F450306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 255 | 469 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300048088|Ga0495602_0020939|Ga0495602_0020939_4715_5596 |
| Length | 275 |
| Sequence | VALEKCHGFRAKARQYGTGLPRRGFIPIGFLVVSDGQNRGFGVAAGLDPAVARPLAERCAELGYGSMWSNDHPGAKGLETLAEFDAAAPGIDLGVAVIALDRTPPETIAVDIERLDLDPARLWLGVGAGFSKKPLTRMAEMGPKMCALAGSGFDGAFFNWMTPEFAVRSRELVEAGAREMGRDTPPVFGYVRTAVGPDAPERLAKEESFYRDLHPGYRNHFNRLAEPEGTVGVAAADAPEAEQKLAAYTALDTVVVRGLASATVEAMTAVAAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 210 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 251 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 252 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 253 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.99 |
| Nodule | 0 |
| Rhizoplane | 14.07 |
| Rhizosphere | 82.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1001440 | 3300002074 | Bacteria | 2618 |
| 2 | JGI24034J26672_10000567 | 3300002239 | Bacteria | 4710 |
| 3 | Ga0070683_100004550 | 3300005329 | Bacteria | 11445 |
| 4 | Ga0070683_100065971 | 3300005329 | Bacteria | 3371 |
| 5 | Ga0070683_100103824 | 3300005329 | Bacteria | 2679 |
| 6 | Ga0070683_100133596 | 3300005329 | Bacteria | 2349 |
| 7 | Ga0070677_10000030 | 3300005333 | Bacteria | 41834 |
| 8 | Ga0070680_100063191 | 3300005336 | Bacteria | 3032 |
| 9 | Ga0070682_100000057 | 3300005337 | Bacteria | 108832 |
| 10 | Ga0070682_100000100 | 3300005337 | Bacteria | 77054 |
| 11 | Ga0070682_100501483 | 3300005337 | Bacteria | 941 |
| 12 | Ga0068868_100047588 | 3300005338 | Bacteria | 3362 |
| 13 | Ga0068868_100269549 | 3300005338 | Unclassified | 1438 |
| 14 | Ga0070691_10003021 | 3300005341 | Bacteria | 7535 |
| 15 | Ga0070691_10123658 | 3300005341 | Bacteria | 1305 |
| 16 | Ga0070661_100000031 | 3300005344 | Bacteria | 113816 |
| 17 | Ga0070668_100021473 | 3300005347 | Bacteria | 4877 |
| 18 | Ga0070668_100030816 | 3300005347 | Bacteria | 4080 |
| 19 | Ga0070675_100000073 | 3300005354 | Bacteria | 57652 |
| 20 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 21 | Ga0070674_100023861 | 3300005356 | Bacteria | 3966 |
| 22 | Ga0070673_100062059 | 3300005364 | Bacteria | 2968 |
| 23 | Ga0070688_100000506 | 3300005365 | Bacteria | 19723 |
| 24 | Ga0070688_100000848 | 3300005365 | Bacteria | 15156 |
| 25 | Ga0070659_100002416 | 3300005366 | Bacteria | 13275 |
| 26 | Ga0070667_100055937 | 3300005367 | Bacteria | 3332 |
| 27 | Ga0070714_100120443 | 3300005435 | Bacteria | 2334 |
| 28 | Ga0070713_100000040 | 3300005436 | Bacteria | 82527 |
| 29 | Ga0070713_100126582 | 3300005436 | Bacteria | 2248 |
| 30 | Ga0070701_10044345 | 3300005438 | Bacteria | 2278 |
| 31 | Ga0070711_100006965 | 3300005439 | Bacteria | 6856 |
| 32 | Ga0070700_100015791 | 3300005441 | Bacteria | 4289 |
| 33 | Ga0070700_100023617 | 3300005441 | Bacteria | 3598 |
| 34 | Ga0070694_100557601 | 3300005444 | Bacteria | 918 |
| 35 | Ga0070708_100335039 | 3300005445 | Bacteria | 1426 |
| 36 | Ga0070663_100063976 | 3300005455 | Bacteria | 2658 |
| 37 | Ga0070678_100022773 | 3300005456 | Bacteria | 4160 |
