F450244

General Info

Members Datasets Scaffolds Average Seq Length
469 312 385 229

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1025771|Ga0209758_10257712
Length 257
Sequence MNGTDKLEDTMKAGDVMTRRIIAIHDDAAVDEAARLMLQDDISALPVVDQAGKVLGVVSEGDLLRRVETGTEIRRPRWLELLVGPGRLAEEYVRTHARCVSEIMTRDLVSVTEDTDLSEVVRLMERRRVKRVLVMQGERLVGLISRSNLLHALAHLTPEAKPTPQSDQAIRDAIAAEMSKLKWAPRASVNPIVQDGIVDLHGTIFDDRERDALQVLCENIRGVKQVRDHLIWIEPYSGMPIGPLAGVEIITGNRPTT

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
6 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
7 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
8 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
9 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
10 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
11 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
12 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
13 2643221599 Rhizobium sp. Root708 Isolate Unclassified
14 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
15 2738541293 Rhizobium sp. GV031 Isolate Unclassified
16 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
17 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
18 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
19 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
20 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
21 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
22 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
23 2791355264 Rhizobium sp. S9 Isolate Nodule
24 2791355267 Rhizobium sp. L18 Isolate Nodule
25 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
26 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
27 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
28 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
29 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
30 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
31 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
32 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
33 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
34 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
35 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
36 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
37 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
38 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
39 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
40 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
41 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
42 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
43 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
44 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
45 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
46 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
47 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
48 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
49 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
50 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
51 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
52 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
53 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
54 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
55 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
56 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
57 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
58 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
59 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
60 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
61 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
62 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
63 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
64 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
65 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
66 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
67 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
68 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
69 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
70 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
71 3004167301 Mesorhizobium loti 582 Isolate Unclassified
72 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
73 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
74 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
75 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
80 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
89 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
165 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
166 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
167 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
168 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
169 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
170 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
171 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
309 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
310 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
311 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
312 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.66
Metatranscriptomes 0.43
Isolates 17.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 12.58
Rhizoplane 1.92
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 8.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006904 3300001979 Bacteria 4661
2 JGI24739J22299_10002997 3300001989 Bacteria 6462
3 JGI24739J22299_10045722 3300001989 Bacteria 1435
4 JGI24735J21928_10024815 3300002067 Bacteria 1811
5 rootL2_10111805 3300003322 Bacteria 2050
6 Ga0055540_1000126 3300003792 Bacteria 78462
7 Ga0055531_10039839 3300003794 Bacteria 1387
8 Ga0070670_100000326 3300005331 Bacteria 40332
9 Ga0070660_100121718 3300005339 Bacteria 2083
10 Ga0070667_101087230 3300005367 Bacteria 747
11 Ga0070714_100056191 3300005435 Bacteria 3366
12 Ga0070713_100068388 3300005436 Bacteria 2993
13 Ga0070713_100553760 3300005436 Bacteria 1089
14 Ga0070681_10108863 3300005458 Bacteria 2711
15 Ga0070681_10423727 3300005458 Unclassified 1243
16 Ga0070698_100167947 3300005471 Bacteria 2135
17 Ga0070698_100203782 3300005471 Unclassified 1913
18 Ga0070698_100258225 3300005471 Unclassified 1675
19 Ga0070699_100026293 3300005518 Bacteria 5020
20 Ga0070679_100062372 3300005530 Bacteria 3716
21 Ga0070672_100342015 3300005543 Bacteria 1274
22 Ga0070686_100387017 3300005544 Bacteria 1060
23 Ga0070665_101125044 3300005548 Unclassified 797
24 Ga0068855_100634209 3300005563 Unclassified 1149
25 Ga0068860_100793443 3300005843 Bacteria 960
26 Ga0068860_100938653 3300005843 Bacteria 882
27 Ga0081538_10025688 3300005981 Bacteria 4144
28 Ga0070712_100613153 3300006175 Bacteria 922
29 Ga0075369_10075119 3300006186 Bacteria 1492
30 Ga0075428_100172066 3300006844 Bacteria 2347
31 Ga0075428_100179848 3300006844 Bacteria 2290
32 Ga0075428_100698433 3300006844 Bacteria 1081
33 Ga0075430_100111378 3300006846 Bacteria 2282
34 Ga0075433_10069840 3300006852 Bacteria 3086
35 Ga0075434_100092700 3300006871 Bacteria 3023
36 Ga0075434_100673767 3300006871 Bacteria 1052
37 Ga0111539_10091189 3300009094 Bacteria 3581
38 Ga0111539_10733965 3300009094 Bacteria 1150
39 Ga0114129_10002667 3300009147 Bacteria 24838
40 Ga0114129_11095908 3300009147 Bacteria 997
41 Ga0105248_10384681 3300009177 Bacteria 1580
