F450293

General Info

Members Datasets Scaffolds Average Seq Length
469 266 938 144

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0342687|Ga0495620_0342687_22_495
Length 157
Sequence MSPLTRLEAVPVNPELQGRSYPPAPPYLVGREKVREFARAVFADSPLHHDPESARAAGYSDVVAPPTFPVVVQEHTLAQLLGDPDAGIDFARVVHGDQRFTFSRPIVAGDELTATLTVTSVKTLGGHAMVTAESVIEDADQQHVVTAISSLVVRGDE

Samples

Sample ID Description Type Environment
1 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
133 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
134 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
227 2643221549 Agromyces sp. Root1464 Isolate Unclassified
228 2643221572 Leifsonia sp. Root60 Isolate Unclassified
229 2643221616 Leifsonia sp. Root227 Isolate Unclassified
230 2643221619 Agromyces sp. Root81 Isolate Unclassified
231 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
232 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
233 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
234 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
235 2808606372 Agromyces sp. 23-23 Isolate Unclassified
236 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
237 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
238 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
239 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
240 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
241 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
242 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
243 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
244 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
245 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
246 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
247 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
248 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
249 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
250 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
251 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
252 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
253 2928153084 Leifsonia sp. 563 Isolate Unclassified
254 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
255 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
256 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
257 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
258 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
259 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
260 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
261 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
262 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
263 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
264 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
265 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
266 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.06
Metatranscriptomes 3.2
Isolates 8.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 13.43
Nodule 0
Rhizoplane 5.12
Rhizosphere 70.36
Stem 0
Stem Tuber 0.21
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495620_0342687 3300046515 Bacteria 567
2 JGI25162J39368_1007050 3300002737 Bacteria 1815
3 JGI25164J39214_1000796 3300002772 Bacteria 11303
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 JGI25165J46597_1000125 3300003214 Bacteria 131155
6 rootH1_10097191 3300003323 Bacteria 3955
7 Ga0006562J51391_1056202 3300003578 Bacteria 2700
8 Ga0055539_1000006 3300003752 Bacteria 580055
9 Ga0055539_1017996 3300003752 Bacteria 851
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055532_1005594 3300003758 Bacteria 1752
12 Ga0055525_1000223 3300003759 Bacteria 61497
13 Ga0055527_1000003 3300003760 Bacteria 705001
14 Ga0055542_1000005 3300003762 Bacteria 550280
15 Ga0055529_1000006 3300003763 Bacteria 416978
16 Ga0070658_10076796 3300005327 Bacteria 2739
17 Ga0070658_10276412 3300005327 Bacteria 1429
18 Ga0070658_11159049 3300005327 Bacteria 672
19 Ga0070670_100563834 3300005331 Bacteria 1017
20 Ga0068869_100144163 3300005334 Bacteria 1842
21 Ga0070666_10057313 3300005335 Bacteria 2632
22 Ga0070682_100530901 3300005337 Bacteria 917
23 Ga0068868_100039905 3300005338 Bacteria 3650
24 Ga0070660_100175360 3300005339 Bacteria 1733
25 Ga0070660_100237275 3300005339 Bacteria 1484
26 Ga0070668_100998172 3300005347 Bacteria 752
27 Ga0070671_100512239 3300005355 Bacteria 1033
28 Ga0070659_100000482 3300005366 Bacteria 29316
29 Ga0070659_100148188 3300005366 Bacteria 1913
30 Ga0070667_100937509 3300005367 Bacteria 806
31 Ga0070710_10419993 3300005437 Bacteria 900
