metagRoot

F450165

General Info

Members	Datasets	Scaffolds	Average Seq Length
469	290	938	94

Family's Representative Sequence

Representative Sequence	3300003320\|rootH2_10045491\|rootH2_100454915
Length	109
Sequence	VSAEPQEGQSPVYRRRLIGRVASDKMDKTVVVEVVRFKRDAVYKKYVRVRKRYHAHDEKNEYKTGDRVEIIEHRPLSRQKRWAVTRLIARPATELVGGHVEAAQKAAEP

Samples

	Sample ID	Description	Type	Environment
1	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
2	3300002863	Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
3	3300002865	Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
4	3300002870	Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
5	3300002872	Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
6	3300003161	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
7	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
8	3300003300	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
9	3300003305	Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
10	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
11	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
12	3300003717	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
13	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
14	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
15	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
16	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
19	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
20	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
21	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
22	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
23	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
24	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
25	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
26	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
27	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
28	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
29	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
30	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
31	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
40	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
41	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
42	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
43	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
44	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
45	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
46	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
47	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
48	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
49	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
50	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
51	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
52	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
53	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
54	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
55	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
56	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
57	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
58	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
59	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
60	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
61	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
62	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
63	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
64	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
65	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
66	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
67	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
68	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
69	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
70	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
71	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
72	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
73	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
74	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
75	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
76	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
77	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
78	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
79	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
80	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
81	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
82	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
83	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
88	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
90	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
91	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
93	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
94	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
95	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
96	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
97	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
98	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
99	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
100	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
101	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
102	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
103	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
104	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
105	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
106	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
112	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
113	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
170	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
174	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
175	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
176	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
177	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
178	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
179	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
180	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
181	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
182	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
183	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
184	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
185	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
186	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