42 Ga0105238_10585919 3300009551 Bacteria 1122
43 Ga0157369_10137389 3300013105 Bacteria 2587
44 Ga0157378_10059250 3300013297 Bacteria 3416
45 Ga0157372_10645301 3300013307 Bacteria 1233
46 Ga0157379_10243746 3300014968 Bacteria 1630
47 Ga0157376_10564215 3300014969 Bacteria 1128
48 Ga0213872_10095652 3300021361 Bacteria 1327
49 Ga0213876_10091033 3300021384 Bacteria 1615
50 Ga0209673_1058600 3300025273 Bacteria 974
51 Ga0209758_1025771 3300025297 Unclassified 2568
52 Ga0209050_1010218 3300025298 Bacteria 4656
53 Ga0209256_1017325 3300025299 Bacteria 2399
54 Ga0209051_1000201 3300025303 Bacteria 106123
55 Ga0209257_1005375 3300025304 Bacteria 9042
56 Ga0207692_10202372 3300025898 Bacteria 1168
57 Ga0207707_10271668 3300025912 Bacteria 1469
58 Ga0207707_10364927 3300025912 Unclassified 1243
59 Ga0207693_10060596 3300025915 Bacteria 2965
60 Ga0207660_10200119 3300025917 Bacteria 1560
61 Ga0207657_10048647 3300025919 Bacteria 3701
62 Ga0207650_10000206 3300025925 Bacteria 67660
63 Ga0207664_10158379 3300025929 Bacteria 1929
64 Ga0207665_10072642 3300025939 Bacteria 2350
65 Ga0207665_10137127 3300025939 Bacteria 1742
66 Ga0207667_10557313 3300025949 Unclassified 1159
67 Ga0207667_10614943 3300025949 Bacteria 1095
68 Ga0268266_10626012 3300028379 Unclassified 1035
69 Ga0268264_10840557 3300028381 Bacteria 919
70 Ga0265338_10275282 3300028800 Bacteria 1232
71 Ga0265325_10093648 3300031241 Bacteria 1478
72 Ga0265339_10029634 3300031249 Bacteria 3104
73 Ga0265331_10003111 3300031250 Bacteria 10860
74 Ga0307513_10008385 3300031456 Bacteria 13232
75 Ga0265313_10000832 3300031595 Bacteria 31227
76 Ga0265314_10035140 3300031711 Bacteria 3655
77 Ga0307412_10000095 3300031911 Bacteria 75002
78 Ga0316587_1031239 3300033529 Bacteria 941
79 Ga0373926_0012489 3300035083 Bacteria 2872
80 Ga0373934_0071627 3300035086 Bacteria 1387
81 Ga0373944_0035422 3300035089 Unclassified 1521
82 Ga0373944_0160231 3300035089 Bacteria 798
83 Ga0373923_0074019 3300035111 Unclassified 1467
84 Ga0373923_0106925 3300035111 Bacteria 1239
85 Ga0373945_0017670 3300035116 Bacteria 2417
86 Ga0373945_0167441 3300035116 Bacteria 899
87 Ga0373954_0043566 3300035118 Unclassified 2093
88 Ga0373954_0043743 3300035118 Bacteria 2089
89 Ga0373954_0050486 3300035118 Bacteria 1952
90 Ga0373943_0119423 3300035170 Bacteria 1399
91 Ga0373943_0195708 3300035170 Bacteria 1117
92 Ga0373946_0081043 3300035171 Bacteria 1421
93 Ga0373946_0099459 3300035171 Bacteria 1302
94 Ga0373946_0147470 3300035171 Bacteria 1095
95 Ga0373955_0026014 3300035172 Unclassified 3010
96 Ga0373931_0007997 3300035691 Bacteria 5003
97 Ga0373931_0086107 3300035691 Bacteria 1743
98 Ga0373935_0040988 3300035692 Bacteria 2907
99 Ga0373935_0179139 3300035692 Bacteria 1454
100 Ga0373935_0188964 3300035692 Bacteria 1418
101 Ga0373927_0182136 3300035695 Bacteria 1378
102 Ga0373927_0190732 3300035695 Unclassified 1345
103 Ga0373933_0218753 3300035724 Bacteria 1221
104 Ga0373947_0039396 3300035725 Bacteria 2811
105 Ga0373947_0040457 3300035725 Unclassified 2777
106 Ga0373937_0029689 3300036401 Bacteria 4953
107 Ga0373937_0057854 3300036401 Bacteria 3562
108 Ga0373937_0121025 3300036401 Unclassified 2439
109 Ga0373925_0072015 3300037068 Bacteria 2614
110 Ga0373925_0275861 3300037068 Bacteria 1353
111 Ga0373925_0285147 3300037068 Bacteria 1331
112 Ga0373925_0618415 3300037068 Unclassified 892
113 Ga0395899_0128856 3300037312 Bacteria 1808
114 Ga0395900_0157101 3300037418 Bacteria 2322
115 Ga0436364_0817580 3300037853 Bacteria 2366
116 Ga0395901_0753611 3300038443 Bacteria 966
117 Ga0436365_1535498 3300039437 Bacteria 6321
118 Ga0436360_1018108 3300039438 Bacteria 5151
119 Ga0436360_1228930 3300039438 Bacteria 1016
120 Ga0436360_1238321 3300039438 Bacteria 1738
121 Ga0436361_0003422 3300039447 Unclassified 947
122 Ga0436361_0136861 3300039447 Bacteria 1706
123 Ga0436361_0322884 3300039447 Bacteria 7329
124 Ga0436361_1161468 3300039447 Bacteria 922
125 Ga0436362_0431549 3300039453 Unclassified 1592
126 Ga0451833_0237958 3300041491 Bacteria 1100
127 Ga0451839_0476402 3300041496 Bacteria 4534
128 Ga0451841_0285453 3300041498 Bacteria 7441
129 Ga0451847_0943666 3300041503 Bacteria 5502
130 Ga0451849_0692893 3300041505 Bacteria 954
131 Ga0451850_47952 3300041506 Bacteria 1011
132 Ga0451851_0271909 3300041507 Bacteria 4824
133 Ga0451855_0215471 3300041511 Bacteria 2241
134 Ga0451853_1709556 3300041512 Bacteria 4614
135 Ga0495617_001063 3300046452 Bacteria 12533
136 Ga0495617_111562 3300046452 Bacteria 884
137 Ga0495603_0062121 3300046455 Bacteria 2205
138 Ga0495603_0092608 3300046455 Unclassified 1766
139 Ga0495603_0165413 3300046455 Unclassified 1282
140 Ga0495629_0003713 3300046459 Bacteria 11506
141 Ga0495629_0047335 3300046459 Bacteria 3016
142 Ga0495629_0095802 3300046459 Bacteria 2070
143 Ga0495638_0001187 3300046460 Bacteria 24921
144 Ga0495641_0010013 3300046461 Bacteria 5560
145 Ga0495651_0073288 3300046462 Bacteria 2600
146 Ga0495651_0090760 3300046462 Bacteria 2291
147 Ga0495651_0315492 3300046462 Bacteria 1044
148 Ga0495653_0004128 3300046463 Bacteria 11750
149 Ga0495653_0578226 3300046463 Unclassified 693
150 Ga0495580_0028271 3300046472 Bacteria 4077
151 Ga0495582_0209249 3300046473 Bacteria 1115
152 Ga0495582_0499994 3300046473 Bacteria 703
153 Ga0495605_0027562 3300046474 Bacteria 2943
154 Ga0495639_0039290 3300046475 Bacteria 2128
155 Ga0495639_0111122 3300046475 Bacteria 1301
156 Ga0495639_0169007 3300046475 Unclassified 1061
157 Ga0495662_0001485 3300046476 Bacteria 11615
158 Ga0495662_0077097 3300046476 Bacteria 1619
159 Ga0495664_0060862 3300046477 Unclassified 2248
160 Ga0495664_0277807 3300046477 Unclassified 1012
161 Ga0495664_0380785 3300046477 Bacteria 848
162 Ga0495584_0000048 3300046491 Bacteria 88621
163 Ga0495584_0018481 3300046491 Bacteria 3543
164 Ga0495585_0004231 3300046492 Bacteria 9363
165 Ga0495585_0004625 3300046492 Bacteria 8885
166 Ga0495585_0068308 3300046492 Unclassified 1942
167 Ga0495585_0122544 3300046492 Bacteria 1374
168 Ga0495594_0036904 3300046499 Unclassified 2666
169 Ga0495596_0082804 3300046500 Bacteria 1245
170 Ga0495607_0031873 3300046501 Bacteria 3223
171 Ga0495607_0036751 3300046501 Bacteria 2948
172 Ga0495607_0105434 3300046501 Bacteria 1502
173 Ga0495583_0000108 3300046506 Bacteria 139791
174 Ga0495583_0000323 3300046506 Bacteria 75419
175 Ga0495583_0001447 3300046506 Bacteria 24084
176 Ga0495583_0013521 3300046506 Bacteria 4549
177 Ga0495606_0195798 3300046507 Bacteria 1155
178 Ga0495608_0039944 3300046511 Bacteria 3144
179 Ga0495608_0213636 3300046511 Unclassified 1212
180 Ga0495610_0000447 3300046512 Bacteria 42590
181 Ga0495610_0016553 3300046512 Bacteria 4238
182 Ga0495610_0159568 3300046512 Bacteria 954
183 Ga0495616_0000564 3300046513 Bacteria 28013
184 Ga0495616_0003327 3300046513 Bacteria 10328
185 Ga0495616_0020473 3300046513 Bacteria 3597
186 Ga0495616_0113708 3300046513 Bacteria 1255
187 Ga0495618_0106257 3300046514 Bacteria 1797
188 Ga0495618_0263623 3300046514 Unclassified 1078
189 Ga0495620_0015347 3300046515 Bacteria 3870
190 Ga0495628_0176506 3300046516 Unclassified 1618
191 Ga0495628_0349632 3300046516 Bacteria 1087
192 Ga0495630_0055858 3300046517 Bacteria 2958
193 Ga0495643_0002177 3300046522 Bacteria 16032
194 Ga0495644_0000294 3300046523 Bacteria 23082
195 Ga0495644_0001391 3300046523 Bacteria 9888
196 Ga0495648_0000233 3300046524 Bacteria 63677
197 Ga0495648_0029858 3300046524 Bacteria 3613
198 Ga0495648_0064352 3300046524 Bacteria 2161