| 38 | Ga0070678_100172703 | 3300005456 | Unclassified | 1762 |
| 39 | Ga0070662_100000005 | 3300005457 | Bacteria | 183056 |
| 40 | Ga0070681_10003375 | 3300005458 | Bacteria | 14931 |
| 41 | Ga0070685_10000932 | 3300005466 | Bacteria | 15756 |
| 42 | Ga0070685_10002367 | 3300005466 | Bacteria | 9704 |
| 43 | Ga0070679_100000342 | 3300005530 | Bacteria | 39556 |
| 44 | Ga0070684_100030495 | 3300005535 | Bacteria | 4582 |
| 45 | Ga0070684_100058588 | 3300005535 | Bacteria | 3366 |
| 46 | Ga0068853_100010810 | 3300005539 | Bacteria | 7393 |
| 47 | Ga0068853_100290377 | 3300005539 | Bacteria | 1509 |
| 48 | Ga0070672_100000023 | 3300005543 | Bacteria | 68631 |
| 49 | Ga0070686_100021305 | 3300005544 | Bacteria | 3850 |
| 50 | Ga0070693_100000815 | 3300005547 | Bacteria | 13820 |
| 51 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 52 | Ga0070665_100005655 | 3300005548 | Bacteria | 12855 |
| 53 | Ga0070665_100051337 | 3300005548 | Bacteria | 4136 |
| 54 | Ga0070665_100206134 | 3300005548 | Bacteria | 1967 |
| 55 | Ga0070704_100011003 | 3300005549 | Bacteria | 5521 |
| 56 | Ga0070704_100804640 | 3300005549 | Unclassified | 840 |
| 57 | Ga0068855_100217765 | 3300005563 | Bacteria | 2143 |
| 58 | Ga0070664_100032745 | 3300005564 | Bacteria | 4348 |
| 59 | Ga0068857_100086637 | 3300005577 | Bacteria | 2801 |
| 60 | Ga0068857_100319347 | 3300005577 | Bacteria | 1434 |
| 61 | Ga0068854_100000228 | 3300005578 | Bacteria | 38071 |
| 62 | Ga0068854_100044691 | 3300005578 | Bacteria | 3146 |
| 63 | Ga0068856_100011606 | 3300005614 | Bacteria | 8546 |
| 64 | Ga0068856_100017999 | 3300005614 | Bacteria | 6850 |
| 65 | Ga0068856_100036276 | 3300005614 | Bacteria | 4834 |
| 66 | Ga0068852_100000131 | 3300005616 | Bacteria | 50602 |
| 67 | Ga0068852_100023662 | 3300005616 | Bacteria | 4948 |
| 68 | Ga0068852_100213667 | 3300005616 | Bacteria | 1831 |
| 69 | Ga0068864_100000262 | 3300005618 | Bacteria | 47006 |
| 70 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 71 | Ga0068866_10018222 | 3300005718 | Bacteria | 3172 |
| 72 | Ga0068861_100183345 | 3300005719 | Bacteria | 1744 |
| 73 | Ga0068851_10001684 | 3300005834 | Bacteria | 9671 |
| 74 | Ga0068851_10021394 | 3300005834 | Bacteria | 3140 |
| 75 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 76 | Ga0068863_100030645 | 3300005841 | Bacteria | 5136 |
| 77 | Ga0068858_100000043 | 3300005842 | Bacteria | 132444 |
| 78 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 79 | Ga0068860_100008225 | 3300005843 | Bacteria | 10383 |
| 80 | Ga0068860_100224887 | 3300005843 | Bacteria | 1823 |
| 81 | Ga0081455_10041442 | 3300005937 | Bacteria | 4048 |
| 82 | Ga0081455_10090771 | 3300005937 | Bacteria | 2476 |
| 83 | Ga0081455_10232850 | 3300005937 | Bacteria | 1358 |
| 84 | Ga0081538_10008571 | 3300005981 | Bacteria | 8653 |
| 85 | Ga0081540_1000025 | 3300005983 | Bacteria | 157742 |
| 86 | Ga0081540_1062711 | 3300005983 | Bacteria | 1763 |
| 87 | Ga0081539_10001602 | 3300005985 | Bacteria | 37290 |
| 88 | Ga0075365_10202300 | 3300006038 | Bacteria | 1391 |