32 Ga0070663_100111257 3300005455 Bacteria 2058
33 Ga0070663_100457315 3300005455 Bacteria 1053
34 Ga0070685_10075302 3300005466 Bacteria 2010
35 Ga0068853_100022255 3300005539 Bacteria 5292
36 Ga0070672_100040803 3300005543 Bacteria 3564
37 Ga0068855_100000569 3300005563 Bacteria 45301
38 Ga0068855_100175322 3300005563 Bacteria 2426
39 Ga0068855_100792928 3300005563 Bacteria 1007
40 Ga0068855_101040448 3300005563 Bacteria 858
41 Ga0068855_101727114 3300005563 Bacteria 637
42 Ga0068855_102086155 3300005563 Bacteria 571
43 Ga0068857_100000239 3300005577 Bacteria 36717
44 Ga0068857_101402469 3300005577 Bacteria 680
45 Ga0068854_100291515 3300005578 Bacteria 1317
46 Ga0068856_100103334 3300005614 Bacteria 2843
47 Ga0068856_100576050 3300005614 Bacteria 1147
48 Ga0068856_101213438 3300005614 Bacteria 770
49 Ga0068852_100022750 3300005616 Bacteria 5032
50 Ga0068852_100143901 3300005616 Bacteria 2209
51 Ga0068859_100297249 3300005617 Bacteria 1708
52 Ga0068864_100093156 3300005618 Bacteria 2661
53 Ga0068851_10000027 3300005834 Bacteria 118586
54 Ga0068851_10180785 3300005834 Bacteria 1168
55 Ga0068863_101551749 3300005841 Bacteria 671
56 Ga0075365_10138551 3300006038 Bacteria 1688
57 Ga0075364_10006791 3300006051 Bacteria 6748
58 Ga0075364_10202387 3300006051 Bacteria 1346
59 Ga0075364_10338747 3300006051 Bacteria 1025
60 Ga0097620_100297234 3300006931 Bacteria 1708
61 Ga0105240_10486162 3300009093 Bacteria 1375
62 Ga0105240_10982374 3300009093 Bacteria 904
63 Ga0105245_10054442 3300009098 Bacteria 3593
64 Ga0105247_10145871 3300009101 Bacteria 1555
65 Ga0105247_10255834 3300009101 Bacteria 1199
66 Ga0105241_10050671 3300009174 Bacteria 3165
67 Ga0105241_11479202 3300009174 Bacteria 653
68 Ga0105248_10000492 3300009177 Bacteria 44904
69 Ga0105248_10019436 3300009177 Bacteria 7517
70 Ga0105237_10000442 3300009545 Bacteria 59060
71 Ga0105237_10119858 3300009545 Bacteria 2625
72 Ga0105238_10015350 3300009551 Bacteria 7756
73 Ga0105238_10163828 3300009551 Bacteria 2199
74 Ga0105238_10554192 3300009551 Bacteria 1154
75 Ga0105239_10056750 3300010375 Bacteria 4296
76 Ga0105239_11147535 3300010375 Bacteria 895
77 Ga0105239_11336717 3300010375 Bacteria 827
78 Ga0105239_11830989 3300010375 Bacteria 703
79 Ga0157370_10014835 3300013104 Bacteria 7950
80 Ga0157370_10195745 3300013104 Bacteria 1876
81 Ga0157369_10018468 3300013105 Bacteria 7818
82 Ga0157374_10168275 3300013296 Bacteria 2137
83 Ga0157374_12082689 3300013296 Bacteria 594
84 Ga0163162_10485000 3300013306 Bacteria 1367
85 Ga0157372_10146947 3300013307 Bacteria 2718
86 Ga0157372_10449198 3300013307 Bacteria 1502
87 Ga0157372_11604436 3300013307 Bacteria 749
88 Ga0157375_10134328 3300013308 Bacteria 2596
89 Ga0157375_10172106 3300013308 Bacteria 2313
90 Ga0157375_10454271 3300013308 Bacteria 1447
91 Ga0157375_10667693 3300013308 Bacteria 1195
92 Ga0163163_10084876 3300014325 Bacteria 3174
93 Ga0163163_10363656 3300014325 Bacteria 1503
94 Ga0197907_10362185 3300020069 Bacteria 883
95 Ga0197907_11190262 3300020069 Bacteria 752
96 Ga0206356_10216627 3300020070 Bacteria 1454
97 Ga0206349_1191997 3300020075 Bacteria 1184
98 Ga0206355_1320943 3300020076 Bacteria 1228
99 Ga0206351_10302037 3300020077 Bacteria 671
100 Ga0206351_10924243 3300020077 Bacteria 738
101 Ga0206352_10530069 3300020078 Bacteria 633
102 Ga0206350_10199319 3300020080 Bacteria 737
103 Ga0206350_10703538 3300020080 Bacteria 1141
104 Ga0206354_10810658 3300020081 Bacteria 1292
105 Ga0206353_10061093 3300020082 Bacteria 17359
106 Ga0154015_1358594 3300020610 Bacteria 716
107 Ga0224712_10044691 3300022467 Bacteria 1691
108 Ga0209566_100032 3300025225 Bacteria 338313
109 Ga0209674_100001 3300025226 Bacteria 4013750
110 Ga0209672_100003 3300025228 Bacteria 1560476
111 Ga0209147_101047 3300025229 Bacteria 11727
112 Ga0209563_100001 3300025230 Bacteria 4013775
113 Ga0209563_100326 3300025230 Bacteria 18720
114 Ga0207427_100039 3300025231 Bacteria 291576
115 Ga0209437_100599 3300025233 Bacteria 22547
116 Ga0209258_106285 3300025242 Bacteria 1881
117 Ga0209677_100001 3300025253 Bacteria 4013787
118 Ga0209677_100406 3300025253 Bacteria 25755
119 Ga0209148_1000004 3300025254 Bacteria 1844481
120 Ga0209148_1002028 3300025254 Bacteria 7905
121 Ga0209129_1019770 3300025258 Bacteria 1266
122 Ga0209233_1000014 3300025261 Bacteria 996641
123 Ga0209233_1040493 3300025261 Bacteria 1013
124 Ga0209455_1000091 3300025272 Bacteria 223115
125 Ga0207656_10000001 3300025321 Bacteria 1323684
126 Ga0207656_10062423 3300025321 Bacteria 1638
127 Ga0207692_10347307 3300025898 Bacteria 914
128 Ga0207710_10093041 3300025900 Bacteria 1414