199 Ga0495666_0147830 3300046526 Bacteria 1093
200 Ga0495652_0049569 3300046529 Bacteria 3594
201 Ga0495665_0036335 3300046531 Bacteria 2630
202 Ga0495640_0004052 3300046533 Bacteria 11725
203 Ga0495640_0086304 3300046533 Bacteria 2078
204 Ga0495640_0144792 3300046533 Bacteria 1529
205 Ga0495640_0230765 3300046533 Unclassified 1164
206 Ga0495640_0281772 3300046533 Bacteria 1035
207 Ga0495609_0001334 3300046538 Bacteria 16761
208 Ga0495609_0002325 3300046538 Bacteria 11743
209 Ga0495621_0075122 3300046539 Bacteria 1251
210 Ga0495645_0106981 3300046543 Bacteria 1983
211 Ga0495645_0127219 3300046543 Bacteria 1789
212 Ga0495622_0011692 3300046557 Bacteria 4058
213 Ga0495633_0000358 3300046558 Bacteria 49277
214 Ga0495633_0014290 3300046558 Bacteria 4157
215 Ga0495633_0220313 3300046558 Unclassified 869
216 Ga0495667_0013568 3300046559 Bacteria 5512
217 Ga0495667_0042994 3300046559 Bacteria 2995
218 Ga0495656_0012590 3300046615 Bacteria 3126
219 Ga0495656_0023987 3300046615 Bacteria 2404
220 Ga0495656_0030555 3300046615 Bacteria 2178
221 Ga0495634_0016797 3300046642 Bacteria 5228
222 Ga0495634_0041125 3300046642 Bacteria 3140
223 Ga0495634_0060184 3300046642 Unclassified 2527
224 Ga0495611_0001899 3300046648 Bacteria 9944
225 Ga0495625_0004227 3300046660 Bacteria 13682
226 Ga0495625_0004379 3300046660 Bacteria 13393
227 Ga0495625_0005626 3300046660 Bacteria 11364
228 Ga0495625_0014501 3300046660 Bacteria 6283
229 Ga0495625_0080132 3300046660 Bacteria 2274
230 Ga0495625_0313298 3300046660 Bacteria 1001
231 Ga0495625_0436145 3300046660 Bacteria 812
232 Ga0495635_0026007 3300046663 Bacteria 4076
233 Ga0495635_0354109 3300046663 Unclassified 979
234 Ga0495659_0000926 3300046664 Bacteria 10409
235 Ga0495661_0016666 3300046665 Bacteria 4864
236 Ga0495661_0022227 3300046665 Bacteria 4127
237 Ga0495661_0098235 3300046665 Bacteria 1653
238 Ga0495588_0036138 3300046674 Bacteria 2505
239 Ga0495657_0052456 3300046675 Bacteria 2734
240 Ga0495657_0069554 3300046675 Bacteria 2303
241 Ga0495599_0373190 3300046678 Unclassified 852
242 Ga0495623_0233132 3300046679 Unclassified 1043
243 Ga0495646_0007062 3300046680 Bacteria 7133
244 Ga0495647_0001811 3300046681 Bacteria 6610
245 Ga0495613_0058184 3300046689 Unclassified 2837
246 Ga0495613_0569509 3300046689 Bacteria 756
247 Ga0495613_0742818 3300046689 Unclassified 643
248 Ga0495624_0066638 3300046690 Unclassified 2247
249 Ga0495624_0091142 3300046690 Bacteria 1881
250 Ga0495670_0000501 3300046691 Bacteria 18590
251 Ga0495670_0005798 3300046691 Bacteria 6051
252 Ga0495670_0021110 3300046691 Bacteria 3211
253 Ga0495670_0168129 3300046691 Bacteria 1154
254 Ga0495671_0031260 3300046692 Bacteria 2722
255 Ga0495671_0395458 3300046692 Bacteria 662
256 Ga0495649_0272684 3300046694 Bacteria 865
257 Ga0495589_0022389 3300046794 Bacteria 3225
258 Ga0495589_0163978 3300046794 Bacteria 1058
259 Ga0495589_0208335 3300046794 Bacteria 921
260 Ga0495581_0039716 3300047315 Bacteria 2724
261 Ga0495604_0003851 3300047317 Bacteria 11951
262 Ga0495604_0045643 3300047317 Bacteria 3419
263 Ga0495604_0049304 3300047317 Bacteria 3273
264 Ga0495604_0364382 3300047317 Bacteria 958
265 Ga0495636_0001261 3300047318 Bacteria 9589
266 Ga0495674_0054501 3300047319 Bacteria 3511
267 Ga0495672_0001033 3300047320 Bacteria 28619
268 Ga0495672_0005567 3300047320 Bacteria 9960
269 Ga0495672_0315036 3300047320 Unclassified 737
270 Ga0495676_0017952 3300047321 Bacteria 6243
271 Ga0495676_0065638 3300047321 Bacteria 2816
272 Ga0495680_0020450 3300047322 Bacteria 5569
273 Ga0495680_0089195 3300047322 Bacteria 2315
274 Ga0495680_0385733 3300047322 Bacteria 970
275 Ga0495683_0018637 3300047323 Bacteria 3586
276 Ga0495687_001119 3300047443 Bacteria 26043
277 Ga0495687_003924 3300047443 Bacteria 10417
278 Ga0495687_018538 3300047443 Bacteria 3439
279 Ga0495675_0059992 3300047444 Bacteria 2411
280 Ga0495675_0194228 3300047444 Bacteria 1238
281 Ga0495685_000215 3300047447 Bacteria 19545
282 Ga0495673_0010216 3300047469 Bacteria 5122
283 Ga0495684_0001317 3300047471 Bacteria 19978
284 Ga0495684_0430514 3300047471 Bacteria 921
285 Ga0495686_0000576 3300047472 Bacteria 52136
286 Ga0495593_0112736 3300047673 Unclassified 1388
287 Ga0495614_0032832 3300048089 Bacteria 2233
288 Ga0495614_0114657 3300048089 Bacteria 1185
289 Ga0495615_0017431 3300048090 Bacteria 1564
290 Ga0495626_0038860 3300048091 Bacteria 2254
291 Ga0496102_0017683 3300048905 Bacteria 6249
292 Ga0496105_0274799 3300048908 Unclassified 1360
293 Ga0496105_0866954 3300048908 Bacteria 682
294 Ga0496108_0081507 3300048911 Bacteria 2742
295 Ga0496109_0239794 3300048912 Bacteria 1706
296 Ga0496110_0210269 3300048913 Bacteria 1768
297 Ga0496111_0116879 3300048914 Bacteria 1967
298 Ga0496113_0539834 3300048916 Bacteria 936
299 Ga0496116_0001337 3300048919 Bacteria 28054
300 Ga0496117_0021143 3300048920 Bacteria 5280
301 Ga0496117_0032739 3300048920 Bacteria 3945
302 Ga0496121_0002710 3300048924 Bacteria 26470
303 Ga0496122_0021734 3300048925 Bacteria 5729
304 Ga0496123_0001934 3300048926 Bacteria 27003
305 Ga0496124_0001937 3300048927 Bacteria 28380
306 Ga0496124_0025275 3300048927 Bacteria 5381
307 Ga0496125_0220365 3300048928 Bacteria 1223
308 Ga0495678_013464 3300049459 Bacteria 3839
309 Ga0495682_0000013 3300049460 Bacteria 259670
310 Ga0495682_0000360 3300049460 Bacteria 33234
311 Ga0501031_0069415 3300049568 Bacteria 2295
312 Ga0501032_0155342 3300049569 Bacteria 1503
313 Ga0501033_0064146 3300049570 Bacteria 2703
314 Ga0501034_0228608 3300049571 Bacteria 1810
315 Ga0501036_0000858 3300049572 Bacteria 22614
316 Ga0501037_0022914 3300049573 Bacteria 4618
317 Ga0501038_0067551 3300049574 Bacteria 3041
318 Ga0501038_0373180 3300049574 Bacteria 1108
319 Ga0501039_0005465 3300049575 Bacteria 9610
320 Ga0501039_0151160 3300049575 Bacteria 1824
321 Ga0501040_0006438 3300049576 Bacteria 7623
322 Ga0501041_0020762 3300049577 Bacteria 3929
323 Ga0501041_0206037 3300049577 Bacteria 1233
324 Ga0501042_0002982 3300049578 Bacteria 10526
325 Ga0501043_0030908 3300049579 Bacteria 4212
326 Ga0501046_0002074 3300049580 Bacteria 19022
327 Ga0501048_0078596 3300049582 Bacteria 2328
328 Ga0501070_0147576 3300049586 Bacteria 1941
329 Ga0501071_0203426 3300049587 Bacteria 1488
330 Ga0501071_0259930 3300049587 Unclassified 1311
331 Ga0501072_0006307 3300049588 Bacteria 9030
332 Ga0501072_0164310 3300049588 Bacteria 1771
333 Ga0501074_0068912 3300049590 Bacteria 2543
334 Ga0501074_0087696 3300049590 Bacteria 2228
335 Ga0501075_0010322 3300049591 Bacteria 6563
336 Ga0501075_0027617 3300049591 Bacteria 4183
337 Ga0501075_0071623 3300049591 Bacteria 2620
338 Ga0501075_0529367 3300049591 Unclassified 899
339 Ga0501076_0064333 3300049592 Bacteria 2923
340 Ga0501076_0136332 3300049592 Bacteria 1992
341 Ga0501077_0012328 3300049593 Bacteria 5354
342 Ga0501077_0042913 3300049593 Bacteria 2874
343 Ga0501077_0380391 3300049593 Bacteria 902
344 Ga0501079_0005946 3300049741 Bacteria 9129
345 Ga0501079_0043031 3300049741 Bacteria 3486
346 Ga0501079_0053969 3300049741 Bacteria 3100
347 Ga0501081_0006478 3300049743 Bacteria 7600
348 Ga0501081_0008811 3300049743 Bacteria 6556
349 Ga0501081_0036808 3300049743 Bacteria 3337
350 Ga0501081_0075176 3300049743 Bacteria 2358
351 Ga0501081_0497767 3300049743 Bacteria 908
352 Ga0501035_0045568 3300049822 Bacteria 3946
353 Ga0501035_0069621 3300049822 Bacteria 3118
354 Ga0501044_0056543 3300049823 Bacteria 4029