| 89 | Ga0075365_10215812 | 3300006038 | Bacteria | 1345 |
| 90 | Ga0075363_100030246 | 3300006048 | Unclassified | 2802 |
| 91 | Ga0075364_10040728 | 3300006051 | Bacteria | 3014 |
| 92 | Ga0075364_10109866 | 3300006051 | Unclassified | 1839 |
| 93 | Ga0070715_10000012 | 3300006163 | Bacteria | 173731 |
| 94 | Ga0070712_100004470 | 3300006175 | Bacteria | 8632 |
| 95 | Ga0070712_100023424 | 3300006175 | Bacteria | 4079 |
| 96 | Ga0068871_100186873 | 3300006358 | Bacteria | 1783 |
| 97 | Ga0075430_100113990 | 3300006846 | Bacteria | 2253 |
| 98 | Ga0075431_100013519 | 3300006847 | Bacteria | 8246 |
| 99 | Ga0075431_100061325 | 3300006847 | Bacteria | 3881 |
| 100 | Ga0075433_10000093 | 3300006852 | Bacteria | 42077 |
| 101 | Ga0075433_10008121 | 3300006852 | Bacteria | 8359 |
| 102 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 103 | Ga0111539_10243271 | 3300009094 | Bacteria | 2095 |
| 104 | Ga0105245_10000091 | 3300009098 | Bacteria | 89925 |
| 105 | Ga0105245_10000955 | 3300009098 | Bacteria | 26277 |
| 106 | Ga0105245_10001248 | 3300009098 | Bacteria | 22969 |
| 107 | Ga0105245_10001267 | 3300009098 | Bacteria | 22830 |
| 108 | Ga0105245_10001725 | 3300009098 | Bacteria | 19939 |
| 109 | Ga0105245_10237132 | 3300009098 | Bacteria | 1767 |
| 110 | Ga0114129_10239477 | 3300009147 | Bacteria | 2439 |
| 111 | Ga0105243_10041345 | 3300009148 | Bacteria | 3606 |
| 112 | Ga0105243_10174056 | 3300009148 | Bacteria | 1867 |
| 113 | Ga0105241_10105944 | 3300009174 | Bacteria | 2243 |
| 114 | Ga0105242_10000575 | 3300009176 | Bacteria | 29085 |
| 115 | Ga0105242_10411471 | 3300009176 | Unclassified | 1265 |
| 116 | Ga0105248_10000466 | 3300009177 | Bacteria | 46063 |
| 117 | Ga0105249_10000192 | 3300009553 | Bacteria | 69997 |
| 118 | Ga0105249_10944388 | 3300009553 | Unclassified | 930 |
| 119 | Ga0105239_10108396 | 3300010375 | Bacteria | 3077 |
| 120 | Ga0105239_10290788 | 3300010375 | Bacteria | 1840 |
| 121 | Ga0105239_10374275 | 3300010375 | Bacteria | 1610 |
| 122 | Ga0105246_10025900 | 3300011119 | Bacteria | 3826 |
| 123 | Ga0105246_10143545 | 3300011119 | Bacteria | 1798 |
| 124 | Ga0157342_1014853 | 3300012507 | Bacteria | 847 |
| 125 | Ga0157370_10027409 | 3300013104 | Bacteria | 5617 |
| 126 | Ga0157369_10000128 | 3300013105 | Bacteria | 108576 |
| 127 | Ga0157374_10010028 | 3300013296 | Bacteria | 8132 |
| 128 | Ga0157374_10027538 | 3300013296 | Bacteria | 5131 |
| 129 | Ga0157378_10074028 | 3300013297 | Bacteria | 3064 |
| 130 | Ga0157372_10000121 | 3300013307 | Bacteria | 83548 |
| 131 | Ga0157375_10051373 | 3300013308 | Bacteria | 4048 |
| 132 | Ga0157375_10057327 | 3300013308 | Bacteria | 3850 |
| 133 | Ga0157375_10084307 | 3300013308 | Bacteria | 3226 |
| 134 | Ga0157375_10085865 | 3300013308 | Bacteria | 3197 |
| 135 | Ga0163163_10376506 | 3300014325 | Bacteria | 1477 |
| 136 | Ga0157380_10000373 | 3300014326 | Bacteria | 26937 |
| 137 | Ga0157379_10218254 | 3300014968 | Bacteria | 1727 |
| 138 | Ga0163161_10000073 | 3300017792 | Bacteria | 102053 |
| 139 | Ga0163161_10405360 | 3300017792 | Unclassified | 1094 |