129 Ga0207710_10229055 3300025900 Bacteria 924
130 Ga0207647_10042047 3300025904 Bacteria 2869
131 Ga0207705_10000001 3300025909 Bacteria 2061880
132 Ga0207705_10044334 3300025909 Bacteria 3196
133 Ga0207705_10136403 3300025909 Bacteria 1830
134 Ga0207705_10149823 3300025909 Bacteria 1748
135 Ga0207705_10173072 3300025909 Bacteria 1626
136 Ga0207654_10000001 3300025911 Bacteria 1816198
137 Ga0207695_10003163 3300025913 Bacteria 23477
138 Ga0207695_10006597 3300025913 Bacteria 15004
139 Ga0207695_10451631 3300025913 Bacteria 1168
140 Ga0207695_10851566 3300025913 Bacteria 792
141 Ga0207671_10000001 3300025914 Bacteria 1318881
142 Ga0207671_10127805 3300025914 Bacteria 1949
143 Ga0207657_10036357 3300025919 Bacteria 4408
144 Ga0207657_10063821 3300025919 Bacteria 3147
145 Ga0207649_10089603 3300025920 Bacteria 2011
146 Ga0207694_10000420 3300025924 Bacteria 39573
147 Ga0207650_11313990 3300025925 Bacteria 615
148 Ga0207687_10027545 3300025927 Bacteria 3814
149 Ga0207644_11266000 3300025931 Bacteria 620
150 Ga0207690_10000300 3300025932 Bacteria 34612
151 Ga0207690_10067347 3300025932 Bacteria 2456
152 Ga0207709_10914968 3300025935 Bacteria 713
153 Ga0207691_10092793 3300025940 Bacteria 2704
154 Ga0207711_10001676 3300025941 Bacteria 20398
155 Ga0207711_10043495 3300025941 Bacteria 3831
156 Ga0207689_10786711 3300025942 Bacteria 803
157 Ga0207667_10003290 3300025949 Bacteria 19941
158 Ga0207667_10005356 3300025949 Bacteria 15639
159 Ga0207667_10005569 3300025949 Bacteria 15370
160 Ga0207667_10629105 3300025949 Bacteria 1080
161 Ga0207667_10718389 3300025949 Bacteria 1000
162 Ga0207640_11478187 3300025981 Bacteria 610
163 Ga0207658_10787939 3300025986 Bacteria 862
164 Ga0207703_10000224 3300026035 Bacteria 65306
165 Ga0207639_10017834 3300026041 Bacteria 5035
166 Ga0207639_10032822 3300026041 Bacteria 3825
167 Ga0207678_10233727 3300026067 Bacteria 1574
168 Ga0207678_10480393 3300026067 Bacteria 1082
169 Ga0207702_10087545 3300026078 Bacteria 2719
170 Ga0207702_10492423 3300026078 Bacteria 1194
171 Ga0207641_11312571 3300026088 Bacteria 724
172 Ga0207676_10888316 3300026095 Bacteria 873
173 Ga0207674_10001276 3300026116 Bacteria 32897
174 Ga0207674_10113726 3300026116 Bacteria 2679
175 Ga0207698_10000473 3300026142 Bacteria 23344
176 Ga0207698_10000591 3300026142 Bacteria 21157
177 Ga0207698_10195879 3300026142 Bacteria 1805
178 Ga0268265_10312438 3300028380 Bacteria 1420
179 Ga0307515_10065382 3300028794 Bacteria 5063
180 Ga0307515_10281435 3300028794 Bacteria 1370
181 Ga0307515_10295960 3300028794 Bacteria 1309
182 Ga0307513_10188059 3300031456 Bacteria 1920
183 Ga0307513_11002181 3300031456 Bacteria 545
184 Ga0307514_10004141 3300031649 Bacteria 13440
185 Ga0307413_10425534 3300031824 Bacteria 1047
186 Ga0307518_10259890 3300031838 Bacteria 1095
187 Ga0307410_10102484 3300031852 Bacteria 2054
188 Ga0307406_10023710 3300031901 Bacteria 3655
189 Ga0307412_10170273 3300031911 Bacteria 1628
190 Ga0307412_10747714 3300031911 Bacteria 844
191 Ga0307412_11175402 3300031911 Bacteria 686
192 Ga0307416_100435418 3300032002 Bacteria 1360
193 Ga0307415_100309089 3300032126 Bacteria 1313
194 Ga0395899_0003980 3300037312 Bacteria 11640
195 Ga0395900_0161151 3300037418 Bacteria 2288
196 Ga0395901_0420429 3300038443 Bacteria 1371
197 Ga0395901_1480176 3300038443 Bacteria 635
198 Ga0439465_0275485 3300041413 Bacteria 626
199 Ga0451791_1588114 3300041451 Bacteria 817
200 Ga0451793_0124887 3300041452 Bacteria 722
201 Ga0451793_0277597 3300041452 Bacteria 1220
202 Ga0451793_0523654 3300041452 Bacteria 1601
203 Ga0451793_0943848 3300041452 Bacteria 860
204 Ga0451793_1643693 3300041452 Bacteria 1016
205 Ga0451797_1137175 3300041453 Bacteria 740
206 Ga0451795_0926964 3300041456 Bacteria 609
207 Ga0451795_1302916 3300041456 Bacteria 1034
208 Ga0451800_0541600 3300041459 Bacteria 666
209 Ga0451802_1809820 3300041460 Bacteria 782
210 Ga0451806_712886 3300041462 Bacteria 688
211 Ga0451841_0346760 3300041498 Bacteria 1005
212 Ga0451847_0425482 3300041503 Bacteria 634
213 Ga0451853_3926263 3300041512 Bacteria 529
214 Ga0451853_4106937 3300041512 Bacteria 1012
215 Ga0439457_096258 3300042014 Bacteria 688
216 Ga0466969_0224737 3300044656 Bacteria 853
217 Ga0466972_0077356 3300044658 Bacteria 1585
218 Ga0466972_0125388 3300044658 Bacteria 1210
219 Ga0466972_0323832 3300044658 Bacteria 720
220 Ga0466972_0439477 3300044658 Bacteria 613
221 Ga0466965_0031080 3300044683 Bacteria 2602
222 Ga0466965_0084228 3300044683 Bacteria 1610
223 Ga0466966_0049994 3300044684 Bacteria 2661
224 Ga0466966_0092573 3300044684 Bacteria 1875