355 Ga0501044_0314525 3300049823 Bacteria 1492
356 Ga0501045_0058548 3300049824 Bacteria 2821
357 nmdc:mga05p37_3516_c1 3300050507 Bacteria 18305
358 nmdc:mga05p37_842176_c1 3300050507 Bacteria 997
359 nmdc:mga0qj67_290414_c1 3300050509 Bacteria 1325
360 nmdc:mga0n895_256523_c1 3300050512 Bacteria 1774
361 nmdc:mga0a205_92575_c2 3300050515 Bacteria 2572
362 nmdc:mga0sz30_52460_c1 3300050516 Bacteria 1731
363 Ga0495601_0002753 3300053077 Bacteria 9988
364 Ga0495601_0465064 3300053077 Bacteria 817
365 Ga0495612_0050842 3300053078 Unclassified 1702
366 Ga0495612_0058933 3300053078 Bacteria 1587
367 Ga0495619_0002119 3300053085 Bacteria 13146
368 Ga0495619_0003071 3300053085 Bacteria 10843
369 Ga0495619_0061788 3300053085 Bacteria 2493
370 Ga0495619_0074387 3300053085 Bacteria 2278
371 Ga0500607_170660 3300053121 Unclassified 980
372 Ga0500559_0263848 3300053136 Unclassified 811
373 Ga0500568_0000549 3300053139 Bacteria 27581
374 Ga0500568_0014246 3300053139 Bacteria 3596
375 Ga0500590_000211 3300053148 Bacteria 17788
376 Ga0500616_0000956 3300053153 Bacteria 31287
377 Ga0501084_0004761 3300054114 Bacteria 11093
378 Ga0501084_0005019 3300054114 Bacteria 10823
379 Ga0501084_0019794 3300054114 Bacteria 5609
380 Ga0501084_0080155 3300054114 Bacteria 2737
381 Ga0501082_0008345 3300060353 Bacteria 8934
382 Ga0501082_0052459 3300060353 Bacteria 3515
383 Ga0501082_0112375 3300060353 Bacteria 2358
384 Ga0501082_0154291 3300060353 Bacteria 1995
385 Ga0530510_0004079 3300061734 Bacteria 10082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0866954 Ga0496105_0866954_64_654 167
2 3300053148 Ga0500590_000211 Ga0500590_000211_3575_4258 170
3 3300046476 Ga0495662_0001485 Ga0495662_0001485_4347_5012 171
4 3300046663 Ga0495635_0354109 Ga0495635_0354109_115_780 171
5 3300047317 Ga0495604_0003851 Ga0495604_0003851_1540_2205 171
6 3300053121 Ga0500607_170660 Ga0500607_170660_31_696 171
7 3300053136 Ga0500559_0263848 Ga0500559_0263848_116_781 171
8 3300046462 Ga0495651_0315492 Ga0495651_0315492_148_813 173
9 3300046675 Ga0495657_0069554 Ga0495657_0069554_339_1004 173
10 iso_pu_bacteria 2791355267 2793366192 173
11 3300035692 Ga0373935_0179139 Ga0373935_0179139_813_1427 176
12 3300046558 Ga0495633_0220313 Ga0495633_0220313_15_629 176
13 3300046689 Ga0495613_0742818 Ga0495613_0742818_12_626 176
14 3300046692 Ga0495671_0395458 Ga0495671_0395458_23_613 176
15 3300046524 Ga0495648_0064352 Ga0495648_0064352_527_1210 177
16 3300036401 Ga0373937_0057854 Ga0373937_0057854_134_820 179
17 3300046463 Ga0495653_0578226 Ga0495653_0578226_18_638 180
18 3300046543 Ga0495645_0127219 Ga0495645_0127219_1131_1751 180
19 3300053077 Ga0495601_0465064 Ga0495601_0465064_163_783 180
20 3300047317 Ga0495604_0364382 Ga0495604_0364382_132_821 183
21 3300047322 Ga0495680_0385733 Ga0495680_0385733_87_776 183
22 3300047444 Ga0495675_0194228 Ga0495675_0194228_98_787 183
23 3300053139 Ga0500568_0000549 Ga0500568_0000549_1701_2384 183
24 3300053153 Ga0500616_0000956 Ga0500616_0000956_3201_3884 183
25 3300037068 Ga0373925_0275861 Ga0373925_0275861_708_1316 184
26 iso_pu_bacteria 2906378014 2906379498 184
27 3300025273 Ga0209673_1058600 Ga0209673_10586001 186
28 3300025299 Ga0209256_1017325 Ga0209256_10173254 186
29 3300046473 Ga0495582_0209249 Ga0495582_0209249_413_1057 186
30 3300003792 Ga0055540_1000126 Ga0055540_100012661 187
31 3300003794 Ga0055531_10039839 Ga0055531_100398391 187
32 3300025298 Ga0209050_1010218 Ga0209050_10102183 187
33 3300025303 Ga0209051_1000201 Ga0209051_100020160 187
34 3300025304 Ga0209257_1005375 Ga0209257_10053753 187
35 3300035695 Ga0373927_0190732 Ga0373927_0190732_466_1110 188
36 3300046473 Ga0495582_0499994 Ga0495582_0499994_35_679 188
37 3300046516 Ga0495628_0349632 Ga0495628_0349632_141_785 188
38 3300046678 Ga0495599_0373190 Ga0495599_0373190_11_655 188
39 3300046680 Ga0495646_0007062 Ga0495646_0007062_6117_6761 188
40 3300047320 Ga0495672_0315036 Ga0495672_0315036_35_691 188
41 3300053078 Ga0495612_0058933 Ga0495612_0058933_139_783 188
42 iso_pu_bacteria 2838686498 2838693545 190
43 iso_pu_bacteria 2838729681 2838735438 190
44 iso_pu_bacteria 2838742623 2838748340 190
45 iso_pu_bacteria 2842156927 2842162652 190
46 iso_pu_bacteria 2842180545 2842186156 190
47 iso_pu_bacteria 2842243621 2842249962 190
48 iso_pu_bacteria 2842257432 2842263258 190
49 iso_pu_bacteria 2842271015 2842278014 190
50 iso_pu_bacteria 2844454524 2844461123 190
51 3300048089 Ga0495614_0114657 Ga0495614_0114657_26_691 192
52 iso_pu_bacteria 2937843397 2937844000 192
53 3300005331 Ga0070670_100000326 Ga0070670_10000032628 194
54 3300005471 Ga0070698_100167947 Ga0070698_1001679472 194
55 3300005471 Ga0070698_100258225 Ga0070698_1002582252 194
56 3300025925 Ga0207650_10000206 Ga0207650_100002063 194
57 3300046501 Ga0495607_0105434 Ga0495607_0105434_607_1254 194
58 3300046660 Ga0495625_0436145 Ga0495625_0436145_150_797 194
59 3300046691 Ga0495670_0168129 Ga0495670_0168129_227_874 194
60 iso_pu_bacteria 3004268573 3004274228 194
61 iso_pu_bacteria 2738541293 2738805742 195
62 iso_pu_bacteria 3005409236 3005414095 195
63 iso_pu_bacteria 2510461076 2510899606 196
64 iso_pu_bacteria 2513237093 2513632817 196
65 iso_pu_bacteria 2515154116 2515655980 196
66 iso_pu_bacteria 2516653085 2517081027 196
67 iso_pu_bacteria 2517287029 2517407989 196
68 iso_pu_bacteria 2585427528 2585540146 196
69 iso_pu_bacteria 2585427593 2585838344 196
70 iso_pu_bacteria 2643221599 2644004990 196
71 iso_pu_bacteria 2765235942 2766069190 196
72 iso_pu_bacteria 2791355264 2793350183 196
73 iso_pu_bacteria 2841851746 2841858404 196
74 iso_pu_bacteria 2842110456 2842111460 196
75 iso_pu_bacteria 2842229732 2842236031 196
76 iso_pu_bacteria 2874131515 2874137363 196
77 iso_pu_bacteria 2933586486 2933588014 196
78 iso_pu_bacteria 8018127388 8018127924 196
79 iso_pu_bacteria 8056375014 8056379880 196
80 iso_pu_bacteria 2582581299 2585231384 197
81 iso_pu_bacteria 3005452660 3005455236 197
82 iso_pu_bacteria 2582581299 2585232287 198
83 iso_pu_bacteria 2643221634 2644190866 198
84 3300005367 Ga0070667_101087230 Ga0070667_1010872301 199
85 3300041506 Ga0451850_47952 Ga0451850_47952_11_673 199
86 3300041511 Ga0451855_0215471 Ga0451855_0215471_796_1458 199
87 3300046660 Ga0495625_0313298 Ga0495625_0313298_273_950 199
88 3300048919 Ga0496116_0001337 Ga0496116_0001337_23113_23775 199
89 3300048920 Ga0496117_0032739 Ga0496117_0032739_3148_3810 199
90 3300048924 Ga0496121_0002710 Ga0496121_0002710_1423_2085 199
91 3300048925 Ga0496122_0021734 Ga0496122_0021734_728_1390 199
92 3300048926 Ga0496123_0001934 Ga0496123_0001934_3872_4534 199
93 3300048927 Ga0496124_0001937 Ga0496124_0001937_22670_23332 199
94 3300048928 Ga0496125_0220365 Ga0496125_0220365_196_858 199
95 3300003322 rootL2_10111805 rootL2_101118052 200
96 3300041491 Ga0451833_0237958 Ga0451833_0237958_49_714 200
97 3300041496 Ga0451839_0476402 Ga0451839_0476402_2341_3006 200
98 3300041498 Ga0451841_0285453 Ga0451841_0285453_3497_4162 200
99 3300041503 Ga0451847_0943666 Ga0451847_0943666_2905_3570 200
100 3300041505 Ga0451849_0692893 Ga0451849_0692893_241_906 200
101 3300041507 Ga0451851_0271909 Ga0451851_0271909_2905_3570 200
102 3300041512 Ga0451853_1709556 Ga0451853_1709556_2967_3632 200
103 3300046524 Ga0495648_0029858 Ga0495648_0029858_1556_2221 200
104 3300046660 Ga0495625_0004227 Ga0495625_0004227_10038_10703 200
105 3300047472 Ga0495686_0000576 Ga0495686_0000576_31905_32567 200
106 3300053139 Ga0500568_0014246 Ga0500568_0014246_1763_2428 200