187	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
188	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
189	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
190	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
191	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
192	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
193	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
194	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
195	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
196	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
197	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
198	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
199	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
200	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
201	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
202	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
203	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
204	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
205	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
206	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
207	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
208	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
209	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
210	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
211	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
212	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
213	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
214	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
215	3300041464	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT	Metatranscriptome	Rhizoplane
216	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
217	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
218	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
219	3300041506	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT	Metatranscriptome	Unclassified
220	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
221	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
222	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
223	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
224	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
225	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
226	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
227	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
228	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
229	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
230	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
231	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
232	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
233	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
234	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
235	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
236	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
237	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
238	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
239	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
240	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
241	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
242	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
243	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
244	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
245	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
246	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
247	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
248	3300049529	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
249	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
250	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
251	3300049542	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
252	3300049556	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
253	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
254	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
260	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
264	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
265	3300049657	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought	Metagenome	Rhizosphere
266	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
267	3300049674	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought	Metagenome	Rhizosphere
268	3300049676	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control	Metagenome	Rhizosphere
269	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
270	3300049689	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought	Metagenome	Rhizosphere
271	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
272	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
273	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
276	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
277	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
278	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
279	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
280	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
281	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
282	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
283	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
284	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
285	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
286	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
287	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
288	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
289	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
290	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	88.27
Metatranscriptomes	11.73
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.62
Nodule	0
Rhizoplane	5.33
Rhizosphere	84.86
Stem	0
Stem Tuber	0
Unclassified	1.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH2_10045491	3300003320	Bacteria	3605
2	Ga0006769J43182_104289	3300002863	Bacteria	1186
3	Ga0006769J43182_106300	3300002863	Bacteria	758
4	Ga0006761J43178_107109	3300002865	Bacteria	508
5	Ga0006763J43179_108456	3300002870	Bacteria	665
6	Ga0006762J43184_109605	3300002872	Unclassified	610
7	Ga0006765J45826_111039	3300003161	Bacteria	1101
8	Ga0006759J45824_1027396	3300003163	Bacteria	1543
9	Ga0006759J45824_1029961	3300003163	Bacteria	6330
10	Ga0006759J45824_1037748	3300003163	Bacteria	1087
11	Ga0006759J45824_1039453	3300003163	Bacteria	2123
