323_1488_1925 145
183 3300042014 Ga0439457_006140 Ga0439457_006140_1953_2390 145
184 3300042015 Ga0439462_0009116 Ga0439462_0009116_134_571 145
185 3300042015 Ga0439462_0049205 Ga0439462_0049205_445_882 145
186 3300044656 Ga0466969_0001169 Ga0466969_0001169_6688_7134 145
187 3300045976 Ga0466967_0212078 Ga0466967_0212078_197_634 145
188 3300046694 Ga0495649_0287622 Ga0495649_0287622_51_488 145
189 3300048091 Ga0495626_0191172 Ga0495626_0191172_19_456 145
190 3300048905 Ga0496102_0018785 Ga0496102_0018785_1651_2103 145
191 3300048906 Ga0496103_0122348 Ga0496103_0122348_496_948 145
192 3300048919 Ga0496116_0124041 Ga0496116_0124041_780_1256 145
193 3300048919 Ga0496116_0326914 Ga0496116_0326914_138_575 145
194 3300048919 Ga0496116_0379933 Ga0496116_0379933_105_542 145
195 3300048920 Ga0496117_0020517 Ga0496117_0020517_4650_5150 145
196 3300048921 Ga0496118_0008899 Ga0496118_0008899_3455_3955 145
197 3300048922 Ga0496119_0022894 Ga0496119_0022894_3255_3755 145
198 3300048923 Ga0496120_0022182 Ga0496120_0022182_2337_2837 145
199 3300048924 Ga0496121_0060975 Ga0496121_0060975_1018_1494 145
200 3300048924 Ga0496121_0081829 Ga0496121_0081829_950_1450 145
201 3300048925 Ga0496122_0058381 Ga0496122_0058381_1593_2084 145
202 3300048925 Ga0496122_0074795 Ga0496122_0074795_945_1382 145
203 3300048925 Ga0496122_0162524 Ga0496122_0162524_639_1139 145
204 3300048925 Ga0496122_0190162 Ga0496122_0190162_243_719 145
205 3300048926 Ga0496123_0142086 Ga0496123_0142086_174_674 145
206 3300048927 Ga0496124_0029177 Ga0496124_0029177_2121_2597 145
207 3300048928 Ga0496125_0001139 Ga0496125_0001139_35042_35542 145
208 3300048929 Ga0496126_0028467 Ga0496126_0028467_1043_1543 145
209 3300049592 Ga0501076_1636551 Ga0501076_1636551_67_513 145
210 iso_pu_bacteria 2579778775 2580930867 145
211 iso_pu_bacteria 2585428059 2587740817 145
212 iso_pu_bacteria 2593339131 2595090068 145
213 iso_pu_bacteria 2600255286 2601639865 145
214 iso_pu_bacteria 2619619294 2621273736 145
215 iso_pu_bacteria 2643221676 2644427781 145
216 iso_pu_bacteria 2721755693 2723606519 145
217 iso_pu_bacteria 2728369359 2730137115 145
218 iso_pu_bacteria 2738543017 2739271135 145
219 iso_pu_bacteria 2751185905 2753808826 145
220 iso_pu_bacteria 2757320391 2757567591 145
221 iso_pu_bacteria 2775507177 2777760855 145
222 iso_pu_bacteria 2775507192 2777836269 145
223 iso_pu_bacteria 2802428803 2802437814 145
224 iso_pu_bacteria 2818991459 2819672098 145
225 iso_pu_bacteria 2857453340 2857455882 145
226 iso_pu_bacteria 2857465823 2857471914 145
227 iso_pu_bacteria 2857586860 2857590098 145
228 iso_pu_bacteria 2857591370 2857594233 145
229 iso_pu_bacteria 2881636855 2881638207 145
230 iso_pu_bacteria 2881644220 2881648683 145
231 iso_pu_bacteria 2889276214 2889277073 145
232 iso_pu_bacteria 2904595352 2904596240 145
233 iso_pu_bacteria 2904755435 2904759001 145
234 iso_pu_bacteria 2919425241 2919426210 145
235 iso_pu_bacteria 2919425241 2919429924 145