107 3300046506 Ga0495583_0013521 Ga0495583_0013521_677_1366 201
108 3300046515 Ga0495620_0015347 Ga0495620_0015347_684_1373 201
109 3300046522 Ga0495643_0002177 Ga0495643_0002177_10248_10955 201
110 3300046660 Ga0495625_0004379 Ga0495625_0004379_2465_3172 201
111 3300047443 Ga0495687_003924 Ga0495687_003924_4378_5085 201
112 3300048927 Ga0496124_0025275 Ga0496124_0025275_1439_2128 201
113 3300031456 Ga0307513_10008385 Ga0307513_100083856 202
114 3300046506 Ga0495583_0001447 Ga0495583_0001447_10436_11104 202
115 3300046615 Ga0495656_0012590 Ga0495656_0012590_116_784 202
116 3300046794 Ga0495589_0163978 Ga0495589_0163978_352_1020 202
117 iso_pu_bacteria 2838661181 2838666960 202
118 iso_pu_bacteria 2848858292 2848863338 202
119 iso_pu_bacteria 2933016740 2933017430 202
120 3300035691 Ga0373931_0007997 Ga0373931_0007997_3457_4134 203
121 iso_pu_bacteria 2513237144 2513913622 203
122 iso_pu_bacteria 2844002411 2844006575 203
123 iso_pu_bacteria 2871466892 2871472529 203
124 3300009147 Ga0114129_11095908 Ga0114129_110959082 204
125 3300050507 nmdc:mga05p37_842176_c1 nmdc:mga05p37_842176_c1_201_884 204
126 3300025939 Ga0207665_10137127 Ga0207665_101371271 205
127 3300049575 Ga0501039_0151160 Ga0501039_0151160_495_1160 205
128 3300005435 Ga0070714_100056191 Ga0070714_1000561913 206
129 3300006844 Ga0075428_100179848 Ga0075428_1001798482 206
130 3300025929 Ga0207664_10158379 Ga0207664_101583793 206
131 3300033529 Ga0316587_1031239 Ga0316587_10312391 206
132 3300035086 Ga0373934_0071627 Ga0373934_0071627_107_805 206
133 3300035111 Ga0373923_0106925 Ga0373923_0106925_61_759 206
134 3300035118 Ga0373954_0043566 Ga0373954_0043566_1072_1770 206
135 3300035118 Ga0373954_0050486 Ga0373954_0050486_133_831 206
136 3300035692 Ga0373935_0188964 Ga0373935_0188964_116_814 206
137 3300035725 Ga0373947_0040457 Ga0373947_0040457_503_1201 206
138 3300036401 Ga0373937_0029689 Ga0373937_0029689_745_1443 206
139 3300036401 Ga0373937_0121025 Ga0373937_0121025_1415_2113 206
140 3300037068 Ga0373925_0618415 Ga0373925_0618415_61_759 206
141 3300046462 Ga0495651_0073288 Ga0495651_0073288_216_914 206
142 3300046477 Ga0495664_0277807 Ga0495664_0277807_254_952 206
143 3300046511 Ga0495608_0213636 Ga0495608_0213636_372_1070 206
144 3300046559 Ga0495667_0042994 Ga0495667_0042994_1444_2142 206
145 3300046642 Ga0495634_0060184 Ga0495634_0060184_11_715 206
146 3300046675 Ga0495657_0052456 Ga0495657_0052456_1705_2403 206
147 3300047317 Ga0495604_0045643 Ga0495604_0045643_1591_2289 206
148 3300047444 Ga0495675_0059992 Ga0495675_0059992_456_1154 206
149 3300047471 Ga0495684_0430514 Ga0495684_0430514_151_849 206
150 3300049568 Ga0501031_0069415 Ga0501031_0069415_1368_2039 206
151 3300049569 Ga0501032_0155342 Ga0501032_0155342_722_1393 206
152 3300049571 Ga0501034_0228608 Ga0501034_0228608_522_1193 206
153 3300049572 Ga0501036_0000858 Ga0501036_0000858_4195_4866 206
154 3300049574 Ga0501038_0067551 Ga0501038_0067551_1079_1750 206
155 3300049575 Ga0501039_0005465 Ga0501039_0005465_1813_2484 206
156 3300049576 Ga0501040_0006438 Ga0501040_0006438_1981_2652 206
157 3300049577 Ga0501041_0020762 Ga0501041_0020762_2771_3442 206
158 3300049578 Ga0501042_0002982 Ga0501042_0002982_5555_6226 206
159 3300049579 Ga0501043_0030908 Ga0501043_0030908_1759_2430 206
160 3300049580 Ga0501046_0002074 Ga0501046_0002074_14131_14802 206
161 3300049582 Ga0501048_0078596 Ga0501048_0078596_1350_2021 206
162 3300049586 Ga0501070_0147576 Ga0501070_0147576_764_1435 206
163 3300049588 Ga0501072_0006307 Ga0501072_0006307_620_1291 206
164 3300049590 Ga0501074_0087696 Ga0501074_0087696_494_1165 206
165 3300049591 Ga0501075_0027617 Ga0501075_0027617_748_1419 206
166 3300049592 Ga0501076_0136332 Ga0501076_0136332_1196_1867 206
167 3300049593 Ga0501077_0042913 Ga0501077_0042913_1207_1878 206
168 3300049741 Ga0501079_0053969 Ga0501079_0053969_1632_2303 206
169 3300049743 Ga0501081_0006478 Ga0501081_0006478_3210_3881 206
170 3300049824 Ga0501045_0058548 Ga0501045_0058548_253_924 206
171 3300053085 Ga0495619_0061788 Ga0495619_0061788_296_994 206
172 3300054114 Ga0501084_0019794 Ga0501084_0019794_3454_4125 206
173 3300060353 Ga0501082_0112375 Ga0501082_0112375_565_1236 206
174 3300061734 Ga0530510_0004079 Ga0530510_0004079_6308_6979 206
175 3300046514 Ga0495618_0263623 Ga0495618_0263623_67_741 207
176 3300046533 Ga0495640_0230765 Ga0495640_0230765_394_1068 207
177 3300053085 Ga0495619_0074387 Ga0495619_0074387_393_1067 207
178 3300049593 Ga0501077_0380391 Ga0501077_0380391_207_881 208
179 3300050516 nmdc:mga0sz30_52460_c1 nmdc:mga0sz30_52460_c1_745_1461 208
180 iso_pu_bacteria 2597490356 2599103637 208
181 iso_pu_bacteria 2846952575 2846957321 208
182 3300005458 Ga0070681_10108863 Ga0070681_101088632 209
183 3300005530 Ga0070679_100062372 Ga0070679_1000623726 209
184 3300006871 Ga0075434_100092700 Ga0075434_1000927003 209
185 3300025912 Ga0207707_10271668 Ga0207707_102716682 209
186 3300025917 Ga0207660_10200119 Ga0207660_102001193 209
187 3300046694 Ga0495649_0272684 Ga0495649_0272684_181_852 209
188 3300050512 nmdc:mga0n895_256523_c1 nmdc:mga0n895_256523_c1_199_888 209
189 iso_pu_bacteria 2509276018 2509373344 209
190 iso_pu_bacteria 2513237164 2514034804 209
191 iso_pu_bacteria 2597490356 2599101287 209
192 iso_pu_bacteria 2756170246 2756678114 209
193 iso_pu_bacteria 2844009547 2844012130 209
194 iso_pu_bacteria 2846952575 2846953991 209
195 iso_pu_bacteria 2848858292 2848859835 209
196 iso_pu_bacteria 2856328259 2856330798 209
197 iso_pu_bacteria 2869249662 2869255025 209
198 iso_pu_bacteria 2869264136 2869264507 209
199 iso_pu_bacteria 2869271264 2869275318 209
200 iso_pu_bacteria 2871451962 2871454666 209
201 iso_pu_bacteria 2871459585 2871463268 209
202 iso_pu_bacteria 2876399893 2876406290 209
203 iso_pu_bacteria 2906363423 2906366979 209
204 iso_pu_bacteria 2906370794 2906376744 209
205 iso_pu_bacteria 2906393657 2906395936 209
206 iso_pu_bacteria 2924733363 2924739776 209
207 iso_pu_bacteria 2961136820 2961142195 209
208 iso_pu_bacteria 2965025482 2965028322 209
209 iso_pu_bacteria 2965040258 2965044769 209
210 iso_pu_bacteria 2965089291 2965096288 209
211 iso_pu_bacteria 2968138860 2968146572 209
212 iso_pu_bacteria 2970547951 2970551000 209
213 iso_pu_bacteria 2970619444 2970625558 209
214 iso_pu_bacteria 2977915119 2977918648 209
215 iso_pu_bacteria 2977950692 2977951705 209
216 iso_pu_bacteria 3004167301 3004170636 209
217 iso_pu_bacteria 3004195979 3004201635 209
218 iso_pu_bacteria 649633066 649865066 209
219 iso_pu_bacteria 8004361976 8004367247 209
220 3300006852 Ga0075433_10069840 Ga0075433_100698404 210
221 3300039438 Ga0436360_1018108 Ga0436360_1018108_3841_4554 210
222 3300039438 Ga0436360_1228930 Ga0436360_1228930_94_801 210
223 3300039438 Ga0436360_1238321 Ga0436360_1238321_878_1585 210
224 3300039447 Ga0436361_1161468 Ga0436361_1161468_157_864 210
225 3300046512 Ga0495610_0000447 Ga0495610_0000447_36070_36756 210
226 3300046538 Ga0495609_0002325 Ga0495609_0002325_7541_8251 210
227 3300050515 nmdc:mga0a205_92575_c2 nmdc:mga0a205_92575_c2_693_1388 210
228 3300001989 JGI24739J22299_10002997 JGI24739J22299_100029972 211
229 3300005563 Ga0068855_100634209 Ga0068855_1006342091 211
230 3300009551 Ga0105238_10585919 Ga0105238_105859192 211
231 3300025898 Ga0207692_10202372 Ga0207692_102023721 211
232 3300025915 Ga0207693_10060596 Ga0207693_100605961 211
233 3300025949 Ga0207667_10557313 Ga0207667_105573132 211