12	Ga0006758J48902_1009221	3300003300	Bacteria	1961
13	Ga0006758J48902_1009222	3300003300	Bacteria	1430
14	Ga0006758J48902_1009598	3300003300	Bacteria	4274
15	Ga0006758J48902_1012886	3300003300	Bacteria	2834
16	Ga0006758J48902_1021124	3300003300	Bacteria	508
17	Ga0006770J48903_1016726	3300003305	Bacteria	2195
18	rootH1_10015553	3300003323	Bacteria	3043
19	rootH1_10015554	3300003323	Bacteria	1679
20	Ga0032354_1050569	3300003693	Bacteria	911
21	Ga0032354_1123461	3300003693	Bacteria	549
22	Ga0006766_120163	3300003717	Bacteria	664
23	Ga0058859_11363661	3300004798	Bacteria	639
24	Ga0058859_11666696	3300004798	Bacteria	530
25	Ga0058859_11793010	3300004798	Bacteria	1259
26	Ga0058860_11423517	3300004801	Bacteria	555
27	Ga0058860_12230108	3300004801	Bacteria	926
28	Ga0065717_1013978	3300005276	Bacteria	546
29	Ga0065707_11084460	3300005295	Bacteria	519
30	Ga0070676_10018293	3300005328	Bacteria	3881
31	Ga0070683_100241547	3300005329	Bacteria	1718
32	Ga0070683_100803732	3300005329	Bacteria	902
33	Ga0070683_102191005	3300005329	Bacteria	530
34	Ga0070690_100558134	3300005330	Bacteria	864
35	Ga0070690_100664315	3300005330	Bacteria	797
36	Ga0070670_100337869	3300005331	Bacteria	1322
37	Ga0070677_10024571	3300005333	Bacteria	2242
38	Ga0070677_10081789	3300005333	Bacteria	1383
39	Ga0068869_100050185	3300005334	Bacteria	3023
40	Ga0068869_101184256	3300005334	Bacteria	671
41	Ga0070680_100354549	3300005336	Bacteria	1248
42	Ga0070682_100000787	3300005337	Bacteria	18636
43	Ga0070682_100016985	3300005337	Bacteria	4237
44	Ga0070682_100139853	3300005337	Bacteria	1649
45	Ga0070682_101237566	3300005337	Bacteria	632
46	Ga0070682_101649650	3300005337	Bacteria	556
47	Ga0070682_101693088	3300005337	Bacteria	549
48	Ga0070682_101843434	3300005337	Bacteria	529
49	Ga0068868_100160818	3300005338	Bacteria	1854
50	Ga0068868_100923284	3300005338	Bacteria	794
51	Ga0070660_100406772	3300005339	Bacteria	1126
52	Ga0070689_100068193	3300005340	Bacteria	2774
53	Ga0070689_100124190	3300005340	Bacteria	2064
54	Ga0070689_100342599	3300005340	Bacteria	1252
55	Ga0070689_100688822	3300005340	Bacteria	892
56	Ga0070691_10060647	3300005341	Bacteria	1819
57	Ga0070687_101406173	3300005343	Bacteria	522
58	Ga0070692_10149633	3300005345	Bacteria	1328
59	Ga0070668_100028739	3300005347	Bacteria	4219
60	Ga0070669_100025363	3300005353	Bacteria	4257
61	Ga0070675_100183980	3300005354	Bacteria	1808
62	Ga0070675_100195961	3300005354	Bacteria	1752
63	Ga0070675_100318549	3300005354	Bacteria	1373
64	Ga0070671_100191826	3300005355	Bacteria	1732
65	Ga0070674_100007457	3300005356	Bacteria	6453
66	Ga0070674_100367453	3300005356	Bacteria	1167
67	Ga0070673_100051191	3300005364	Bacteria	3232
68	Ga0070673_100071173	3300005364	Bacteria	2793
69	Ga0070673_100677707	3300005364	Bacteria	945
70	Ga0070688_100081462	3300005365	Bacteria	2096
71	Ga0070688_100426728	3300005365	Bacteria	986
72	Ga0070688_100874058	3300005365	Bacteria	707
73	Ga0070659_100169875	3300005366	Bacteria	1786
74	Ga0070713_101097969	3300005436	Bacteria	769
75	Ga0070701_10085332	3300005438	Bacteria	1719
76	Ga0070705_100852754	3300005440	Bacteria	729
77	Ga0070700_100727749	3300005441	Bacteria	792
78	Ga0070694_100586888	3300005444	Bacteria	896
79	Ga0070663_100466825	3300005455	Bacteria	1043
80	Ga0070678_100804705	3300005456	Bacteria	854
81	Ga0070662_100093375	3300005457	Bacteria	2263
82	Ga0070681_10212292	3300005458	Bacteria	1851
83	Ga0070681_11003005	3300005458	Bacteria	755
84	Ga0068867_100016292	3300005459	Bacteria	5278
85	Ga0070685_10052930	3300005466	Bacteria	2350
86	Ga0070685_10088782	3300005466	Bacteria	1867
87	Ga0070685_10603653	3300005466	Bacteria	790
88	Ga0070685_10858064	3300005466	Bacteria	673
89	Ga0070685_11045815	3300005466	Bacteria	614
90	Ga0070706_100500942	3300005467	Bacteria	1130
91	Ga0070684_100086123	3300005535	Bacteria	2788
92	Ga0070684_100501115	3300005535	Bacteria	1125
93	Ga0070684_101318129	3300005535	Bacteria	680
94	Ga0068853_100558747	3300005539	Bacteria	1085
95	Ga0068853_100622443	3300005539	Bacteria	1026
96	Ga0068853_102207948	3300005539	Bacteria	534
97	Ga0068853_102235865	3300005539	Bacteria	530
98	Ga0070672_100005856	3300005543	Bacteria	8198
99	Ga0070672_100074196	3300005543	Bacteria	2713
100	Ga0070672_100083257	3300005543	Bacteria	2567
101	Ga0070672_100188208	3300005543	Bacteria	1722
102	Ga0070672_100189079	3300005543	Bacteria	1718
103	Ga0070686_100022242	3300005544	Bacteria	3774
104	Ga0070686_101267123	3300005544	Bacteria	614
105	Ga0070695_100147012	3300005545	Bacteria	1641
106	Ga0070693_100339727	3300005547	Bacteria	1024
107	Ga0070665_100826267	3300005548	Bacteria	940
108	Ga0070665_101890826	3300005548	Bacteria	603
109	Ga0070704_100408103	3300005549	Bacteria	1161
110	Ga0068855_100000266	3300005563	Bacteria	65127
111	Ga0068855_100021979	3300005563	Bacteria	7648
112	Ga0070664_100697310	3300005564	Bacteria	946
113	Ga0068857_101054500	3300005577	Bacteria	784
114	Ga0068857_101060227	3300005577	Bacteria	782
115	Ga0068854_100126246	3300005578	Bacteria	1949
116	Ga0068856_100072939	3300005614	Bacteria	3399
117	Ga0068856_100711535	3300005614	Bacteria	1024
118	Ga0070702_101355678	3300005615	Bacteria	580
119	Ga0068859_100995658	3300005617	Bacteria	920
120	Ga0068859_102986625	3300005617	Bacteria	517
121	Ga0068864_100669070	3300005618	Bacteria	1012
122	Ga0068864_101108396	3300005618	Bacteria	788
123	Ga0068866_10091912	3300005718	Bacteria	1654
124	Ga0068866_10396743	3300005718	Bacteria	889
125	Ga0068861_100396217	3300005719	Bacteria	1224
126	Ga0068861_100457060	3300005719	Bacteria	1145
127	Ga0068851_10372549	3300005834	Bacteria	835
128	Ga0068851_10718012	3300005834	Bacteria	616
129	Ga0068851_10760925	3300005834	Bacteria	600
130	Ga0068870_10768276	3300005840	Bacteria	671
131	Ga0068863_100015171	3300005841	Bacteria	7402
132	Ga0068863_101710820	3300005841	Bacteria	639
133	Ga0068858_100295540	3300005842	Bacteria	1544
134	Ga0068858_101347111	3300005842	Bacteria	703
135	Ga0068862_100091874	3300005844	Bacteria	2644
136	Ga0068862_102095527	3300005844	Bacteria	577
137	Ga0081455_10537061	3300005937	Bacteria	776
138	Ga0070715_10425876	3300006163	Bacteria	744
139	Ga0070716_101720011	3300006173	Bacteria	518
140	Ga0070712_101578029	3300006175	Bacteria	574
141	Ga0075362_10218353	3300006177	Bacteria	931
142	Ga0075362_10271068	3300006177	Bacteria	838
143	Ga0075366_10009031	3300006195	Bacteria	5559
144	Ga0075366_10018157	3300006195	Bacteria	4061
145	Ga0075366_10081289	3300006195	Bacteria	1935
146	Ga0075366_10517867	3300006195	Bacteria	738
147	Ga0068871_100286387	3300006358	Bacteria	1442
148	Ga0068871_100313833	3300006358	Bacteria	1379