236 iso_pu_bacteria 2929206907 2929208083 145
237 iso_pu_bacteria 2936340661 2936345516 145
238 iso_pu_bacteria 2939702853 2939703053 145
239 iso_pu_bacteria 2971410472 2971412100 145
240 iso_pu_bacteria 2980182181 2980186456 145
241 iso_pu_bacteria 2996706504 2996710751 145
242 iso_pu_bacteria 3001272096 3001274326 145
243 iso_pu_bacteria 3006984091 3006984120 145
244 iso_pu_bacteria 648028048 648172498 145
245 iso_pu_bacteria 8055632911 8055634393 145
246 iso_pu_bacteria 8056533031 8056535102 145
247 3300002987 JGI25159J45721_1009471 JGI25159J45721_10094712 146
248 3300003187 JGI25151J46595_10000747 JGI25151J46595_100007477 146
249 3300003187 JGI25151J46595_10012089 JGI25151J46595_100120894 146
250 3300003187 JGI25151J46595_10023653 JGI25151J46595_100236532 146
251 3300003187 JGI25151J46595_10076031 JGI25151J46595_100760312 146
252 3300003187 JGI25151J46595_10082623 JGI25151J46595_100826232 146
253 3300003187 JGI25151J46595_10137708 JGI25151J46595_101377081 146
254 3300003320 rootH2_10041601 rootH2_100416014 146
255 3300003322 rootL2_10013974 rootL2_1001397431 146
256 3300003323 rootH1_10364009 rootH1_103640096 146
257 3300003578 Ga0006562J51391_1010313 Ga0006562J51391_10103131 146
258 3300003751 Ga0055538_1000108 Ga0055538_100010862 146
259 3300003758 Ga0055532_1000060 Ga0055532_100006024 146
260 3300003758 Ga0055532_1000756 Ga0055532_10007566 146
261 3300003758 Ga0055532_1002278 Ga0055532_10022783 146
262 3300003781 Ga0055536_1014101 Ga0055536_10141013 146
263 3300003790 Ga0055528_1003904 Ga0055528_10039045 146
264 3300005353 Ga0070669_100176684 Ga0070669_1001766842 146
265 3300005353 Ga0070669_100551787 Ga0070669_1005517871 146
266 3300005354 Ga0070675_100528416 Ga0070675_1005284162 146
267 3300005355 Ga0070671_100038401 Ga0070671_1000384015 146
268 3300009011 Ga0105251_10008147 Ga0105251_100081475 146
269 3300009011 Ga0105251_10088663 Ga0105251_100886632 146
270 3300009036 Ga0105244_10002902 Ga0105244_100029025 146
271 3300009036 Ga0105244_10018217 Ga0105244_100182175 146
272 3300009036 Ga0105244_10065935 Ga0105244_100659352 146
273 3300009036 Ga0105244_10114274 Ga0105244_101142742 146
274 3300009036 Ga0105244_10364364 Ga0105244_103643641 146
275 3300009092 Ga0105250_10005299 Ga0105250_100052996 146
276 3300009092 Ga0105250_10141303 Ga0105250_101413031 146
277 3300009092 Ga0105250_10530617 Ga0105250_105306171 146
278 3300009098 Ga0105245_10292446 Ga0105245_102924463 146
279 3300009101 Ga0105247_10018143 Ga0105247_100181435 146
280 3300009148 Ga0105243_10001879 Ga0105243_1000187921 146
281 3300009148 Ga0105243_10373872 Ga0105243_103738723 146
282 3300009176 Ga0105242_10079962 Ga0105242_100799625 146
283 3300009553 Ga0105249_10295242 Ga0105249_102952423 146
284 3300010375 Ga0105239_10201252 Ga0105239_102012522 146
285 3300011119 Ga0105246_10008815 Ga0105246_100088156 146
286 3300011119 Ga0105246_10018365 Ga0105246_100183655 146
287 3300011119 Ga0105246_11786271 Ga0105246_117862711 146