| 140 | Ga0207656_10012500 | 3300025321 | Bacteria | 3230 |
| 141 | Ga0207656_10063223 | 3300025321 | Bacteria | 1629 |
| 142 | Ga0207682_10000003 | 3300025893 | Bacteria | 128548 |
| 143 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 144 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 145 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 146 | Ga0207642_10011311 | 3300025899 | Bacteria | 3178 |
| 147 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 148 | Ga0207654_10049517 | 3300025911 | Bacteria | 2410 |
| 149 | Ga0207707_10021445 | 3300025912 | Bacteria | 5647 |
| 150 | Ga0207693_10002303 | 3300025915 | Bacteria | 16597 |
| 151 | Ga0207693_10002931 | 3300025915 | Bacteria | 14766 |
| 152 | Ga0207663_10004537 | 3300025916 | Bacteria | 6914 |
| 153 | Ga0207660_10043074 | 3300025917 | Bacteria | 3171 |
| 154 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 155 | Ga0207652_10000351 | 3300025921 | Bacteria | 47656 |
| 156 | Ga0207659_10000082 | 3300025926 | Bacteria | 57573 |
| 157 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 158 | Ga0207687_10000042 | 3300025927 | Bacteria | 108169 |
| 159 | Ga0207687_10000613 | 3300025927 | Bacteria | 24053 |
| 160 | Ga0207700_10000032 | 3300025928 | Bacteria | 125088 |
| 161 | Ga0207700_10286312 | 3300025928 | Bacteria | 1419 |
| 162 | Ga0207644_10062240 | 3300025931 | Bacteria | 2706 |
| 163 | Ga0207690_10001263 | 3300025932 | Bacteria | 16002 |
| 164 | Ga0207686_10000042 | 3300025934 | Bacteria | 122852 |
| 165 | Ga0207686_10004598 | 3300025934 | Bacteria | 7395 |
| 166 | Ga0207686_10037675 | 3300025934 | Bacteria | 2920 |
| 167 | Ga0207709_10022401 | 3300025935 | Bacteria | 3583 |
| 168 | Ga0207709_10051350 | 3300025935 | Bacteria | 2527 |
| 169 | Ga0207709_10137193 | 3300025935 | Bacteria | 1676 |
| 170 | Ga0207670_10182725 | 3300025936 | Bacteria | 1581 |
| 171 | Ga0207669_10000023 | 3300025937 | Bacteria | 96638 |
| 172 | Ga0207704_10000012 | 3300025938 | Bacteria | 178319 |
| 173 | Ga0207665_10071435 | 3300025939 | Bacteria | 2370 |
| 174 | Ga0207691_10000172 | 3300025940 | Bacteria | 60310 |
| 175 | Ga0207711_10000085 | 3300025941 | Bacteria | 99467 |
| 176 | Ga0207661_10000192 | 3300025944 | Bacteria | 39824 |
| 177 | Ga0207661_10002060 | 3300025944 | Bacteria | 13837 |
| 178 | Ga0207661_10004186 | 3300025944 | Bacteria | 10093 |
| 179 | Ga0207661_10026767 | 3300025944 | Bacteria | 4398 |
| 180 | Ga0207661_10066564 | 3300025944 | Bacteria | 2927 |
| 181 | Ga0207679_10018749 | 3300025945 | Bacteria | 4642 |
| 182 | Ga0207667_10145184 | 3300025949 | Bacteria | 2443 |
| 183 | Ga0207651_10001007 | 3300025960 | Bacteria | 12456 |
| 184 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 185 | Ga0207668_10075892 | 3300025972 | Bacteria | 2418 |
| 186 | Ga0207640_10000026 | 3300025981 | Bacteria | 142343 |
| 187 | Ga0207640_10007305 | 3300025981 | Bacteria | 6098 |
| 188 | Ga0207658_10029105 | 3300025986 | Bacteria | 3897 |
| 189 | Ga0207677_10000902 | 3300026023 | Bacteria | 16642 |
| 190 | Ga0207677_10179848 | 3300026023 | Bacteria | 1663 |