149	Ga0068871_101231209	3300006358	Bacteria	703
150	Ga0075430_100286181	3300006846	Bacteria	1364
151	Ga0075430_101138474	3300006846	Bacteria	643
152	Ga0075431_101875986	3300006847	Bacteria	555
153	Ga0075429_100717589	3300006880	Bacteria	876
154	Ga0068865_100759355	3300006881	Bacteria	833
155	Ga0075436_100799513	3300006914	Bacteria	702
156	Ga0097620_100995693	3300006931	Bacteria	920
157	Ga0097620_102985358	3300006931	Bacteria	517
158	Ga0105240_10368729	3300009093	Bacteria	1624
159	Ga0111539_11194141	3300009094	Bacteria	884
160	Ga0105245_10002954	3300009098	Bacteria	15251
161	Ga0105247_11152370	3300009101	Bacteria	615
162	Ga0114129_12226119	3300009147	Bacteria	659
163	Ga0105243_10918606	3300009148	Bacteria	872
164	Ga0105241_10003328	3300009174	Bacteria	11959
165	Ga0105241_12563013	3300009174	Bacteria	511
166	Ga0105242_12189552	3300009176	Bacteria	598
167	Ga0105248_12884117	3300009177	Bacteria	548
168	Ga0105237_10569738	3300009545	Bacteria	1139
169	Ga0105238_10733151	3300009551	Bacteria	1001
170	Ga0105238_11509572	3300009551	Bacteria	701
171	Ga0105249_11897303	3300009553	Bacteria	668
172	Ga0105239_10555629	3300010375	Bacteria	1307
173	Ga0105246_11461753	3300011119	Bacteria	640
174	Ga0157371_11252600	3300013102	Bacteria	573
175	Ga0157370_11379431	3300013104	Bacteria	634
176	Ga0157374_10039567	3300013296	Bacteria	4339
177	Ga0157374_10446050	3300013296	Bacteria	1295
178	Ga0157375_10379526	3300013308	Bacteria	1580
179	Ga0163163_10668872	3300014325	Bacteria	1102
180	Ga0163163_11213366	3300014325	Bacteria	817
181	Ga0157380_10316530	3300014326	Bacteria	1445
182	Ga0157380_12892543	3300014326	Bacteria	546
183	Ga0157380_12965027	3300014326	Unclassified	540
184	Ga0157377_10994466	3300014745	Bacteria	635
185	Ga0157377_11055316	3300014745	Bacteria	619
186	Ga0157377_11673329	3300014745	Bacteria	512
187	Ga0157379_10549618	3300014968	Bacteria	1074
188	Ga0157379_11984428	3300014968	Bacteria	575
189	Ga0157376_10085510	3300014969	Bacteria	2718
190	Ga0157376_10282688	3300014969	Bacteria	1563
191	Ga0157376_10493542	3300014969	Bacteria	1202
192	Ga0157376_10865049	3300014969	Bacteria	920
193	Ga0157376_11171514	3300014969	Bacteria	796
194	Ga0163161_10227494	3300017792	Bacteria	1446
195	Ga0206352_10383322	3300020078	Bacteria	825
196	Ga0213876_10573324	3300021384	Bacteria	600
197	Ga0207666_1001625	3300025271	Bacteria	2664
198	Ga0207697_10348596	3300025315	Bacteria	657
199	Ga0207656_10455330	3300025321	Bacteria	647
200	Ga0207682_10011730	3300025893	Bacteria	3424
201	Ga0207682_10143047	3300025893	Bacteria	1074
202	Ga0207642_10677187	3300025899	Bacteria	648
203	Ga0207642_11128329	3300025899	Bacteria	507
204	Ga0207688_10186585	3300025901	Bacteria	1239
205	Ga0207680_10374993	3300025903	Bacteria	1002
206	Ga0207647_10118635	3300025904	Bacteria	1561
207	Ga0207685_10737060	3300025905	Bacteria	539
208	Ga0207699_10740975	3300025906	Bacteria	721
209	Ga0207645_10021058	3300025907	Bacteria	4257
210	Ga0207645_11054841	3300025907	Bacteria	549
211	Ga0207643_10206890	3300025908	Bacteria	1197
212	Ga0207654_10005897	3300025911	Bacteria	6169
213	Ga0207654_10519492	3300025911	Bacteria	843
214	Ga0207707_10070280	3300025912	Bacteria	3051
215	Ga0207707_10755366	3300025912	Bacteria	813
216	Ga0207671_10619500	3300025914	Bacteria	862
217	Ga0207662_10086791	3300025918	Bacteria	1918
218	Ga0207657_10653070	3300025919	Bacteria	819
219	Ga0207681_10002742	3300025923	Bacteria	11146
220	Ga0207694_10176365	3300025924	Bacteria	1732
221	Ga0207694_11139312	3300025924	Bacteria	660
222	Ga0207650_10048909	3300025925	Bacteria	3120
223	Ga0207659_10240778	3300025926	Bacteria	1463
224	Ga0207659_10385428	3300025926	Bacteria	1169
225	Ga0207659_10403812	3300025926	Bacteria	1143
226	Ga0207687_10002323	3300025927	Bacteria	12949
227	Ga0207700_10425332	3300025928	Bacteria	1167
228	Ga0207644_10055836	3300025931	Bacteria	2848
229	Ga0207690_10136438	3300025932	Bacteria	1802
230	Ga0207706_10091565	3300025933	Bacteria	2673
231	Ga0207686_11087414	3300025934	Bacteria	651
232	Ga0207709_10210974	3300025935	Bacteria	1394
233	Ga0207670_10150696	3300025936	Bacteria	1725
234	Ga0207670_10156318	3300025936	Bacteria	1698
235	Ga0207669_10672618	3300025937	Bacteria	848
236	Ga0207704_10003857	3300025938	Bacteria	6810
237	Ga0207704_10765814	3300025938	Bacteria	804
238	Ga0207665_10850556	3300025939	Bacteria	722
239	Ga0207665_11452521	3300025939	Bacteria	545
240	Ga0207691_10036323	3300025940	Bacteria	4565
241	Ga0207691_10204635	3300025940	Bacteria	1717
242	Ga0207691_10289454	3300025940	Bacteria	1409
243	Ga0207691_10713868	3300025940	Bacteria	845
244	Ga0207691_10727844	3300025940	Bacteria	836
245	Ga0207711_12046003	3300025941	Unclassified	515
246	Ga0207689_10065221	3300025942	Bacteria	2996
247	Ga0207689_11284890	3300025942	Bacteria	615
248	Ga0207661_10060988	3300025944	Bacteria	3046
249	Ga0207661_10082186	3300025944	Bacteria	2663
250	Ga0207679_10286525	3300025945	Bacteria	1414
251	Ga0207667_10000612	3300025949	Bacteria	46149
252	Ga0207667_10003431	3300025949	Bacteria	19566
253	Ga0207651_10007125	3300025960	Bacteria	5937
254	Ga0207651_10064605	3300025960	Bacteria	2562
255	Ga0207651_10855995	3300025960	Bacteria	808
256	Ga0207651_11357292	3300025960	Bacteria	639
257	Ga0207668_10693369	3300025972	Bacteria	894
258	Ga0207640_10323909	3300025981	Bacteria	1228
259	Ga0207658_10392774	3300025986	Bacteria	1217
260	Ga0207677_10291313	3300026023	Bacteria	1345
261	Ga0207703_10316451	3300026035	Bacteria	1428
262	Ga0207703_11834217	3300026035	Bacteria	582
263	Ga0207639_10047593	3300026041	Bacteria	3242
264	Ga0207639_10492689	3300026041	Bacteria	1118
265	Ga0207639_10992147	3300026041	Bacteria	786
266	Ga0207678_10677898	3300026067	Bacteria	906
267	Ga0207678_11178814	3300026067	Bacteria	678
268	Ga0207708_10012451	3300026075	Bacteria	6340
269	Ga0207708_10057952	3300026075	Bacteria	2955
270	Ga0207708_11336648	3300026075	Bacteria	628
271	Ga0207708_11616581	3300026075	Unclassified	569
272	Ga0207702_10040498	3300026078	Bacteria	3906
273	Ga0207702_10182964	3300026078	Bacteria	1931
274	Ga0207702_10439820	3300026078	Bacteria	1264
275	Ga0207641_10401323	3300026088	Bacteria	1316
276	Ga0207641_11554345	3300026088	Bacteria	663
277	Ga0207648_10011154	3300026089	Bacteria	8479
278	Ga0207676_10514073	3300026095	Bacteria	1139
279	Ga0207676_11130419	3300026095	Bacteria	775
280	Ga0207674_10860911	3300026116	Bacteria	874
281	Ga0207674_10965093	3300026116	Bacteria	821
282	Ga0207675_100013850	3300026118	Bacteria	7520
283	Ga0207675_100181324	3300026118	Bacteria	2016
284	Ga0207675_100768026	3300026118	Bacteria	976