225 Ga0466961_0225822 3300044693 Bacteria 1153
226 Ga0466961_0264562 3300044693 Bacteria 1054
227 Ga0466971_0416857 3300044719 Bacteria 656
228 Ga0466968_0092331 3300044735 Bacteria 1343
229 Ga0466970_0003621 3300044765 Bacteria 7533
230 Ga0466970_0041380 3300044765 Bacteria 2448
231 Ga0466970_0043989 3300044765 Bacteria 2377
232 Ga0466970_0323921 3300044765 Bacteria 871
233 Ga0466957_0181837 3300044842 Bacteria 1373
234 Ga0466960_0037679 3300044901 Bacteria 2269
235 Ga0466959_0067426 3300045049 Bacteria 2594
236 Ga0466958_0291009 3300045836 Bacteria 1048
237 Ga0466967_0658292 3300045976 Bacteria 1036
238 Ga0466967_1778431 3300045976 Bacteria 614
239 Ga0495590_0002706 3300046457 Bacteria 7324
240 Ga0495650_0000770 3300046471 Bacteria 39564
241 Ga0495580_0105585 3300046472 Bacteria 1957
242 Ga0495606_0223736 3300046507 Bacteria 1059
243 Ga0495632_0123742 3300046519 Bacteria 1207
244 Ga0495625_0603547 3300046660 Bacteria 659
245 Ga0495588_0046650 3300046674 Bacteria 2223
246 Ga0495581_0096987 3300047315 Bacteria 1712
247 Ga0495672_0019950 3300047320 Bacteria 4405
248 Ga0495672_0095528 3300047320 Bacteria 1623
249 Ga0495673_0204137 3300047469 Bacteria 738
250 Ga0495686_0148713 3300047472 Bacteria 1377
251 Ga0495686_0160868 3300047472 Bacteria 1312
252 Ga0496100_0043464 3300048903 Bacteria 2873
253 Ga0496101_0024597 3300048904 Bacteria 4169
254 Ga0496101_0200078 3300048904 Bacteria 1544
255 Ga0496102_0706909 3300048905 Bacteria 931
256 Ga0496104_0153249 3300048907 Bacteria 2212
257 Ga0496104_0639336 3300048907 Bacteria 973
258 Ga0496105_0091345 3300048908 Bacteria 2514
259 Ga0496113_0315396 3300048916 Bacteria 1253
260 Ga0496114_0013243 3300048917 Bacteria 6610
261 Ga0496114_0080692 3300048917 Bacteria 2747
262 Ga0496115_0043446 3300048918 Bacteria 3584
263 Ga0496115_0255670 3300048918 Bacteria 1441
264 Ga0496117_0004795 3300048920 Bacteria 14659
265 Ga0496117_0032010 3300048920 Bacteria 4005
266 Ga0496117_0036516 3300048920 Bacteria 3676
267 Ga0496117_0043162 3300048920 Bacteria 3282
268 Ga0496118_0000472 3300048921 Bacteria 66796
269 Ga0496119_0000905 3300048922 Bacteria 38593
270 Ga0496119_0061493 3300048922 Bacteria 2242
271 Ga0496119_0198978 3300048922 Bacteria 1038
272 Ga0496119_0375335 3300048922 Bacteria 683
273 Ga0496120_0002435 3300048923 Bacteria 18835
274 Ga0496120_0028113 3300048923 Bacteria 3450
275 Ga0496120_0107364 3300048923 Bacteria 1464
276 Ga0496120_0178600 3300048923 Bacteria 1044
277 Ga0496121_0000015 3300048924 Bacteria 571958
278 Ga0496121_0409194 3300048924 Bacteria 886
279 Ga0496121_0414571 3300048924 Bacteria 878
280 Ga0496122_0001688 3300048925 Bacteria 34239
281 Ga0496123_0015117 3300048926 Bacteria 6351
282 Ga0496124_0000040 3300048927 Bacteria 307061
283 Ga0496125_0229545 3300048928 Bacteria 1188
284 Ga0496126_0295474 3300048929 Bacteria 1338
285 Ga0496126_0352094 3300048929 Bacteria 1204
286 Ga0496126_0570961 3300048929 Bacteria 895
287 Ga0496126_0614933 3300048929 Bacteria 854
288 Ga0501031_0016691 3300049568 Bacteria 4770
289 Ga0501032_0006421 3300049569 Bacteria 8652
290 Ga0501032_0006536 3300049569 Bacteria 8561
291 Ga0501032_0044095 3300049569 Bacteria 3019
292 Ga0501033_0003088 3300049570 Bacteria 13839
293 Ga0501033_0007742 3300049570 Bacteria 8330
294 Ga0501033_0012546 3300049570 Bacteria 6465
295 Ga0501033_0052509 3300049570 Bacteria 3021
296 Ga0501033_0077775 3300049570 Bacteria 2435
297 Ga0501033_0095304 3300049570 Bacteria 2175
298 Ga0501033_0103380 3300049570 Bacteria 2077
299 Ga0501033_0406958 3300049570 Bacteria 948
300 Ga0501034_0008302 3300049571 Bacteria 10991
301 Ga0501034_0018348 3300049571 Bacteria 7175
302 Ga0501034_0040767 3300049571 Bacteria 4698
303 Ga0501034_0042209 3300049571 Bacteria 4617
304 Ga0501034_0056708 3300049571 Bacteria 3941
305 Ga0501034_0077430 3300049571 Bacteria 3331
306 Ga0501034_0110271 3300049571 Bacteria 2743
307 Ga0501034_0238007 3300049571 Bacteria 1767
308 Ga0501034_0285811 3300049571 Bacteria 1588
309 Ga0501034_0295120 3300049571 Bacteria 1558
310 Ga0501034_0303839 3300049571 Bacteria 1532
311 Ga0501034_1031675 3300049571 Bacteria 705
312 Ga0501036_0013201 3300049572 Bacteria 6859
313 Ga0501036_0139205 3300049572 Bacteria 2048
314 Ga0501036_0181793 3300049572 Bacteria 1770
315 Ga0501036_0202534 3300049572 Bacteria 1669
316 Ga0501036_0863656 3300049572 Bacteria 743
317 Ga0501037_0021659 3300049573 Bacteria 4752
318 Ga0501037_0051907 3300049573 Bacteria 2999
319 Ga0501037_0076941 3300049573 Bacteria 2422
320 Ga0501037_0095599 3300049573 Bacteria 2147
321 Ga0501037_0143615 3300049573 Bacteria 1707