288 3300013297 Ga0157378_10002050 Ga0157378_100020502 146
289 3300014325 Ga0163163_11551489 Ga0163163_115514891 146
290 3300014745 Ga0157377_10007811 Ga0157377_100078114 146
291 3300014969 Ga0157376_10064061 Ga0157376_100640615 146
292 3300025224 Ga0209784_100100 Ga0209784_10010087 146
293 3300025229 Ga0209147_100054 Ga0209147_10005475 146
294 3300025229 Ga0209147_100080 Ga0209147_100080126 146
295 3300025229 Ga0209147_100312 Ga0209147_1003128 146
296 3300025229 Ga0209147_110966 Ga0209147_1109661 146
297 3300025233 Ga0209437_101010 Ga0209437_1010104 146
298 3300025273 Ga0209673_1008737 Ga0209673_10087377 146
299 3300025284 Ga0209130_1000320 Ga0209130_100032059 146
300 3300025284 Ga0209130_1004430 Ga0209130_10044304 146
301 3300025291 Ga0209675_1010349 Ga0209675_10103495 146
302 3300025292 Ga0209676_1000597 Ga0209676_100059732 146
303 3300025292 Ga0209676_1009235 Ga0209676_10092354 146
304 3300025292 Ga0209676_1054856 Ga0209676_10548562 146
305 3300025292 Ga0209676_1090739 Ga0209676_10907391 146
306 3300025294 Ga0209025_1000170 Ga0209025_10001709 146
307 3300025294 Ga0209025_1000433 Ga0209025_100043343 146
308 3300025294 Ga0209025_1001857 Ga0209025_100185715 146
309 3300025294 Ga0209025_1002061 Ga0209025_100206114 146
310 3300025294 Ga0209025_1002449 Ga0209025_10024492 146
311 3300025294 Ga0209025_1003052 Ga0209025_100305217 146
312 3300025294 Ga0209025_1006096 Ga0209025_10060963 146
313 3300025294 Ga0209025_1009239 Ga0209025_10092398 146
314 3300025294 Ga0209025_1009914 Ga0209025_10099145 146
315 3300025294 Ga0209025_1014353 Ga0209025_10143531 146
316 3300025294 Ga0209025_1035613 Ga0209025_10356132 146
317 3300025294 Ga0209025_1089466 Ga0209025_10894662 146
318 3300025302 Ga0207426_1060439 Ga0207426_10604392 146
319 3300025711 Ga0207696_1000479 Ga0207696_10004799 146
320 3300025711 Ga0207696_1001916 Ga0207696_10019167 146
321 3300025711 Ga0207696_1002758 Ga0207696_10027585 146
322 3300025728 Ga0207655_1017140 Ga0207655_10171405 146
323 3300025728 Ga0207655_1033821 Ga0207655_10338212 146
324 3300025728 Ga0207655_1073141 Ga0207655_10731411 146
325 3300025735 Ga0207713_1004372 Ga0207713_10043725 146
326 3300025735 Ga0207713_1034826 Ga0207713_10348261 146
327 3300025735 Ga0207713_1040714 Ga0207713_10407144 146
328 3300025735 Ga0207713_1048472 Ga0207713_10484721 146
329 3300025735 Ga0207713_1064818 Ga0207713_10648182 146
330 3300025900 Ga0207710_10033695 Ga0207710_100336953 146
331 3300025907 Ga0207645_10559827 Ga0207645_105598272 146
332 3300025923 Ga0207681_10060786 Ga0207681_100607861 146
333 3300025923 Ga0207681_10394181 Ga0207681_103941812 146
334 3300025925 Ga0207650_10293087 Ga0207650_102930872 146
335 3300025926 Ga0207659_10281347 Ga0207659_102813472 146
336 3300025926 Ga0207659_10982227 Ga0207659_109822271 146
337 3300025927 Ga0207687_10435845 Ga0207687_104358451 146
338 3300025934 Ga0207686_10048175 Ga0207686_100481751 146
339 3300025935 Ga0207709_10016523 Ga0207709_100165234 146
340 3300025935 Ga0207709_11097608 Ga0207709_110976081 146