| 191 | Ga0207703_10000053 | 3300026035 | Bacteria | 143924 |
| 192 | Ga0207703_10000132 | 3300026035 | Bacteria | 90163 |
| 193 | Ga0207639_10017445 | 3300026041 | Bacteria | 5089 |
| 194 | Ga0207678_10410801 | 3300026067 | Bacteria | 1173 |
| 195 | Ga0207708_10039590 | 3300026075 | Bacteria | 3592 |
| 196 | Ga0207708_10154910 | 3300026075 | Bacteria | 1807 |
| 197 | Ga0207702_10000316 | 3300026078 | Bacteria | 55327 |
| 198 | Ga0207702_10022211 | 3300026078 | Bacteria | 5259 |
| 199 | Ga0207702_10025971 | 3300026078 | Bacteria | 4862 |
| 200 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 201 | Ga0207648_10001595 | 3300026089 | Bacteria | 24839 |
| 202 | Ga0207648_10035542 | 3300026089 | Bacteria | 4389 |
| 203 | Ga0207676_10000038 | 3300026095 | Bacteria | 171492 |
| 204 | Ga0207675_100126694 | 3300026118 | Bacteria | 2419 |
| 205 | Ga0207675_100786606 | 3300026118 | Bacteria | 964 |
| 206 | Ga0207683_10038680 | 3300026121 | Bacteria | 4160 |
| 207 | Ga0207683_10097553 | 3300026121 | Bacteria | 2621 |
| 208 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 209 | Ga0207698_10150520 | 3300026142 | Bacteria | 2019 |
| 210 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 211 | Ga0268266_10011667 | 3300028379 | Bacteria | 7627 |
| 212 | Ga0268266_10034171 | 3300028379 | Bacteria | 4324 |
| 213 | Ga0268266_10078323 | 3300028379 | Bacteria | 2876 |
| 214 | Ga0268264_10003521 | 3300028381 | Bacteria | 13496 |
| 215 | Ga0265337_1006261 | 3300028556 | Bacteria | 4613 |
| 216 | Ga0265326_10000027 | 3300028558 | Bacteria | 110843 |
| 217 | Ga0265319_1000548 | 3300028563 | Bacteria | 25570 |
| 218 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 219 | Ga0265338_10000047 | 3300028800 | Bacteria | 220905 |
| 220 | Ga0265324_10000103 | 3300029957 | Bacteria | 67507 |
| 221 | Ga0265328_10010469 | 3300031239 | Bacteria | 3731 |
| 222 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 223 | Ga0265329_10001629 | 3300031242 | Bacteria | 10760 |
| 224 | Ga0265331_10002979 | 3300031250 | Bacteria | 11146 |
| 225 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 226 | Ga0265316_10023411 | 3300031344 | Bacteria | 5189 |
| 227 | Ga0265314_10001375 | 3300031711 | Bacteria | 27314 |
| 228 | Ga0316576_10002289 | 3300031727 | Bacteria | 10851 |
| 229 | Ga0307415_100142799 | 3300032126 | Bacteria | 1831 |
| 230 | Ga0316574_0013026 | 3300035398 | Bacteria | 4771 |
| 231 | Ga0373937_0006840 | 3300036401 | Bacteria | 9841 |
| 232 | Ga0373937_0195038 | 3300036401 | Bacteria | 1903 |
| 233 | Ga0316584_0009370 | 3300036712 | Bacteria | 6792 |
| 234 | Ga0395900_0096233 | 3300037418 | Bacteria | 3042 |
| 235 | Ga0395900_0228438 | 3300037418 | Bacteria | 1873 |
| 236 | Ga0395901_0065476 | 3300038443 | Bacteria | 3784 |
| 237 | Ga0395901_0125976 | 3300038443 | Bacteria | 2692 |
| 238 | Ga0451833_0353539 | 3300041491 | Bacteria | 2162 |
| 239 | Ga0451853_2266777 | 3300041512 | Bacteria | 3683 |
| 240 | Ga0466963_0022205 | 3300044694 | Bacteria | 4016 |
| 241 | Ga0466963_0080948 | 3300044694 | Bacteria | 2199 |