234 3300028800 Ga0265338_10275282 Ga0265338_102752822 211
235 3300031241 Ga0265325_10093648 Ga0265325_100936482 211
236 3300031249 Ga0265339_10029634 Ga0265339_100296342 211
237 3300031250 Ga0265331_10003111 Ga0265331_100031116 211
238 3300031595 Ga0265313_10000832 Ga0265313_100008329 211
239 3300031711 Ga0265314_10035140 Ga0265314_100351403 211
240 3300035171 Ga0373946_0081043 Ga0373946_0081043_190_915 211
241 3300037068 Ga0373925_0285147 Ga0373925_0285147_540_1265 211
242 3300046475 Ga0495639_0169007 Ga0495639_0169007_190_915 211
243 3300046794 Ga0495589_0022389 Ga0495589_0022389_1975_2664 211
244 3300047443 Ga0495687_018538 Ga0495687_018538_1994_2683 211
245 3300049570 Ga0501033_0064146 Ga0501033_0064146_232_933 211
246 3300049573 Ga0501037_0022914 Ga0501037_0022914_3106_3807 211
247 3300049574 Ga0501038_0373180 Ga0501038_0373180_363_1064 211
248 3300049743 Ga0501081_0497767 Ga0501081_0497767_160_858 211
249 3300049822 Ga0501035_0045568 Ga0501035_0045568_3228_3929 211
250 3300049823 Ga0501044_0056543 Ga0501044_0056543_1760_2461 211
251 iso_pu_bacteria 2738541296 2738824162 211
252 iso_pu_bacteria 2738541298 2738836963 211
253 iso_pu_bacteria 2738541306 2738878494 211
254 iso_pu_bacteria 2738543002 2739190132 211
255 iso_pu_bacteria 2738543008 2739225087 211
256 iso_pu_bacteria 2945934425 2945939256 211
257 iso_pu_bacteria 2990703756 2990706595 211
258 iso_pu_bacteria 641736151 642426471 211
259 3300005458 Ga0070681_10423727 Ga0070681_104237271 212
260 3300006844 Ga0075428_100172066 Ga0075428_1001720664 212
261 3300006844 Ga0075428_100698433 Ga0075428_1006984332 212
262 3300006871 Ga0075434_100673767 Ga0075434_1006737671 212
263 3300009094 Ga0111539_10091189 Ga0111539_100911892 212
264 3300009094 Ga0111539_10733965 Ga0111539_107339652 212
265 3300009147 Ga0114129_10002667 Ga0114129_100026676 212
266 3300013307 Ga0157372_10645301 Ga0157372_106453011 212
267 3300025912 Ga0207707_10364927 Ga0207707_103649272 212
268 3300025949 Ga0207667_10614943 Ga0207667_106149432 212
269 3300035083 Ga0373926_0012489 Ga0373926_0012489_1123_1845 212
270 3300035089 Ga0373944_0035422 Ga0373944_0035422_591_1313 212
271 3300035089 Ga0373944_0160231 Ga0373944_0160231_37_759 212
272 3300035111 Ga0373923_0074019 Ga0373923_0074019_620_1342 212
273 3300035116 Ga0373945_0017670 Ga0373945_0017670_975_1697 212
274 3300035118 Ga0373954_0043743 Ga0373954_0043743_742_1464 212
275 3300035170 Ga0373943_0119423 Ga0373943_0119423_587_1309 212
276 3300035171 Ga0373946_0099459 Ga0373946_0099459_278_1000 212
277 3300035171 Ga0373946_0147470 Ga0373946_0147470_18_740 212
278 3300035172 Ga0373955_0026014 Ga0373955_0026014_458_1180 212
279 3300035692 Ga0373935_0040988 Ga0373935_0040988_450_1172 212
280 3300035695 Ga0373927_0182136 Ga0373927_0182136_646_1368 212
281 3300035724 Ga0373933_0218753 Ga0373933_0218753_387_1109 212
282 3300035725 Ga0373947_0039396 Ga0373947_0039396_372_1094 212
283 3300037068 Ga0373925_0072015 Ga0373925_0072015_1299_2021 212
284 3300037312 Ga0395899_0128856 Ga0395899_0128856_597_1346 212
285 3300037418 Ga0395900_0157101 Ga0395900_0157101_463_1212 212
286 3300037853 Ga0436364_0817580 Ga0436364_0817580_620_1330 212
287 3300038443 Ga0395901_0753611 Ga0395901_0753611_118_867 212
288 3300046455 Ga0495603_0062121 Ga0495603_0062121_947_1669 212
289 3300046455 Ga0495603_0092608 Ga0495603_0092608_451_1173 212
290 3300046455 Ga0495603_0165413 Ga0495603_0165413_165_890 212
291 3300046459 Ga0495629_0003713 Ga0495629_0003713_692_1414 212
292 3300046459 Ga0495629_0047335 Ga0495629_0047335_261_983 212
293 3300046459 Ga0495629_0095802 Ga0495629_0095802_491_1216 212
294 3300046461 Ga0495641_0010013 Ga0495641_0010013_1307_2029 212
295 3300046462 Ga0495651_0090760 Ga0495651_0090760_705_1427 212
296 3300046463 Ga0495653_0004128 Ga0495653_0004128_3226_3948 212
297 3300046472 Ga0495580_0028271 Ga0495580_0028271_865_1587 212
298 3300046475 Ga0495639_0039290 Ga0495639_0039290_1191_1913 212
299 3300046477 Ga0495664_0060862 Ga0495664_0060862_697_1419 212
300 3300046492 Ga0495585_0068308 Ga0495585_0068308_143_865 212
301 3300046499 Ga0495594_0036904 Ga0495594_0036904_697_1419 212
302 3300046511 Ga0495608_0039944 Ga0495608_0039944_1108_1830 212
303 3300046514 Ga0495618_0106257 Ga0495618_0106257_478_1200 212
304 3300046516 Ga0495628_0176506 Ga0495628_0176506_618_1340 212
305 3300046517 Ga0495630_0055858 Ga0495630_0055858_1674_2396 212
306 3300046526 Ga0495666_0147830 Ga0495666_0147830_331_1053 212
307 3300046529 Ga0495652_0049569 Ga0495652_0049569_2052_2774 212
308 3300046531 Ga0495665_0036335 Ga0495665_0036335_743_1465 212
309 3300046533 Ga0495640_0004052 Ga0495640_0004052_9901_10623 212
310 3300046533 Ga0495640_0086304 Ga0495640_0086304_1326_2048 212
311 3300046533 Ga0495640_0144792 Ga0495640_0144792_436_1158 212
312 3300046543 Ga0495645_0106981 Ga0495645_0106981_1047_1772 212
313 3300046557 Ga0495622_0011692 Ga0495622_0011692_357_1079 212
314 3300046559 Ga0495667_0013568 Ga0495667_0013568_191_913 212
315 3300046642 Ga0495634_0016797 Ga0495634_0016797_2014_2736 212
316 3300046642 Ga0495634_0041125 Ga0495634_0041125_2048_2773 212
317 3300046663 Ga0495635_0026007 Ga0495635_0026007_1946_2671 212
318 3300046674 Ga0495588_0036138 Ga0495588_0036138_1293_2015 212
319 3300046679 Ga0495623_0233132 Ga0495623_0233132_144_866 212
320 3300046681 Ga0495647_0001811 Ga0495647_0001811_5319_6041 212
321 3300046689 Ga0495613_0058184 Ga0495613_0058184_753_1475 212
322 3300046689 Ga0495613_0569509 Ga0495613_0569509_49_738 212
323 3300046690 Ga0495624_0066638 Ga0495624_0066638_905_1627 212
324 3300046690 Ga0495624_0091142 Ga0495624_0091142_222_947 212
325 3300047315 Ga0495581_0039716 Ga0495581_0039716_588_1310 212
326 3300047317 Ga0495604_0049304 Ga0495604_0049304_2295_3017 212
327 3300047319 Ga0495674_0054501 Ga0495674_0054501_1015_1737 212
328 3300047321 Ga0495676_0017952 Ga0495676_0017952_3524_4246 212
329 3300047322 Ga0495680_0020450 Ga0495680_0020450_2278_3000 212
330 3300047322 Ga0495680_0089195 Ga0495680_0089195_1053_1775 212
331 3300047471 Ga0495684_0001317 Ga0495684_0001317_10546_11268 212
332 3300047673 Ga0495593_0112736 Ga0495593_0112736_517_1242 212
333 3300048089 Ga0495614_0032832 Ga0495614_0032832_1414_2136 212
334 3300048908 Ga0496105_0274799 Ga0496105_0274799_627_1349 212
335 3300049822 Ga0501035_0069621 Ga0501035_0069621_2195_2884 212
336 3300050507 nmdc:mga05p37_3516_c1 nmdc:mga05p37_3516_c1_1622_2311 212
337 3300053077 Ga0495601_0002753 Ga0495601_0002753_5180_5905 212
338 3300053078 Ga0495612_0050842 Ga0495612_0050842_412_1134 212
339 3300053085 Ga0495619_0002119 Ga0495619_0002119_11036_11758 212
340 3300053085 Ga0495619_0003071 Ga0495619_0003071_835_1557 212
341 3300005436 Ga0070713_100068388 Ga0070713_1000683882 213
342 3300005471 Ga0070698_100203782 Ga0070698_1002037823 213
343 3300005518 Ga0070699_100026293 Ga0070699_1000262935 213
344 3300005543 Ga0070672_100342015 Ga0070672_1003420153 213
345 3300005544 Ga0070686_100387017 Ga0070686_1003870171 213
346 3300005843 Ga0068860_100938653 Ga0068860_1009386531 213
347 3300005981 Ga0081538_10025688 Ga0081538_100256882 213
348 3300006846 Ga0075430_100111378 Ga0075430_1001113782 213
349 3300009177 Ga0105248_10384681 Ga0105248_103846812 213
350 3300013297 Ga0157378_10059250 Ga0157378_100592501 213
351 3300014968 Ga0157379_10243746 Ga0157379_102437462 213
352 3300014969 Ga0157376_10564215 Ga0157376_105642152 213
353 3300021361 Ga0213872_10095652 Ga0213872_100956522 213