322 Ga0501037_0309786 3300049573 Bacteria 1095
323 Ga0501037_0574185 3300049573 Bacteria 759
324 Ga0501038_0004245 3300049574 Bacteria 13323
325 Ga0501038_0015122 3300049574 Bacteria 7022
326 Ga0501038_0181984 3300049574 Bacteria 1695
327 Ga0501038_0288508 3300049574 Bacteria 1290
328 Ga0501039_0020137 3300049575 Bacteria 5115
329 Ga0501039_0086557 3300049575 Bacteria 2440
330 Ga0501039_0154499 3300049575 Bacteria 1803
331 Ga0501039_0275618 3300049575 Bacteria 1322
332 Ga0501039_1222230 3300049575 Bacteria 581
333 Ga0501040_1381756 3300049576 Bacteria 511
334 Ga0501042_0054225 3300049578 Bacteria 2859
335 Ga0501042_0083580 3300049578 Bacteria 2289
336 Ga0501043_0012047 3300049579 Bacteria 6761
337 Ga0501043_0012355 3300049579 Bacteria 6677
338 Ga0501043_0050120 3300049579 Bacteria 3282
339 Ga0501043_0241928 3300049579 Bacteria 1392
340 Ga0501043_0532645 3300049579 Bacteria 874
341 Ga0501046_0011643 3300049580 Bacteria 7519
342 Ga0501046_0040782 3300049580 Bacteria 3708
343 Ga0501046_0137064 3300049580 Bacteria 1853
344 Ga0501046_0376474 3300049580 Bacteria 1028
345 Ga0501047_0051731 3300049581 Bacteria 3969
346 Ga0501047_0151416 3300049581 Bacteria 2195
347 Ga0501047_0187916 3300049581 Bacteria 1930
348 Ga0501047_0355567 3300049581 Bacteria 1301
349 Ga0501047_0411546 3300049581 Bacteria 1184
350 Ga0501047_0721618 3300049581 Bacteria 813
351 Ga0501048_0000826 3300049582 Bacteria 22836
352 Ga0501048_0070152 3300049582 Bacteria 2475
353 Ga0501048_0227388 3300049582 Bacteria 1324
354 Ga0501048_1233783 3300049582 Bacteria 538
355 Ga0501067_0016214 3300049583 Bacteria 4118
356 Ga0501068_0056338 3300049584 Bacteria 2383
357 Ga0501068_0056343 3300049584 Bacteria 2383
358 Ga0501068_0101937 3300049584 Bacteria 1780
359 Ga0501069_0111771 3300049585 Bacteria 1556
360 Ga0501069_0511526 3300049585 Bacteria 717
361 Ga0501070_0000076 3300049586 Bacteria 83972
362 Ga0501070_0003466 3300049586 Bacteria 13683
363 Ga0501070_0031034 3300049586 Bacteria 4477
364 Ga0501070_0040299 3300049586 Bacteria 3895
365 Ga0501070_0061844 3300049586 Bacteria 3102
366 Ga0501070_0921308 3300049586 Bacteria 681
367 Ga0501070_1198556 3300049586 Bacteria 583
368 Ga0501071_0006160 3300049587 Bacteria 7775
369 Ga0501071_0163258 3300049587 Bacteria 1666
370 Ga0501072_0833598 3300049588 Bacteria 721
371 Ga0501073_0019298 3300049589 Bacteria 4923
372 Ga0501073_0141895 3300049589 Bacteria 1664
373 Ga0501073_0352937 3300049589 Bacteria 1015
374 Ga0501073_1207936 3300049589 Bacteria 519
375 Ga0501074_0086964 3300049590 Bacteria 2239
376 Ga0501079_0255172 3300049741 Bacteria 1371
377 Ga0501080_0000092 3300049742 Bacteria 60619
378 Ga0501083_0000011 3300049744 Bacteria 181041
379 Ga0501083_0037195 3300049744 Bacteria 3316
380 Ga0501083_0049995 3300049744 Bacteria 2815
381 Ga0501083_0606709 3300049744 Bacteria 712
382 Ga0501035_0013421 3300049822 Bacteria 7561
383 Ga0501035_0069684 3300049822 Bacteria 3116
384 Ga0501035_0082162 3300049822 Bacteria 2843
385 Ga0501035_0135956 3300049822 Bacteria 2140
386 Ga0501035_0374223 3300049822 Bacteria 1189
387 Ga0501035_0418370 3300049822 Bacteria 1113
388 Ga0501044_0009041 3300049823 Bacteria 10890
389 Ga0501044_0017495 3300049823 Bacteria 7692
390 Ga0501044_0017572 3300049823 Bacteria 7671
391 Ga0501044_0078822 3300049823 Bacteria 3338
392 Ga0501044_0107056 3300049823 Bacteria 2807
393 Ga0501044_0216339 3300049823 Bacteria 1868
394 Ga0501044_0686399 3300049823 Bacteria 910
395 Ga0501045_0060827 3300049824 Bacteria 2769
396 nmdc:mga00v17_2594_c1 3300050491 Bacteria 9263
397 nmdc:mga0yw44_108739_c1 3300050492 Bacteria 1774
398 nmdc:mga0yw44_199623_c1 3300050492 Bacteria 1321
399 nmdc:mga06z11_916710_c1 3300050494 Bacteria 534
400 nmdc:mga0qj67_1411456_c1 3300050509 Bacteria 537
401 Ga0500635_0000505 3300053080 Bacteria 10779
402 Ga0500635_0022215 3300053080 Bacteria 1964
403 Ga0500643_000297 3300053087 Bacteria 41873
404 Ga0500556_0000041 3300053104 Bacteria 134317
405 Ga0500562_000624 3300053108 Bacteria 8540
406 Ga0500655_005012 3300053133 Bacteria 2381
407 Ga0500559_0001662 3300053136 Bacteria 12307
408 Ga0500559_0315538 3300053136 Bacteria 733
409 Ga0500568_0000003 3300053139 Bacteria 863587
410 Ga0500573_0000011 3300053140 Bacteria 209484
411 Ga0500573_0001100 3300053140 Bacteria 12533
412 Ga0500573_0012695 3300053140 Bacteria 4735
413 Ga0500573_0019828 3300053140 Bacteria 3848
414 Ga0500573_0026506 3300053140 Bacteria 3331
415 Ga0500573_0036733 3300053140 Bacteria 2829
416 Ga0500573_0063038 3300053140 Bacteria 2121
417 Ga0500573_0098905 3300053140 Bacteria 1643
418 Ga0500573_0162312 3300053140 Bacteria 1215