| 242 | Ga0466957_0003682 | 3300044842 | Bacteria | 8460 |
| 243 | Ga0466967_0000007 | 3300045976 | Bacteria | 135597 |
| 244 | Ga0466967_0045840 | 3300045976 | Bacteria | 3802 |
| 245 | Ga0495592_0006735 | 3300046454 | Bacteria | 8570 |
| 246 | Ga0495592_0141577 | 3300046454 | Bacteria | 1672 |
| 247 | Ga0495592_0183159 | 3300046454 | Bacteria | 1425 |
| 248 | Ga0495603_0000044 | 3300046455 | Bacteria | 53548 |
| 249 | Ga0495603_0000291 | 3300046455 | Bacteria | 26643 |
| 250 | Ga0495603_0022441 | 3300046455 | Bacteria | 3820 |
| 251 | Ga0495629_0000976 | 3300046459 | Bacteria | 22977 |
| 252 | Ga0495629_0008682 | 3300046459 | Bacteria | 7482 |
| 253 | Ga0495629_0013552 | 3300046459 | Bacteria | 5882 |
| 254 | Ga0495641_0000012 | 3300046461 | Bacteria | 144818 |
| 255 | Ga0495641_0018220 | 3300046461 | Bacteria | 3629 |
| 256 | Ga0495651_0370730 | 3300046462 | Unclassified | 941 |
| 257 | Ga0495653_0067382 | 3300046463 | Bacteria | 2689 |
| 258 | Ga0495653_0071876 | 3300046463 | Bacteria | 2585 |
| 259 | Ga0495653_0107155 | 3300046463 | Unclassified | 2014 |
| 260 | Ga0495582_0000007 | 3300046473 | Bacteria | 139882 |
| 261 | Ga0495582_0096569 | 3300046473 | Bacteria | 1652 |
| 262 | Ga0495662_0000121 | 3300046476 | Bacteria | 28985 |
| 263 | Ga0495662_0007156 | 3300046476 | Bacteria | 5529 |
| 264 | Ga0495664_0194423 | 3300046477 | Bacteria | 1230 |
| 265 | Ga0495594_0000005 | 3300046499 | Bacteria | 175437 |
| 266 | Ga0495606_0000082 | 3300046507 | Bacteria | 159585 |
| 267 | Ga0495608_0000590 | 3300046511 | Bacteria | 24984 |
| 268 | Ga0495608_0001675 | 3300046511 | Bacteria | 15943 |
| 269 | Ga0495608_0099559 | 3300046511 | Bacteria | 1875 |
| 270 | Ga0495618_0000003 | 3300046514 | Bacteria | 256269 |
| 271 | Ga0495620_0000446 | 3300046515 | Bacteria | 27496 |
| 272 | Ga0495628_0002265 | 3300046516 | Bacteria | 17396 |
| 273 | Ga0495628_0009797 | 3300046516 | Bacteria | 8160 |
| 274 | Ga0495628_0051003 | 3300046516 | Bacteria | 3272 |
| 275 | Ga0495628_0053122 | 3300046516 | Bacteria | 3199 |
| 276 | Ga0495628_0505270 | 3300046516 | Bacteria | 872 |
| 277 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 278 | Ga0495630_0005868 | 3300046517 | Bacteria | 8685 |
| 279 | Ga0495630_0011828 | 3300046517 | Bacteria | 6323 |
| 280 | Ga0495630_0036118 | 3300046517 | Bacteria | 3694 |
| 281 | Ga0495630_0087146 | 3300046517 | Bacteria | 2358 |
| 282 | Ga0495644_0001081 | 3300046523 | Bacteria | 11303 |
| 283 | Ga0495652_0000060 | 3300046529 | Bacteria | 111891 |
| 284 | Ga0495652_0000061 | 3300046529 | Bacteria | 111729 |
| 285 | Ga0495640_0081934 | 3300046533 | Bacteria | 2144 |
| 286 | Ga0495586_0000384 | 3300046535 | Bacteria | 27060 |
| 287 | Ga0495587_0001311 | 3300046536 | Bacteria | 16514 |
| 288 | Ga0495587_0053463 | 3300046536 | Bacteria | 2381 |
| 289 | Ga0495587_0054477 | 3300046536 | Bacteria | 2357 |
| 290 | Ga0495587_0138687 | 3300046536 | Bacteria | 1388 |
| 291 | Ga0495598_0021713 | 3300046537 | Bacteria | 1710 |
| 292 | Ga0495621_0014670 | 3300046539 | Unclassified | 2484 |
| 293 | Ga0495645_0022954 | 3300046543 | Bacteria | 4516 |