285	Ga0207675_101074241	3300026118	Bacteria	824
286	Ga0207683_10259086	3300026121	Bacteria	1588
287	Ga0207683_10512688	3300026121	Bacteria	1108
288	Ga0207683_10802614	3300026121	Bacteria	873
289	Ga0207698_10903638	3300026142	Bacteria	890
290	Ga0207698_12216058	3300026142	Bacteria	562
291	Ga0209998_10004948	3300027717	Bacteria	2802
292	Ga0207428_10017611	3300027907	Bacteria	6126
293	Ga0268266_10962908	3300028379	Bacteria	826
294	Ga0268266_11956922	3300028379	Bacteria	560
295	Ga0268265_10034866	3300028380	Bacteria	3671
296	Ga0268265_11308794	3300028380	Bacteria	725
297	Ga0268264_10136493	3300028381	Bacteria	2181
298	Ga0265337_1001901	3300028556	Bacteria	9942
299	Ga0265319_1060122	3300028563	Bacteria	1234
300	Ga0265334_10001615	3300028573	Bacteria	10823
301	Ga0265336_10076203	3300028666	Bacteria	1002
302	Ga0307515_10202150	3300028794	Bacteria	1859
303	Ga0307515_10654784	3300028794	Bacteria	663
304	Ga0265338_10382558	3300028800	Bacteria	1006
305	Ga0265332_10084104	3300031238	Bacteria	1349
306	Ga0265332_10155677	3300031238	Bacteria	955
307	Ga0265320_10001512	3300031240	Bacteria	16930
308	Ga0265325_10118345	3300031241	Bacteria	1280
309	Ga0265340_10015118	3300031247	Bacteria	4016
310	Ga0265339_10055328	3300031249	Bacteria	2153
311	Ga0307513_10090959	3300031456	Bacteria	3111
312	Ga0307513_10667955	3300031456	Bacteria	746
313	Ga0307509_10500318	3300031507	Bacteria	900
314	Ga0307509_10843681	3300031507	Bacteria	581
315	Ga0307508_10050191	3300031616	Bacteria	3713
316	Ga0307508_10810175	3300031616	Bacteria	554
317	Ga0265314_10276656	3300031711	Bacteria	951
318	Ga0307516_10003404	3300031730	Bacteria	20479
319	Ga0307412_11226029	3300031911	Bacteria	673
320	Ga0307411_11306245	3300032005	Bacteria	661
321	Ga0307411_11320669	3300032005	Bacteria	658
322	Ga0316592_1113147	3300033524	Unclassified	628
323	Ga0316588_1150386	3300033528	Bacteria	597
324	Ga0316596_1123044	3300033541	Bacteria	707
325	Ga0373958_0009873	3300034819	Bacteria	1581
326	Ga0373926_0037278	3300035083	Bacteria	1729
327	Ga0373929_0185126	3300035085	Bacteria	576
328	Ga0373945_0138113	3300035116	Bacteria	981
329	Ga0373943_0011073	3300035170	Bacteria	4051
330	Ga0373935_0390479	3300035692	Bacteria	998
331	Ga0373927_0161417	3300035695	Bacteria	1468
332	Ga0373933_0762442	3300035724	Bacteria	637
333	Ga0373937_0408129	3300036401	Bacteria	1289
334	Ga0373937_1251706	3300036401	Bacteria	690
335	Ga0436365_1839659	3300039437	Bacteria	4011
336	Ga0451787_227323	3300041441	Bacteria	658
337	Ga0451787_430695	3300041441	Bacteria	2872
338	Ga0451789_0502497	3300041443	Bacteria	598
339	Ga0451789_0934748	3300041443	Bacteria	559
340	Ga0451794_07065	3300041446	Bacteria	1237
341	Ga0451791_1548520	3300041451	Bacteria	563
342	Ga0451793_1893695	3300041452	Bacteria	643
343	Ga0451797_0895524	3300041453	Bacteria	687
344	Ga0451795_1143703	3300041456	Bacteria	681
345	Ga0451798_0262246	3300041458	Bacteria	638
346	Ga0451798_0874282	3300041458	Bacteria	1069
347	Ga0451800_0558223	3300041459	Bacteria	1409
348	Ga0451805_026080	3300041461	Bacteria	882
349	Ga0451804_0599107	3300041463	Bacteria	625
350	Ga0451804_0747749	3300041463	Bacteria	563
351	Ga0451808_33157	3300041464	Bacteria	607
352	Ga0451807_0974580	3300041486	Bacteria	1692
353	Ga0451807_0978842	3300041486	Bacteria	702
354	Ga0451807_1144583	3300041486	Bacteria	508
355	Ga0451807_1291030	3300041486	Bacteria	641
356	Ga0451807_2271178	3300041486	Bacteria	599
357	Ga0451841_1083457	3300041498	Bacteria	1025
358	Ga0451849_0111712	3300041505	Bacteria	615
359	Ga0451849_1344458	3300041505	Bacteria	3728
360	Ga0451850_63564	3300041506	Bacteria	877
361	Ga0451851_0850392	3300041507	Bacteria	930
362	Ga0451843_0372412	3300041509	Bacteria	751
363	Ga0451853_1266368	3300041512	Bacteria	15952
364	Ga0451853_1756466	3300041512	Bacteria	966
365	Ga0451853_2204238	3300041512	Bacteria	789
366	Ga0451853_3977348	3300041512	Bacteria	1406
367	Ga0439445_0049438	3300042004	Bacteria	1132
368	Ga0439445_0049753	3300042004	Bacteria	1129
369	Ga0439458_0212994	3300042157	Bacteria	531
370	Ga0453684_1877951	3300044712	Bacteria	607
371	Ga0466971_0121247	3300044719	Bacteria	1210
372	Ga0466960_0030191	3300044901	Bacteria	2493
373	Ga0466959_0532825	3300045049	Bacteria	793
374	Ga0451576_0136068	3300045051	Bacteria	2562
375	Ga0451576_0635891	3300045051	Bacteria	1121
376	Ga0495623_0653304	3300046679	Bacteria	542
377	Ga0495658_0132955	3300046683	Bacteria	1516
378	Ga0495680_0062109	3300047322	Bacteria	2873
379	Ga0496102_0436016	3300048905	Bacteria	1230
380	Ga0496104_0036226	3300048907	Bacteria	4612
381	Ga0496112_0030222	3300048915	Bacteria	5242
382	Ga0496115_0561298	3300048918	Bacteria	911
383	Ga0501306_024178	3300049127	Bacteria	867
384	Ga0501306_041246	3300049127	Bacteria	717
385	Ga0501308_011068	3300049128	Bacteria	1011
386	Ga0501308_014383	3300049128	Bacteria	926
387	Ga0501309_038483	3300049129	Bacteria	725
388	Ga0501310_010584	3300049130	Bacteria	1031
389	Ga0501310_015014	3300049130	Bacteria	915
390	Ga0501310_034206	3300049130	Bacteria	686
391	Ga0501305_018599	3300049161	Bacteria	1007
392	Ga0501305_023035	3300049161	Bacteria	930
393	Ga0501307_006084	3300049162	Bacteria	1292
394	Ga0501307_008393	3300049162	Bacteria	1159
395	Ga0501307_092382	3300049162	Bacteria	506
396	Ga0501290_061926	3300049513	Bacteria	604
397	Ga0501292_132493	3300049515	Bacteria	516
398	Ga0501294_017782	3300049517	Bacteria	749
399	Ga0501299_094957	3300049522	Bacteria	683
400	Ga0501311_012757	3300049527	Bacteria	1053
401	Ga0501313_005318	3300049529	Bacteria	1355
402	Ga0501313_049363	3300049529	Bacteria	579
403	Ga0501314_003556	3300049530	Bacteria	1259
404	Ga0501314_013384	3300049530	Bacteria	795
405	Ga0501315_079563	3300049531	Bacteria	555
406	Ga0501326_05426	3300049542	Bacteria	693
407	Ga0501340_025543	3300049556	Bacteria	515
408	Ga0501042_0376179	3300049578	Bacteria	1028
409	Ga0501047_0083068	3300049581	Bacteria	3079
410	Ga0501067_0003773	3300049583	Bacteria	8357
411	Ga0501067_0009930	3300049583	Bacteria	5271
412	Ga0501068_0195360	3300049584	Bacteria	1283
413	Ga0501068_0314939	3300049584	Bacteria	1003
414	Ga0501070_0345621	3300049586	Bacteria	1208
415	Ga0501071_0018420	3300049587	Bacteria	4834
416	Ga0501072_0155592	3300049588	Bacteria	1823
417	Ga0501072_0824832	3300049588	Bacteria	726
418	Ga0501073_0003382	3300049589	Bacteria	11991
419	Ga0501073_0007918	3300049589	Bacteria	7882
420	Ga0501073_0147160	3300049589	Bacteria	1632
421	Ga0501073_0468049	3300049589	Bacteria	871
422	Ga0501074_0002140	3300049590	Bacteria	13659
423	Ga0501076_0009809	3300049592	Bacteria	7075
424	Ga0501077_0109859	3300049593	Bacteria	1747