354 3300021384 Ga0213876_10091033 Ga0213876_100910332 213
355 3300025297 Ga0209758_1025771 Ga0209758_10257712 213
356 3300025939 Ga0207665_10072642 Ga0207665_100726423 213
357 3300028381 Ga0268264_10840557 Ga0268264_108405572 213
358 3300035170 Ga0373943_0195708 Ga0373943_0195708_366_1058 213
359 3300035691 Ga0373931_0086107 Ga0373931_0086107_460_1173 213
360 3300039437 Ga0436365_1535498 Ga0436365_1535498_5308_6030 213
361 3300039447 Ga0436361_0003422 Ga0436361_0003422_173_865 213
362 3300039447 Ga0436361_0136861 Ga0436361_0136861_719_1411 213
363 3300039447 Ga0436361_0322884 Ga0436361_0322884_6246_6968 213
364 3300039453 Ga0436362_0431549 Ga0436362_0431549_51_773 213
365 3300046452 Ga0495617_001063 Ga0495617_001063_4955_5674 213
366 3300046452 Ga0495617_111562 Ga0495617_111562_98_817 213
367 3300046460 Ga0495638_0001187 Ga0495638_0001187_1970_2737 213
368 3300046475 Ga0495639_0111122 Ga0495639_0111122_321_1052 213
369 3300046476 Ga0495662_0077097 Ga0495662_0077097_672_1391 213
370 3300046491 Ga0495584_0000048 Ga0495584_0000048_36166_36930 213
371 3300046491 Ga0495584_0018481 Ga0495584_0018481_1760_2479 213
372 3300046492 Ga0495585_0004231 Ga0495585_0004231_1491_2210 213
373 3300046492 Ga0495585_0004625 Ga0495585_0004625_5744_6463 213
374 3300046492 Ga0495585_0122544 Ga0495585_0122544_400_1164 213
375 3300046501 Ga0495607_0031873 Ga0495607_0031873_610_1377 213
376 3300046501 Ga0495607_0036751 Ga0495607_0036751_530_1249 213
377 3300046506 Ga0495583_0000108 Ga0495583_0000108_32344_33063 213
378 3300046506 Ga0495583_0000323 Ga0495583_0000323_14416_15156 213
379 3300046512 Ga0495610_0016553 Ga0495610_0016553_934_1698 213
380 3300046512 Ga0495610_0159568 Ga0495610_0159568_171_890 213
381 3300046513 Ga0495616_0000564 Ga0495616_0000564_5450_6214 213
382 3300046513 Ga0495616_0003327 Ga0495616_0003327_3541_4260 213
383 3300046513 Ga0495616_0020473 Ga0495616_0020473_2149_2868 213
384 3300046513 Ga0495616_0113708 Ga0495616_0113708_266_985 213
385 3300046523 Ga0495644_0000294 Ga0495644_0000294_10999_11718 213
386 3300046523 Ga0495644_0001391 Ga0495644_0001391_3952_4671 213
387 3300046524 Ga0495648_0000233 Ga0495648_0000233_26910_27629 213
388 3300046538 Ga0495609_0001334 Ga0495609_0001334_3955_4674 213
389 3300046539 Ga0495621_0075122 Ga0495621_0075122_482_1213 213
390 3300046558 Ga0495633_0000358 Ga0495633_0000358_3164_3883 213
391 3300046558 Ga0495633_0014290 Ga0495633_0014290_525_1244 213
392 3300046615 Ga0495656_0023987 Ga0495656_0023987_1484_2251 213
393 3300046615 Ga0495656_0030555 Ga0495656_0030555_323_1042 213
394 3300046648 Ga0495611_0001899 Ga0495611_0001899_2537_3301 213
395 3300046660 Ga0495625_0005626 Ga0495625_0005626_4997_5716 213
396 3300046660 Ga0495625_0014501 Ga0495625_0014501_4849_5613 213
397 3300046660 Ga0495625_0080132 Ga0495625_0080132_535_1302 213
398 3300046664 Ga0495659_0000926 Ga0495659_0000926_1033_1752 213
399 3300046665 Ga0495661_0016666 Ga0495661_0016666_806_1525 213
400 3300046665 Ga0495661_0022227 Ga0495661_0022227_802_1566 213
401 3300046665 Ga0495661_0098235 Ga0495661_0098235_526_1245 213
402 3300046691 Ga0495670_0000501 Ga0495670_0000501_14043_14762 213
403 3300046691 Ga0495670_0005798 Ga0495670_0005798_4485_5204 213
404 3300046691 Ga0495670_0021110 Ga0495670_0021110_976_1740 213
405 3300046692 Ga0495671_0031260 Ga0495671_0031260_1907_2626 213
406 3300046794 Ga0495589_0208335 Ga0495589_0208335_103_822 213
407 3300047318 Ga0495636_0001261 Ga0495636_0001261_7924_8643 213
408 3300047320 Ga0495672_0001033 Ga0495672_0001033_18660_19505 213
409 3300047320 Ga0495672_0005567 Ga0495672_0005567_3593_4360 213
410 3300047321 Ga0495676_0065638 Ga0495676_0065638_179_946 213
411 3300047323 Ga0495683_0018637 Ga0495683_0018637_1598_2365 213
412 3300047443 Ga0495687_001119 Ga0495687_001119_20328_21047 213
413 3300047447 Ga0495685_000215 Ga0495685_000215_4992_5711 213
414 3300047469 Ga0495673_0010216 Ga0495673_0010216_2895_3662 213
415 3300048090 Ga0495615_0017431 Ga0495615_0017431_243_974 213
416 3300048905 Ga0496102_0017683 Ga0496102_0017683_3401_4129 213
417 3300048911 Ga0496108_0081507 Ga0496108_0081507_256_987 213
418 3300048912 Ga0496109_0239794 Ga0496109_0239794_793_1524 213
419 3300048913 Ga0496110_0210269 Ga0496110_0210269_381_1112 213
420 3300048914 Ga0496111_0116879 Ga0496111_0116879_386_1117 213
421 3300048916 Ga0496113_0539834 Ga0496113_0539834_65_802 213
422 3300049459 Ga0495678_013464 Ga0495678_013464_63_830 213
423 3300049460 Ga0495682_0000013 Ga0495682_0000013_235391_236110 213
424 3300049460 Ga0495682_0000360 Ga0495682_0000360_8246_8965 213
425 3300049577 Ga0501041_0206037 Ga0501041_0206037_353_1042 213
426 3300049587 Ga0501071_0203426 Ga0501071_0203426_305_994 213
427 3300049591 Ga0501075_0010322 Ga0501075_0010322_5208_5897 213
428 3300049593 Ga0501077_0012328 Ga0501077_0012328_4453_5142 213
429 3300049741 Ga0501079_0005946 Ga0501079_0005946_456_1145 213
430 3300049743 Ga0501081_0075176 Ga0501081_0075176_1299_1988 213
431 3300049823 Ga0501044_0314525 Ga0501044_0314525_594_1319 213
432 3300050509 nmdc:mga0qj67_290414_c1 nmdc:mga0qj67_290414_c1_338_1033 213
433 3300054114 Ga0501084_0004761 Ga0501084_0004761_150_839 213
434 3300060353 Ga0501082_0154291 Ga0501082_0154291_819_1508 213
435 iso_pu_bacteria 2965102966 2965109797 213
436 3300005436 Ga0070713_100553760 Ga0070713_1005537601 214
437 3300005548 Ga0070665_101125044 Ga0070665_1011250441 214
438 3300005843 Ga0068860_100793443 Ga0068860_1007934431 214
439 3300006175 Ga0070712_100613153 Ga0070712_1006131531 214
440 3300006186 Ga0075369_10075119 Ga0075369_100751191 214
441 3300028379 Ga0268266_10626012 Ga0268266_106260121 214
442 3300035116 Ga0373945_0167441 Ga0373945_0167441_107_829 214
443 3300046477 Ga0495664_0380785 Ga0495664_0380785_85_807 214
444 3300046533 Ga0495640_0281772 Ga0495640_0281772_291_983 214
445 3300049587 Ga0501071_0259930 Ga0501071_0259930_576_1268 214
446 3300049588 Ga0501072_0164310 Ga0501072_0164310_633_1325 214
447 3300049590 Ga0501074_0068912 Ga0501074_0068912_479_1171 214
448 3300049591 Ga0501075_0071623 Ga0501075_0071623_188_880 214
449 3300049591 Ga0501075_0529367 Ga0501075_0529367_193_885 214
450 3300049592 Ga0501076_0064333 Ga0501076_0064333_707_1399 214
451 3300049741 Ga0501079_0043031 Ga0501079_0043031_11_703 214
452 3300049743 Ga0501081_0008811 Ga0501081_0008811_2776_3468 214
453 3300049743 Ga0501081_0036808 Ga0501081_0036808_698_1390 214
454 3300054114 Ga0501084_0005019 Ga0501084_0005019_9901_10593 214
455 3300054114 Ga0501084_0080155 Ga0501084_0080155_314_1006 214
456 3300060353 Ga0501082_0008345 Ga0501082_0008345_2997_3689 214
457 3300060353 Ga0501082_0052459 Ga0501082_0052459_1536_2228 214
458 3300001979 JGI24740J21852_10006904 JGI24740J21852_100069045 215
459 3300001989 JGI24739J22299_10045722 JGI24739J22299_100457222 215
460 3300002067 JGI24735J21928_10024815 JGI24735J21928_100248152 215
461 3300005339 Ga0070660_100121718 Ga0070660_1001217182 215
462 3300013105 Ga0157369_10137389 Ga0157369_101373893 215
463 3300025919 Ga0207657_10048647 Ga0207657_100486472 215
464 3300031911 Ga0307412_10000095 Ga0307412_100000957 215
465 3300046474 Ga0495605_0027562 Ga0495605_0027562_1154_1843 215
466 3300046500 Ga0495596_0082804 Ga0495596_0082804_523_1212 215
467 3300046507 Ga0495606_0195798 Ga0495606_0195798_416_1105 215
468 3300048091 Ga0495626_0038860 Ga0495626_0038860_501_1190 215
469 3300048920 Ga0496117_0021143 Ga0496117_0021143_3143_3832 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04972