341 3300025961 Ga0207712_10451146 Ga0207712_104511462 146
342 3300028379 Ga0268266_10884380 Ga0268266_108843802 146
343 3300030083 Ga0237817_10024 Ga0237817_1002442 146
344 3300030083 Ga0237817_10986 Ga0237817_109862 146
345 3300030083 Ga0237817_11186 Ga0237817_111862 146
346 3300031548 Ga0307408_100354316 Ga0307408_1003543163 146
347 3300031548 Ga0307408_101729494 Ga0307408_1017294941 146
348 3300031731 Ga0307405_11541321 Ga0307405_115413211 146
349 3300031995 Ga0307409_100011167 Ga0307409_1000111673 146
350 3300031995 Ga0307409_100779355 Ga0307409_1007793551 146
351 3300032002 Ga0307416_100014947 Ga0307416_1000149474 146
352 3300032002 Ga0307416_100242127 Ga0307416_1002421271 146
353 3300038705 Ga0237819_00348 Ga0237819_00348_1683_2123 146
354 3300038705 Ga0237819_00577 Ga0237819_00577_9268_9708 146
355 3300045976 Ga0466967_0009686 Ga0466967_0009686_6657_7097 146
356 3300045976 Ga0466967_1236348 Ga0466967_1236348_53_493 146
357 3300046455 Ga0495603_0064131 Ga0495603_0064131_1607_2047 146
358 3300046491 Ga0495584_0044049 Ga0495584_0044049_1594_2034 146
359 3300046492 Ga0495585_0008512 Ga0495585_0008512_3144_3584 146
360 3300046520 Ga0495637_0138253 Ga0495637_0138253_388_834 146
361 3300046530 Ga0495654_0074503 Ga0495654_0074503_178_693 146
362 3300046542 Ga0495597_0275085 Ga0495597_0275085_87_533 146
363 3300046558 Ga0495633_0234228 Ga0495633_0234228_370_810 146
364 3300046648 Ga0495611_0199652 Ga0495611_0199652_420_860 146
365 3300046665 Ga0495661_0051259 Ga0495661_0051259_916_1362 146
366 3300046665 Ga0495661_0068887 Ga0495661_0068887_884_1399 146
367 3300046691 Ga0495670_0039371 Ga0495670_0039371_1720_2166 146
368 3300046810 Ga0495660_0031812 Ga0495660_0031812_95_541 146
369 3300047321 Ga0495676_0058790 Ga0495676_0058790_2480_2920 146
370 3300047323 Ga0495683_0096267 Ga0495683_0096267_871_1311 146
371 3300048091 Ga0495626_0124350 Ga0495626_0124350_52_504 146
372 3300048091 Ga0495626_0300586 Ga0495626_0300586_166_612 146
373 3300048903 Ga0496100_0000519 Ga0496100_0000519_13554_13994 146
374 3300048904 Ga0496101_0007109 Ga0496101_0007109_5707_6147 146
375 3300048905 Ga0496102_0001666 Ga0496102_0001666_7083_7523 146
376 3300048905 Ga0496102_0058745 Ga0496102_0058745_2410_2853 146
377 3300048905 Ga0496102_0841706 Ga0496102_0841706_46_498 146
378 3300048906 Ga0496103_0001204 Ga0496103_0001204_8211_8651 146
379 3300048907 Ga0496104_0000832 Ga0496104_0000832_17259_17699 146
380 3300048908 Ga0496105_0000067 Ga0496105_0000067_54894_55334 146
381 3300048909 Ga0496106_0002301 Ga0496106_0002301_3504_3944 146
382 3300048909 Ga0496106_1050127 Ga0496106_1050127_179_622 146
383 3300048910 Ga0496107_0000724 Ga0496107_0000724_1297_1737 146
384 3300048911 Ga0496108_0003318 Ga0496108_0003318_10299_10739 146
385 3300048912 Ga0496109_0000906 Ga0496109_0000906_6882_7322 146
386 3300048913 Ga0496110_0009002 Ga0496110_0009002_6557_6997 146
387 3300048913 Ga0496110_0487214 Ga0496110_0487214_413_859 146