425	Ga0501199_030610	3300049650	Bacteria	663
426	Ga0501210_027006	3300049657	Bacteria	577
427	Ga0501222_048189	3300049662	Bacteria	620
428	Ga0501242_075069	3300049674	Bacteria	535
429	Ga0501246_026919	3300049676	Bacteria	627
430	Ga0501253_058867	3300049683	Bacteria	823
431	Ga0501260_053820	3300049689	Bacteria	512
432	Ga0501221_228627	3300049704	Bacteria	527
433	Ga0501225_0037033	3300049705	Bacteria	1344
434	Ga0501079_0080947	3300049741	Bacteria	2511
435	Ga0501079_0593202	3300049741	Bacteria	872
436	Ga0501080_0001538	3300049742	Bacteria	19472
437	Ga0501080_0012444	3300049742	Bacteria	7800
438	Ga0501080_0088773	3300049742	Bacteria	2872
439	Ga0501080_0710557	3300049742	Bacteria	886
440	Ga0501081_1564162	3300049743	Bacteria	501
441	Ga0501083_0015971	3300049744	Bacteria	5257
442	Ga0501083_0023661	3300049744	Bacteria	4259
443	Ga0501083_0195843	3300049744	Bacteria	1319
444	Ga0501083_0471175	3300049744	Bacteria	817
445	Ga0501083_0798520	3300049744	Bacteria	614
446	Ga0501265_049455	3300049762	Bacteria	658
447	nmdc:mga03683_193661_c1	3300050489	Bacteria	931
448	nmdc:mga00v17_39504_c1	3300050491	Bacteria	2826
449	nmdc:mga0k408_14443_c1	3300050493	Bacteria	4352
450	nmdc:mga0k408_18243_c1	3300050493	Bacteria	3915
451	nmdc:mga0k408_23012_c1	3300050493	Bacteria	3512
452	nmdc:mga0k408_34669_c1	3300050493	Bacteria	2890
453	nmdc:mga0k408_3991_c1	3300050493	Bacteria	7823
454	nmdc:mga0k408_598713_c1	3300050493	Bacteria	650
455	nmdc:mga08y16_20950_c1	3300050511	Bacteria	6902
456	nmdc:mga08y16_596915_c1	3300050511	Bacteria	1113
457	nmdc:mga08x19_268098_c1	3300050514	Bacteria	1181
458	Ga0500635_0007996	3300053080	Bacteria	2885
459	Ga0495595_0439037	3300053084	Bacteria	663
460	Ga0500644_0006354	3300053088	Bacteria	3023
461	Ga0500647_0228163	3300053091	Bacteria	830
462	Ga0501084_0117414	3300054114	Bacteria	2237
463	Ga0501084_0144668	3300054114	Bacteria	2002
464	Ga0501084_0408519	3300054114	Bacteria	1147
465	Ga0587084_012826	3300059477	Bacteria	1142
466	Ga0587109_053057	3300059624	Bacteria	836
467	Ga0501082_0073718	3300060353	Bacteria	2940
468	Ga0501082_0337953	3300060353	Bacteria	1312
469	Ga0501082_1479513	3300060353	Bacteria	593
470	rootH2_10045491
471	Ga0006769J43182_104289
472	Ga0006769J43182_106300
473	Ga0006761J43178_107109
474	Ga0006763J43179_108456
475	Ga0006762J43184_109605
476	Ga0006765J45826_111039
477	Ga0006759J45824_1027396
478	Ga0006759J45824_1029961
479	Ga0006759J45824_1037748
480	Ga0006759J45824_1039453
481	Ga0006758J48902_1009221
482	Ga0006758J48902_1009222
483	Ga0006758J48902_1009598
484	Ga0006758J48902_1012886
485	Ga0006758J48902_1021124
486	Ga0006770J48903_1016726
487	rootH1_10015553
488	rootH1_10015554
489	Ga0032354_1050569
490	Ga0032354_1123461
491	Ga0006766_120163
492	Ga0058859_11363661
493	Ga0058859_11666696
494	Ga0058859_11793010
495	Ga0058860_11423517
496	Ga0058860_12230108
497	Ga0065717_1013978
498	Ga0065707_11084460
499	Ga0070676_10018293
500	Ga0070683_100241547
501	Ga0070683_100803732
502	Ga0070683_102191005
503	Ga0070690_100558134
504	Ga0070690_100664315
505	Ga0070670_100337869
506	Ga0070677_10024571
507	Ga0070677_10081789
508	Ga0068869_100050185
509	Ga0068869_101184256
510	Ga0070680_100354549
511	Ga0070682_100000787
512	Ga0070682_100016985
513	Ga0070682_100139853
514	Ga0070682_101237566
515	Ga0070682_101649650
516	Ga0070682_101693088
517	Ga0070682_101843434
518	Ga0068868_100160818
519	Ga0068868_100923284
520	Ga0070660_100406772
521	Ga0070689_100068193
522	Ga0070689_100124190
523	Ga0070689_100342599
524	Ga0070689_100688822
525	Ga0070691_10060647
526	Ga0070687_101406173
527	Ga0070692_10149633
528	Ga0070668_100028739
529	Ga0070669_100025363
530	Ga0070675_100183980
531	Ga0070675_100195961
532	Ga0070675_100318549
533	Ga0070671_100191826
534	Ga0070674_100007457
535	Ga0070674_100367453
536	Ga0070673_100051191
537	Ga0070673_100071173
538	Ga0070673_100677707
539	Ga0070688_100081462
540	Ga0070688_100426728
541	Ga0070688_100874058
542	Ga0070659_100169875
543	Ga0070713_101097969
544	Ga0070701_10085332
545	Ga0070705_100852754
546	Ga0070700_100727749
547	Ga0070694_100586888
548	Ga0070663_100466825
549	Ga0070678_100804705
550	Ga0070662_100093375
551	Ga0070681_10212292
552	Ga0070681_11003005
553	Ga0068867_100016292
554	Ga0070685_10052930
555	Ga0070685_10088782
556	Ga0070685_10603653
557	Ga0070685_10858064
558	Ga0070685_11045815
559	Ga0070706_100500942
560	Ga0070684_100086123
561	Ga0070684_100501115
562	Ga0070684_101318129
563	Ga0068853_100558747
564	Ga0068853_100622443
565	Ga0068853_102207948
566	Ga0068853_102235865
567	Ga0070672_100005856
568	Ga0070672_100074196
569	Ga0070672_100083257
570	Ga0070672_100188208
571	Ga0070672_100189079
572	Ga0070686_100022242
573	Ga0070686_101267123
574	Ga0070695_100147012
575	Ga0070693_100339727
576	Ga0070665_100826267
577	Ga0070665_101890826
578	Ga0070704_100408103
579	Ga0068855_100000266
580	Ga0068855_100021979
581	Ga0070664_100697310
582	Ga0068857_101054500
583	Ga0068857_101060227
584	Ga0068854_100126246
585	Ga0068856_100072939
586	Ga0068856_100711535
587	Ga0070702_101355678
588	Ga0068859_100995658
589	Ga0068859_102986625
590	Ga0068864_100669070
591	Ga0068864_101108396
592	Ga0068866_10091912
593	Ga0068866_10396743
594	Ga0068861_100396217
595	Ga0068861_100457060
596	Ga0068851_10372549
597	Ga0068851_10718012
598	Ga0068851_10760925
599	Ga0068870_10768276
600	Ga0068863_100015171
601	Ga0068863_101710820
602	Ga0068858_100295540
603	Ga0068858_101347111
604	Ga0068862_100091874
605	Ga0068862_102095527
606	Ga0081455_10537061
607	Ga0070715_10425876
608	Ga0070716_101720011
609	Ga0070712_101578029
610	Ga0075362_10218353
611	Ga0075362_10271068
612	Ga0075366_10009031
613	Ga0075366_10018157
614	Ga0075366_10081289
615	Ga0075366_10517867
616	Ga0068871_100286387
617	Ga0068871_100313833
618	Ga0068871_101231209
619	Ga0075430_100286181
620	Ga0075430_101138474
621	Ga0075431_101875986
622	Ga0075429_100717589
623	Ga0068865_100759355
624	Ga0075436_100799513
625	Ga0097620_100995693
626	Ga0097620_102985358
627	Ga0105240_10368729
628	Ga0111539_11194141
629	Ga0105245_10002954
630	Ga0105247_11152370
631	Ga0114129_12226119
632	Ga0105243_10918606
633	Ga0105241_10003328
634	Ga0105241_12563013
635	Ga0105242_12189552
636	Ga0105248_12884117
637	Ga0105237_10569738
638	Ga0105238_10733151
639	Ga0105238_11509572
640	Ga0105249_11897303
641	Ga0105239_10555629
642	Ga0105246_11461753
643	Ga0157371_11252600
644	Ga0157370_11379431
645	Ga0157374_10039567
646	Ga0157374_10446050
647	Ga0157375_10379526
648	Ga0163163_10668872
649	Ga0163163_11213366
650	Ga0157380_10316530
651	Ga0157380_12892543