419 Ga0500573_0356871 3300053140 Bacteria 708
420 Ga0500577_0024964 3300053142 Bacteria 2016
421 Ga0500577_0037570 3300053142 Bacteria 1743
422 Ga0500577_0101717 3300053142 Bacteria 1175
423 Ga0500588_0003164 3300053146 Bacteria 3446
424 Ga0500590_039823 3300053148 Bacteria 2422
425 Ga0500616_0000040 3300053153 Bacteria 367604
426 Ga0500620_000141 3300053155 Bacteria 14598
427 Ga0501084_0055677 3300054114 Bacteria 3309
428 Ga0466962_0134325 3300061719 Bacteria 1197
429 2587864882 2585428094 Bacteria 3604039
430 2643766654 2643221549 Bacteria 4042819
431 2643877492 2643221572 Bacteria 3614809
432 2644094741 2643221616 Bacteria 4066575
433 2644113421 2643221619 Bacteria 4158469
434 2644181277 2643221632 Bacteria 3406696
435 2644384547 2643221669 Bacteria 3611286
436 2723640592 2721755702 Bacteria 4373124
437 2753302741 2751185788 Bacteria 4541048
438 2808903787 2808606372 Bacteria 4649509
439 2844845078 2844841374 Bacteria 3917147
440 2844853103 2844852863 Bacteria 3849151
441 2852643604 2852643534 Bacteria 3013378
442 2857736215 2857733635 Bacteria 3532004
443 2857740160 2857737099 Bacteria 3104305
444 2862994379 2862993130 Bacteria 3860849
445 2870624933 2870622029 Bacteria 3643329
446 2884764094 2884763398 Bacteria 4091164
447 2895662327 2895660088 Bacteria 3782833
448 2904434101 2904430863 Bacteria 3486923
449 2904504032 2904501621 Bacteria 3401437
450 2908676997 2908674828 Bacteria 3382763
451 2909076825 2909074476 Bacteria 3436050
452 2919039437 2919039151 Bacteria 3391018
453 2919042829 2919042368 Bacteria 3905917
454 2919056906 2919055335 Bacteria 3875751
455 2928106207 2928104781 Bacteria 3877447
456 2928154615 2928153084 Bacteria 4020257
457 2928502139 2928500415 Bacteria 3384541
458 2935410087 2935409751 Bacteria 4179611
459 2939659717 2939657138 Bacteria 3740283
460 2939663855 2939660829 Bacteria 3784848
461 2966923146 2966921586 Bacteria 3092803
462 2966925550 2966924647 Bacteria 3268643
463 2984554889 2984551494 Bacteria 3877562
464 2995726637 2995726249 Bacteria 3470435
465 8046355066 8046352972 Bacteria 3613806
466 8055037229 8055034563 Bacteria 3562128
467 8055039440 8055037949 Bacteria 3337834
468 8056038377 8056037122 Bacteria 3854319
469 8057346080 8057345674 Bacteria 4160394
470 Ga0495620_0342687
471 JGI25162J39368_1007050
472 JGI25164J39214_1000796
473 JGI25165J46597_1000014
474 JGI25165J46597_1000125
475 rootH1_10097191
476 Ga0006562J51391_1056202
477 Ga0055539_1000006
478 Ga0055539_1017996
479 Ga0055533_1000002
480 Ga0055532_1005594
481 Ga0055525_1000223
482 Ga0055527_1000003
483 Ga0055542_1000005
484 Ga0055529_1000006
485 Ga0070658_10076796
486 Ga0070658_10276412
487 Ga0070658_11159049
488 Ga0070670_100563834
489 Ga0068869_100144163
490 Ga0070666_10057313
491 Ga0070682_100530901
492 Ga0068868_100039905
493 Ga0070660_100175360
494 Ga0070660_100237275
495 Ga0070668_100998172
496 Ga0070671_100512239
497 Ga0070659_100000482
498 Ga0070659_100148188
499 Ga0070667_100937509
500 Ga0070710_10419993
501 Ga0070663_100111257
502 Ga0070663_100457315
503 Ga0070685_10075302
504 Ga0068853_100022255
505 Ga0070672_100040803
506 Ga0068855_100000569
507 Ga0068855_100175322
508 Ga0068855_100792928
509 Ga0068855_101040448
510 Ga0068855_101727114
511 Ga0068855_102086155
512 Ga0068857_100000239
513 Ga0068857_101402469
514 Ga0068854_100291515
515 Ga0068856_100103334
516 Ga0068856_100576050
517 Ga0068856_101213438
518 Ga0068852_100022750
519 Ga0068852_100143901
520 Ga0068859_100297249
521 Ga0068864_100093156
522 Ga0068851_10000027
523 Ga0068851_10180785
524 Ga0068863_101551749
525 Ga0075365_10138551
526 Ga0075364_10006791
527 Ga0075364_10202387
528 Ga0075364_10338747
529 Ga0097620_100297234
530 Ga0105240_10486162
531 Ga0105240_10982374
532 Ga0105245_10054442
533 Ga0105247_10145871
534 Ga0105247_10255834
535 Ga0105241_10050671
536 Ga0105241_11479202
537 Ga0105248_10000492
538 Ga0105248_10019436
539 Ga0105237_10000442
540 Ga0105237_10119858
541 Ga0105238_10015350
542 Ga0105238_10163828
543 Ga0105238_10554192
544 Ga0105239_10056750
545 Ga0105239_11147535
546 Ga0105239_11336717
547 Ga0105239_11830989
548 Ga0157370_10014835
549 Ga0157370_10195745
550 Ga0157369_10018468
551 Ga0157374_10168275
552 Ga0157374_12082689
553 Ga0163162_10485000
554 Ga0157372_10146947
555 Ga0157372_10449198
556 Ga0157372_11604436
557 Ga0157375_10134328
558 Ga0157375_10172106
559 Ga0157375_10454271
560 Ga0157375_10667693
561 Ga0163163_10084876
562 Ga0163163_10363656
563 Ga0197907_10362185
564 Ga0197907_11190262
565 Ga0206356_10216627
566 Ga0206349_1191997
567 Ga0206355_1320943
568 Ga0206351_10302037