388 3300048913 Ga0496110_1566952 Ga0496110_1566952_15_455 146
389 3300048914 Ga0496111_0002271 Ga0496111_0002271_10014_10454 146
390 3300048914 Ga0496111_0593968 Ga0496111_0593968_185_631 146
391 3300048915 Ga0496112_0000487 Ga0496112_0000487_1295_1735 146
392 3300048916 Ga0496113_0003580 Ga0496113_0003580_1219_1659 146
393 3300048919 Ga0496116_0005397 Ga0496116_0005397_2619_3059 146
394 3300048919 Ga0496116_0017773 Ga0496116_0017773_4390_4842 146
395 3300048919 Ga0496116_0299540 Ga0496116_0299540_216_695 146
396 3300048920 Ga0496117_0048432 Ga0496117_0048432_2577_3017 146
397 3300048922 Ga0496119_0000670 Ga0496119_0000670_77_517 146
398 3300048923 Ga0496120_0024343 Ga0496120_0024343_136_576 146
399 3300048924 Ga0496121_0752508 Ga0496121_0752508_71_523 146
400 3300048925 Ga0496122_0067091 Ga0496122_0067091_1056_1496 146
401 3300048925 Ga0496122_0078545 Ga0496122_0078545_1565_2044 146
402 3300048925 Ga0496122_0197788 Ga0496122_0197788_306_761 146
403 3300048925 Ga0496122_0205444 Ga0496122_0205444_223_675 146
404 3300048926 Ga0496123_0133558 Ga0496123_0133558_651_1091 146
405 3300048927 Ga0496124_0027966 Ga0496124_0027966_4541_5020 146
406 3300048927 Ga0496124_0032984 Ga0496124_0032984_585_1037 146
407 3300048927 Ga0496124_0041193 Ga0496124_0041193_58_537 146
408 3300048927 Ga0496124_0084868 Ga0496124_0084868_1263_1703 146
409 3300048928 Ga0496125_0060292 Ga0496125_0060292_901_1341 146
410 3300048928 Ga0496125_0304031 Ga0496125_0304031_143_622 146
411 3300048929 Ga0496126_0004828 Ga0496126_0004828_14154_14594 146
412 3300049132 Ga0501343_003373 Ga0501343_003373_149_595 146
413 3300049161 Ga0501305_058946 Ga0501305_058946_21_479 146
414 3300049514 Ga0501291_101265 Ga0501291_101265_91_537 146
415 3300049531 Ga0501315_003493 Ga0501315_003493_1119_1565 146
416 3300049531 Ga0501315_074638 Ga0501315_074638_107_553 146
417 3300049533 Ga0501317_105235 Ga0501317_105235_14_460 146
418 3300049548 Ga0501332_03837 Ga0501332_03837_421_867 146
419 3300049568 Ga0501031_0501427 Ga0501031_0501427_219_659 146
420 3300049593 Ga0501077_0671615 Ga0501077_0671615_57_497 146
421 3300049649 Ga0501198_032177 Ga0501198_032177_77_523 146
422 3300049661 Ga0501217_010691 Ga0501217_010691_371_817 146
423 3300049661 Ga0501217_114150 Ga0501217_114150_297_743 146
424 3300049683 Ga0501253_157496 Ga0501253_157496_42_488 146
425 3300049704 Ga0501221_008626 Ga0501221_008626_395_841 146
426 iso_pu_bacteria 2510917027 2511180179 146
427 iso_pu_bacteria 2511231119 2511701008 146
428 iso_pu_bacteria 2512564013 2512639830 146
429 iso_pu_bacteria 2512564039 2512736790 146
430 iso_pu_bacteria 2524023129 2524189200 146
431 iso_pu_bacteria 2545555800 2545559471 146
432 iso_pu_bacteria 2554235469 2556062574 146
433 iso_pu_bacteria 2576861599 2578930427 146
434 iso_pu_bacteria 2585428059 2587741848 146
435 iso_pu_bacteria 2630968484 2631986470 146
436 iso_pu_bacteria 2643221676 2644424704 146
437 iso_pu_bacteria 2648501850 2651530626 146