652	Ga0157380_12965027
653	Ga0157377_10994466
654	Ga0157377_11055316
655	Ga0157377_11673329
656	Ga0157379_10549618
657	Ga0157379_11984428
658	Ga0157376_10085510
659	Ga0157376_10282688
660	Ga0157376_10493542
661	Ga0157376_10865049
662	Ga0157376_11171514
663	Ga0163161_10227494
664	Ga0206352_10383322
665	Ga0213876_10573324
666	Ga0207666_1001625
667	Ga0207697_10348596
668	Ga0207656_10455330
669	Ga0207682_10011730
670	Ga0207682_10143047
671	Ga0207642_10677187
672	Ga0207642_11128329
673	Ga0207688_10186585
674	Ga0207680_10374993
675	Ga0207647_10118635
676	Ga0207685_10737060
677	Ga0207699_10740975
678	Ga0207645_10021058
679	Ga0207645_11054841
680	Ga0207643_10206890
681	Ga0207654_10005897
682	Ga0207654_10519492
683	Ga0207707_10070280
684	Ga0207707_10755366
685	Ga0207671_10619500
686	Ga0207662_10086791
687	Ga0207657_10653070
688	Ga0207681_10002742
689	Ga0207694_10176365
690	Ga0207694_11139312
691	Ga0207650_10048909
692	Ga0207659_10240778
693	Ga0207659_10385428
694	Ga0207659_10403812
695	Ga0207687_10002323
696	Ga0207700_10425332
697	Ga0207644_10055836
698	Ga0207690_10136438
699	Ga0207706_10091565
700	Ga0207686_11087414
701	Ga0207709_10210974
702	Ga0207670_10150696
703	Ga0207670_10156318
704	Ga0207669_10672618
705	Ga0207704_10003857
706	Ga0207704_10765814
707	Ga0207665_10850556
708	Ga0207665_11452521
709	Ga0207691_10036323
710	Ga0207691_10204635
711	Ga0207691_10289454
712	Ga0207691_10713868
713	Ga0207691_10727844
714	Ga0207711_12046003
715	Ga0207689_10065221
716	Ga0207689_11284890
717	Ga0207661_10060988
718	Ga0207661_10082186
719	Ga0207679_10286525
720	Ga0207667_10000612
721	Ga0207667_10003431
722	Ga0207651_10007125
723	Ga0207651_10064605
724	Ga0207651_10855995
725	Ga0207651_11357292
726	Ga0207668_10693369
727	Ga0207640_10323909
728	Ga0207658_10392774
729	Ga0207677_10291313
730	Ga0207703_10316451
731	Ga0207703_11834217
732	Ga0207639_10047593
733	Ga0207639_10492689
734	Ga0207639_10992147
735	Ga0207678_10677898
736	Ga0207678_11178814
737	Ga0207708_10012451
738	Ga0207708_10057952
739	Ga0207708_11336648
740	Ga0207708_11616581
741	Ga0207702_10040498
742	Ga0207702_10182964
743	Ga0207702_10439820
744	Ga0207641_10401323
745	Ga0207641_11554345
746	Ga0207648_10011154
747	Ga0207676_10514073
748	Ga0207676_11130419
749	Ga0207674_10860911
750	Ga0207674_10965093
751	Ga0207675_100013850
752	Ga0207675_100181324
753	Ga0207675_100768026
754	Ga0207675_101074241
755	Ga0207683_10259086
756	Ga0207683_10512688
757	Ga0207683_10802614
758	Ga0207698_10903638
759	Ga0207698_12216058
760	Ga0209998_10004948
761	Ga0207428_10017611
762	Ga0268266_10962908
763	Ga0268266_11956922
764	Ga0268265_10034866
765	Ga0268265_11308794
766	Ga0268264_10136493
767	Ga0265337_1001901
768	Ga0265319_1060122
769	Ga0265334_10001615
770	Ga0265336_10076203
771	Ga0307515_10202150
772	Ga0307515_10654784
773	Ga0265338_10382558
774	Ga0265332_10084104
775	Ga0265332_10155677
776	Ga0265320_10001512
777	Ga0265325_10118345
778	Ga0265340_10015118
779	Ga0265339_10055328
780	Ga0307513_10090959
781	Ga0307513_10667955
782	Ga0307509_10500318
783	Ga0307509_10843681
784	Ga0307508_10050191
785	Ga0307508_10810175
786	Ga0265314_10276656
787	Ga0307516_10003404
788	Ga0307412_11226029
789	Ga0307411_11306245
790	Ga0307411_11320669
791	Ga0316592_1113147
792	Ga0316588_1150386
793	Ga0316596_1123044
794	Ga0373958_0009873
795	Ga0373926_0037278
796	Ga0373929_0185126
797	Ga0373945_0138113
798	Ga0373943_0011073
799	Ga0373935_0390479
800	Ga0373927_0161417
801	Ga0373933_0762442
802	Ga0373937_0408129
803	Ga0373937_1251706
804	Ga0436365_1839659
805	Ga0451787_227323
806	Ga0451787_430695
807	Ga0451789_0502497
808	Ga0451789_0934748
809	Ga0451794_07065
810	Ga0451791_1548520
811	Ga0451793_1893695
812	Ga0451797_0895524
813	Ga0451795_1143703
814	Ga0451798_0262246
815	Ga0451798_0874282
816	Ga0451800_0558223
817	Ga0451805_026080
818	Ga0451804_0599107
819	Ga0451804_0747749
820	Ga0451808_33157
821	Ga0451807_0974580
822	Ga0451807_0978842
823	Ga0451807_1144583
824	Ga0451807_1291030
825	Ga0451807_2271178
826	Ga0451841_1083457
827	Ga0451849_0111712
828	Ga0451849_1344458
829	Ga0451850_63564
830	Ga0451851_0850392
831	Ga0451843_0372412
832	Ga0451853_1266368
833	Ga0451853_1756466
834	Ga0451853_2204238
835	Ga0451853_3977348
836	Ga0439445_0049438
837	Ga0439445_0049753
838	Ga0439458_0212994
839	Ga0453684_1877951
840	Ga0466971_0121247
841	Ga0466960_0030191
842	Ga0466959_0532825
843	Ga0451576_0136068
844	Ga0451576_0635891
845	Ga0495623_0653304
846	Ga0495658_0132955
847	Ga0495680_0062109
848	Ga0496102_0436016
849	Ga0496104_0036226
850	Ga0496112_0030222
851	Ga0496115_0561298
852	Ga0501306_024178
853	Ga0501306_041246
854	Ga0501308_011068
855	Ga0501308_014383
856	Ga0501309_038483
857	Ga0501310_010584
858	Ga0501310_015014
859	Ga0501310_034206
860	Ga0501305_018599
861	Ga0501305_023035
862	Ga0501307_006084
863	Ga0501307_008393
864	Ga0501307_092382
865	Ga0501290_061926
866	Ga0501292_132493
867	Ga0501294_017782
868	Ga0501299_094957
869	Ga0501311_012757
870	Ga0501313_005318
871	Ga0501313_049363
872	Ga0501314_003556
873	Ga0501314_013384
874	Ga0501315_079563
875	Ga0501326_05426
876	Ga0501340_025543
877	Ga0501042_0376179
878	Ga0501047_0083068
879	Ga0501067_0003773
880	Ga0501067_0009930
881	Ga0501068_0195360
882	Ga0501068_0314939
883	Ga0501070_0345621
884	Ga0501071_0018420
885	Ga0501072_0155592
886	Ga0501072_0824832
887	Ga0501073_0003382
888	Ga0501073_0007918
889	Ga0501073_0147160
890	Ga0501073_0468049
891	Ga0501074_0002140
892	Ga0501076_0009809
893	Ga0501077_0109859
894	Ga0501199_030610
895	Ga0501210_027006
896	Ga0501222_048189
897	Ga0501242_075069
898	Ga0501246_026919
899	Ga0501253_058867
900	Ga0501260_053820
901	Ga0501221_228627
902	Ga0501225_0037033
903	Ga0501079_0080947
904	Ga0501079_0593202
905	Ga0501080_0001538
906	Ga0501080_0012444
907	Ga0501080_0088773
908	Ga0501080_0710557
909	Ga0501081_1564162
910	Ga0501083_0015971
911	Ga0501083_0023661
912	Ga0501083_0195843
913	Ga0501083_0471175
914	Ga0501083_0798520
915	Ga0501265_049455
916	nmdc:mga03683_193661_c1
917	nmdc:mga00v17_39504_c1
918	nmdc:mga0k408_14443_c1
919	nmdc:mga0k408_18243_c1
920	nmdc:mga0k408_23012_c1
921	nmdc:mga0k408_34669_c1
922	nmdc:mga0k408_3991_c1
923	nmdc:mga0k408_598713_c1
924	nmdc:mga08y16_20950_c1
925	nmdc:mga08y16_596915_c1
926	nmdc:mga08x19_268098_c1
927	Ga0500635_0007996
928	Ga0495595_0439037
929	Ga0500644_0006354
930	Ga0500647_0228163
931	Ga0501084_0117414
932	Ga0501084_0144668
933	Ga0501084_0408519
934	Ga0587084_012826
935	Ga0587109_053057
936	Ga0501082_0073718
937	Ga0501082_0337953
938	Ga0501082_1479513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