569 Ga0206351_10924243
570 Ga0206352_10530069
571 Ga0206350_10199319
572 Ga0206350_10703538
573 Ga0206354_10810658
574 Ga0206353_10061093
575 Ga0154015_1358594
576 Ga0224712_10044691
577 Ga0209566_100032
578 Ga0209674_100001
579 Ga0209672_100003
580 Ga0209147_101047
581 Ga0209563_100001
582 Ga0209563_100326
583 Ga0207427_100039
584 Ga0209437_100599
585 Ga0209258_106285
586 Ga0209677_100001
587 Ga0209677_100406
588 Ga0209148_1000004
589 Ga0209148_1002028
590 Ga0209129_1019770
591 Ga0209233_1000014
592 Ga0209233_1040493
593 Ga0209455_1000091
594 Ga0207656_10000001
595 Ga0207656_10062423
596 Ga0207692_10347307
597 Ga0207710_10093041
598 Ga0207710_10229055
599 Ga0207647_10042047
600 Ga0207705_10000001
601 Ga0207705_10044334
602 Ga0207705_10136403
603 Ga0207705_10149823
604 Ga0207705_10173072
605 Ga0207654_10000001
606 Ga0207695_10003163
607 Ga0207695_10006597
608 Ga0207695_10451631
609 Ga0207695_10851566
610 Ga0207671_10000001
611 Ga0207671_10127805
612 Ga0207657_10036357
613 Ga0207657_10063821
614 Ga0207649_10089603
615 Ga0207694_10000420
616 Ga0207650_11313990
617 Ga0207687_10027545
618 Ga0207644_11266000
619 Ga0207690_10000300
620 Ga0207690_10067347
621 Ga0207709_10914968
622 Ga0207691_10092793
623 Ga0207711_10001676
624 Ga0207711_10043495
625 Ga0207689_10786711
626 Ga0207667_10003290
627 Ga0207667_10005356
628 Ga0207667_10005569
629 Ga0207667_10629105
630 Ga0207667_10718389
631 Ga0207640_11478187
632 Ga0207658_10787939
633 Ga0207703_10000224
634 Ga0207639_10017834
635 Ga0207639_10032822
636 Ga0207678_10233727
637 Ga0207678_10480393
638 Ga0207702_10087545
639 Ga0207702_10492423
640 Ga0207641_11312571
641 Ga0207676_10888316
642 Ga0207674_10001276
643 Ga0207674_10113726
644 Ga0207698_10000473
645 Ga0207698_10000591
646 Ga0207698_10195879
647 Ga0268265_10312438
648 Ga0307515_10065382
649 Ga0307515_10281435
650 Ga0307515_10295960
651 Ga0307513_10188059
652 Ga0307513_11002181
653 Ga0307514_10004141
654 Ga0307413_10425534
655 Ga0307518_10259890
656 Ga0307410_10102484
657 Ga0307406_10023710
658 Ga0307412_10170273
659 Ga0307412_10747714
660 Ga0307412_11175402
661 Ga0307416_100435418
662 Ga0307415_100309089
663 Ga0395899_0003980
664 Ga0395900_0161151
665 Ga0395901_0420429
666 Ga0395901_1480176
667 Ga0439465_0275485
668 Ga0451791_1588114
669 Ga0451793_0124887
670 Ga0451793_0277597
671 Ga0451793_0523654
672 Ga0451793_0943848
673 Ga0451793_1643693
674 Ga0451797_1137175
675 Ga0451795_0926964
676 Ga0451795_1302916
677 Ga0451800_0541600
678 Ga0451802_1809820
679 Ga0451806_712886
680 Ga0451841_0346760
681 Ga0451847_0425482
682 Ga0451853_3926263
683 Ga0451853_4106937
684 Ga0439457_096258
685 Ga0466969_0224737
686 Ga0466972_0077356
687 Ga0466972_0125388
688 Ga0466972_0323832
689 Ga0466972_0439477
690 Ga0466965_0031080
691 Ga0466965_0084228
692 Ga0466966_0049994
693 Ga0466966_0092573
694 Ga0466961_0225822
695 Ga0466961_0264562
696 Ga0466971_0416857
697 Ga0466968_0092331
698 Ga0466970_0003621
699 Ga0466970_0041380
700 Ga0466970_0043989
701 Ga0466970_0323921
702 Ga0466957_0181837
703 Ga0466960_0037679
704 Ga0466959_0067426
705 Ga0466958_0291009
706 Ga0466967_0658292
707 Ga0466967_1778431
708 Ga0495590_0002706
709 Ga0495650_0000770
710 Ga0495580_0105585
711 Ga0495606_0223736
712 Ga0495632_0123742
713 Ga0495625_0603547
714 Ga0495588_0046650
715 Ga0495581_0096987
716 Ga0495672_0019950
717 Ga0495672_0095528
718 Ga0495673_0204137
719 Ga0495686_0148713
720 Ga0495686_0160868
721 Ga0496100_0043464
722 Ga0496101_0024597
723 Ga0496101_0200078
724 Ga0496102_0706909
725 Ga0496104_0153249
726 Ga0496104_0639336
727 Ga0496105_0091345
728 Ga0496113_0315396
729 Ga0496114_0013243
730 Ga0496114_0080692
731 Ga0496115_0043446
732 Ga0496115_0255670
733 Ga0496117_0004795
734 Ga0496117_0032010
735 Ga0496117_0036516
736 Ga0496117_0043162
737 Ga0496118_0000472
738 Ga0496119_0000905
739 Ga0496119_0061493
740 Ga0496119_0198978
741 Ga0496119_0375335
742 Ga0496120_0002435
743 Ga0496120_0028113
744 Ga0496120_0107364
745 Ga0496120_0178600
746 Ga0496121_0000015
747 Ga0496121_0409194
748 Ga0496121_0414571
749 Ga0496122_0001688
750 Ga0496123_0015117
751 Ga0496124_0000040
752 Ga0496125_0229545
753 Ga0496126_0295474
754 Ga0496126_0352094
755 Ga0496126_0570961
756 Ga0496126_0614933
757 Ga0501031_0016691
758 Ga0501032_0006421
759 Ga0501032_0006536
760 Ga0501032_0044095
761 Ga0501033_0003088
762 Ga0501033_0007742
763 Ga0501033_0012546
764 Ga0501033_0052509
765 Ga0501033_0077775
766 Ga0501033_0095304
767 Ga0501033_0103380
768 Ga0501033_0406958
769 Ga0501034_0008302
770 Ga0501034_0018348
771 Ga0501034_0040767
772 Ga0501034_0042209
773 Ga0501034_0056708