438 iso_pu_bacteria 2671180844 2674422052 146
439 iso_pu_bacteria 2695420354 2695628963 146
440 iso_pu_bacteria 2711768088 2712197813 146
441 iso_pu_bacteria 2716884898 2717915337 146
442 iso_pu_bacteria 2818991459 2819675290 146
443 iso_pu_bacteria 2857465823 2857470328 146
444 iso_pu_bacteria 2857591370 2857594028 146
445 iso_pu_bacteria 2857591370 2857595352 146
446 iso_pu_bacteria 2865002811 2865005428 146
447 iso_pu_bacteria 2877768649 2877771895 146
448 iso_pu_bacteria 2880169592 2880172734 146
449 iso_pu_bacteria 2889042446 2889048314 146
450 iso_pu_bacteria 2897109615 2897113010 146
451 iso_pu_bacteria 2904113452 2904113784 146
452 iso_pu_bacteria 2904490793 2904494571 146
453 iso_pu_bacteria 2904560550 2904561331 146
454 iso_pu_bacteria 2915597211 2915599846 146
455 iso_pu_bacteria 2915606848 2915609397 146
456 iso_pu_bacteria 2919160200 2919164281 146
457 iso_pu_bacteria 2929183550 2929185023 146
458 iso_pu_bacteria 2931384279 2931385431 146
459 iso_pu_bacteria 2939679117 2939680387 146
460 iso_pu_bacteria 2945991243 2945995929 146
461 iso_pu_bacteria 2946053406 2946058635 146
462 iso_pu_bacteria 2969141011 2969144446 146
463 iso_pu_bacteria 2971893375 2971896568 146
464 iso_pu_bacteria 2984527788 2984531478 146
465 iso_pu_bacteria 2984532647 2984532732 146
466 iso_pu_bacteria 3006969106 3006971687 146
467 iso_pu_bacteria 8022630665 8022633160 146
468 iso_pu_bacteria 8051952484 8051954490 146
469 iso_pu_bacteria 8052174270 8052175428 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

29

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n1q-assembly1.cif.gz_A crystal structure of a dps protein from bacillus brevis 0.9988 2 144
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9973 3 144
1ji5-assembly1.cif.gz_A dlp-1 from bacillus anthracis 0.9969 5 144
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.9914 1 144
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9871 2 144
ID Description Score Start End Superfamily
1n1qA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9988 2 144 1.20.1260.10
1ji5D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9984 5 144 1.20.1260.10
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9871 2 144 1.20.1260.10
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9844 1 144 1.20.1260.10
1qghA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9784 5 146 1.20.1260.10
ID Description Score Start End GO Terms
AF-Q8RPQ2-F1-model_v4 DNA protection during starvation protein 2 (EC 1.16.-.-) 1.004 1 146 GO:0005737
GO:0006879
GO:0008199
GO:0016722
AF-A0A2B4MTW8-F1-model_v4 DNA starvation/stationary phase protection protein 1.003 1 146 GO:0008199
GO:0016722
AF-A0A7Z1JKD0-F1-model_v4 deleted 1.002 1 146
AF-A0A4V5TWF2-F1-model_v4 deleted 1.002 26 146
AF-A0A4Q9E074-F1-model_v4 DNA starvation/stationary phase protection protein 1.001 5 144 GO:0008199

Feature Viewer

pLDDT pTM Quality
97.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map