19

86

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4v4w-assembly1.cif.gz_AQ	structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143	0.964	15	90
1i96-assembly1.cif.gz_Q	crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)	0.9621	13	88
8fmw-assembly1.cif.gz_Q	the structure of a hibernating ribosome in the lyme disease pathogen	0.9594	12	91
1n36-assembly1.cif.gz_Q	structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position	0.958	13	91
4v8c-assembly1.cif.gz_CT	crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin).	0.9569	13	89

ID	Description	Score	Start	End	Superfamily
af_C6T0V9_1_79_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9588	15	91	2.40.50.140
3ms0Q00	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9577	13	90	2.40.50.140
af_Q9LHN1_1_100_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9523	15	91	2.40.50.140
af_Q03246_1_107_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9471	13	89	2.40.50.140
af_Q2FW15_6_86_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.941	13	91	2.40.50.140

ID	Description	Score	Start	End	GO Terms
AF-A0A662D8U8-F1-model_v4	Small ribosomal subunit protein uS17	0.9759	13	93	GO:0003735 GO:0006412 GO:0019843 GO:0022627
AF-A0A7C2LTV3-F1-model_v4	Small ribosomal subunit protein uS17	0.9703	13	91	GO:0003735 GO:0006412 GO:0019843 GO:0022627
AF-A0A523V837-F1-model_v4	Small ribosomal subunit protein uS17	0.9693	14	91	GO:0003735 GO:0006412 GO:0019843 GO:0022627
AF-A0A7X3Y523-F1-model_v4	Small ribosomal subunit protein uS17	0.9684	14	95	GO:0003735 GO:0006412 GO:0019843 GO:0022627
AF-A0A6B1HF68-F1-model_v4	Small ribosomal subunit protein uS17	0.968	15	95	GO:0003735 GO:0006412 GO:0019843 GO:0022627

F450165

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00366

Ribosomal_S17

Ribosomal protein S17

19

86

0.98

Structural Annotation

Top 5 Hits

Map