774 Ga0501034_0077430
775 Ga0501034_0110271
776 Ga0501034_0238007
777 Ga0501034_0285811
778 Ga0501034_0295120
779 Ga0501034_0303839
780 Ga0501034_1031675
781 Ga0501036_0013201
782 Ga0501036_0139205
783 Ga0501036_0181793
784 Ga0501036_0202534
785 Ga0501036_0863656
786 Ga0501037_0021659
787 Ga0501037_0051907
788 Ga0501037_0076941
789 Ga0501037_0095599
790 Ga0501037_0143615
791 Ga0501037_0309786
792 Ga0501037_0574185
793 Ga0501038_0004245
794 Ga0501038_0015122
795 Ga0501038_0181984
796 Ga0501038_0288508
797 Ga0501039_0020137
798 Ga0501039_0086557
799 Ga0501039_0154499
800 Ga0501039_0275618
801 Ga0501039_1222230
802 Ga0501040_1381756
803 Ga0501042_0054225
804 Ga0501042_0083580
805 Ga0501043_0012047
806 Ga0501043_0012355
807 Ga0501043_0050120
808 Ga0501043_0241928
809 Ga0501043_0532645
810 Ga0501046_0011643
811 Ga0501046_0040782
812 Ga0501046_0137064
813 Ga0501046_0376474
814 Ga0501047_0051731
815 Ga0501047_0151416
816 Ga0501047_0187916
817 Ga0501047_0355567
818 Ga0501047_0411546
819 Ga0501047_0721618
820 Ga0501048_0000826
821 Ga0501048_0070152
822 Ga0501048_0227388
823 Ga0501048_1233783
824 Ga0501067_0016214
825 Ga0501068_0056338
826 Ga0501068_0056343
827 Ga0501068_0101937
828 Ga0501069_0111771
829 Ga0501069_0511526
830 Ga0501070_0000076
831 Ga0501070_0003466
832 Ga0501070_0031034
833 Ga0501070_0040299
834 Ga0501070_0061844
835 Ga0501070_0921308
836 Ga0501070_1198556
837 Ga0501071_0006160
838 Ga0501071_0163258
839 Ga0501072_0833598
840 Ga0501073_0019298
841 Ga0501073_0141895
842 Ga0501073_0352937
843 Ga0501073_1207936
844 Ga0501074_0086964
845 Ga0501079_0255172
846 Ga0501080_0000092
847 Ga0501083_0000011
848 Ga0501083_0037195
849 Ga0501083_0049995
850 Ga0501083_0606709
851 Ga0501035_0013421
852 Ga0501035_0069684
853 Ga0501035_0082162
854 Ga0501035_0135956
855 Ga0501035_0374223
856 Ga0501035_0418370
857 Ga0501044_0009041
858 Ga0501044_0017495
859 Ga0501044_0017572
860 Ga0501044_0078822
861 Ga0501044_0107056
862 Ga0501044_0216339
863 Ga0501044_0686399
864 Ga0501045_0060827
865 nmdc:mga00v17_2594_c1
866 nmdc:mga0yw44_108739_c1
867 nmdc:mga0yw44_199623_c1
868 nmdc:mga06z11_916710_c1
869 nmdc:mga0qj67_1411456_c1
870 Ga0500635_0000505
871 Ga0500635_0022215
872 Ga0500643_000297
873 Ga0500556_0000041
874 Ga0500562_000624
875 Ga0500655_005012
876 Ga0500559_0001662
877 Ga0500559_0315538
878 Ga0500568_0000003
879 Ga0500573_0000011
880 Ga0500573_0001100
881 Ga0500573_0012695
882 Ga0500573_0019828
883 Ga0500573_0026506
884 Ga0500573_0036733
885 Ga0500573_0063038
886 Ga0500573_0098905
887 Ga0500573_0162312
888 Ga0500573_0356871
889 Ga0500577_0024964
890 Ga0500577_0037570
891 Ga0500577_0101717
892 Ga0500588_0003164
893 Ga0500590_039823
894 Ga0500616_0000040
895 Ga0500620_000141
896 Ga0501084_0055677
897 Ga0466962_0134325
898 2587864882
899 2643766654
900 2643877492
901 2644094741
902 2644113421
903 2644181277
904 2644384547
905 2723640592
906 2753302741
907 2808903787
908 2844845078
909 2844853103
910 2852643604
911 2857736215
912 2857740160
913 2862994379
914 2870624933
915 2884764094
916 2895662327
917 2904434101
918 2904504032
919 2908676997
920 2909076825
921 2919039437
922 2919042829
923 2919056906
924 2928106207
925 2928154615
926 2928502139
927 2935410087
928 2939659717
929 2939663855
930 2966923146
931 2966925550
932 2984554889
933 2995726637
934 8046355066
935 8055037229
936 8055039440
937 8056038377
938 8057346080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

15

147

0.9

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

56

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9577 5 141
5zy8-assembly1.cif.gz_A crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9465 5 140
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.9422 2 143
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9397 1 144
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.9379 1 145
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9607 4 144 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9379 1 145 3.10.129.10
af_P9WFJ9_1_152_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9373 5 146 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9267 6 140 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9257 1 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4V3FB53-F1-model_v4 deleted 0.9933 1 146
AF-A0A1H4V894-F1-model_v4 UPF0336 protein SAMN04490220_2521 0.993 1 146
AF-A0A839G4M2-F1-model_v4 deleted 0.9928 1 146
AF-A0A367XUJ0-F1-model_v4 UPF0336 protein DTO57_13380 0.9918 1 146 GO:0006633
GO:0019171
AF-A0A4V3CYU4-F1-model_v4 UPF0336 protein EDF62_0147 0.9912 1 146 GO:0006633
GO:0019171

Map