BON

BON domain

166

234

0.97

PF00571

CBS

CBS domain

13

69

0.96

PF00571

CBS

CBS domain

100

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhh-assembly1.cif.gz_A the crystal structure of cbs domain protein from shewanella oneidensis mr-1. 0.8626 5 57
3kpc-assembly1.cif.gz_A crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine 0.862 1 118
3kpd-assembly2.cif.gz_C crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. 0.8612 1 118
7r50-assembly2.cif.gz_K crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.8548 10 116
7r50-assembly2.cif.gz_J crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.8517 11 51
ID Description Score Start End Superfamily
af_Q54J25_40_183_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9078 10 55 3.10.580.10
af_Q9XI37_196_349_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9057 8 55 3.10.580.10
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.8846 147 208 3.30.1340.30
af_P0AE45_193_346_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.882 6 53 3.10.580.10
af_P9WFP3_200_346_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8629 1 53 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A345ZH19-F1-model_v4 BON domain-containing protein 0.9183 141 211
AF-A0A847LX49-F1-model_v4 CBS domain-containing protein 0.8912 1 103
AF-A0A7J4FVD2-F1-model_v4 CBS domain-containing protein 0.8881 1 116
AF-A0A6M1PS40-F1-model_v4 deleted 0.8861 138 214
AF-W8X4Z4-F1-model_v4 RNA-binding region RNP-1 0.8809 139 213

Feature Viewer

pLDDT pTM Quality
78.14 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map