| 294 | Ga0495645_0506122 | 3300046543 | Bacteria | 754 |
| 295 | Ga0495622_0000026 | 3300046557 | Bacteria | 137934 |
| 296 | Ga0495667_0000042 | 3300046559 | Bacteria | 124237 |
| 297 | Ga0495667_0119236 | 3300046559 | Bacteria | 1704 |
| 298 | Ga0495656_0003197 | 3300046615 | Bacteria | 5519 |
| 299 | Ga0495656_0114475 | 3300046615 | Unclassified | 1266 |
| 300 | Ga0495634_0009750 | 3300046642 | Bacteria | 7066 |
| 301 | Ga0495634_0173984 | 3300046642 | Bacteria | 1352 |
| 302 | Ga0495625_0000319 | 3300046660 | Bacteria | 73241 |
| 303 | Ga0495635_0000009 | 3300046663 | Bacteria | 259024 |
| 304 | Ga0495635_0005067 | 3300046663 | Bacteria | 9160 |
| 305 | Ga0495588_0000241 | 3300046674 | Bacteria | 46762 |
| 306 | Ga0495657_0000992 | 3300046675 | Bacteria | 24981 |
| 307 | Ga0495657_0090708 | 3300046675 | Bacteria | 1961 |
| 308 | Ga0495599_0029441 | 3300046678 | Bacteria | 3443 |
| 309 | Ga0495647_0000014 | 3300046681 | Bacteria | 87792 |
| 310 | Ga0495647_0001518 | 3300046681 | Bacteria | 7170 |
| 311 | Ga0495647_0015756 | 3300046681 | Bacteria | 2652 |
| 312 | Ga0495658_0000007 | 3300046683 | Bacteria | 139822 |
| 313 | Ga0495658_0002331 | 3300046683 | Bacteria | 9585 |
| 314 | Ga0495669_0000074 | 3300046684 | Bacteria | 66373 |
| 315 | Ga0495669_0015907 | 3300046684 | Bacteria | 3221 |
| 316 | Ga0495613_0000003 | 3300046689 | Bacteria | 248826 |
| 317 | Ga0495613_0000522 | 3300046689 | Bacteria | 32082 |
| 318 | Ga0495613_0171883 | 3300046689 | Bacteria | 1537 |
| 319 | Ga0495613_0216634 | 3300046689 | Unclassified | 1345 |
| 320 | Ga0495624_0000002 | 3300046690 | Bacteria | 189957 |
| 321 | Ga0495624_0000256 | 3300046690 | Bacteria | 42059 |
| 322 | Ga0495670_0026482 | 3300046691 | Bacteria | 2870 |
| 323 | Ga0495649_0005045 | 3300046694 | Bacteria | 8487 |
| 324 | Ga0495600_0010225 | 3300046809 | Bacteria | 5816 |
| 325 | Ga0495600_0105048 | 3300046809 | Bacteria | 1840 |
| 326 | Ga0495604_0000084 | 3300047317 | Bacteria | 82199 |
| 327 | Ga0495604_0000344 | 3300047317 | Bacteria | 41631 |
| 328 | Ga0495604_0019113 | 3300047317 | Bacteria | 5486 |
| 329 | Ga0495604_0109373 | 3300047317 | Bacteria | 2017 |
| 330 | Ga0495674_0000027 | 3300047319 | Bacteria | 132744 |
| 331 | Ga0495676_0014161 | 3300047321 | Bacteria | 7140 |
| 332 | Ga0495676_0023243 | 3300047321 | Bacteria | 5384 |
| 333 | Ga0495676_0131550 | 3300047321 | Bacteria | 1805 |
| 334 | Ga0495680_0000255 | 3300047322 | Bacteria | 58745 |
| 335 | Ga0495680_0001247 | 3300047322 | Bacteria | 27898 |
| 336 | Ga0495680_0010811 | 3300047322 | Bacteria | 8129 |
| 337 | Ga0495680_0015114 | 3300047322 | Bacteria | 6666 |
| 338 | Ga0495675_0000520 | 3300047444 | Bacteria | 24971 |
| 339 | Ga0495679_075964 | 3300047446 | Unclassified | 961 |
| 340 | Ga0495686_0230407 | 3300047472 | Bacteria | 1049 |
| 341 | Ga0495593_0018008 | 3300047673 | Bacteria | 3973 |
| 342 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 343 | Ga0495602_0006000 | 3300048088 | Bacteria | 12757 |
| 344 | Ga0495602_0020939 | 3300048088 | Bacteria | 6449 |
| 345 | Ga0495614_0017462 | 3300048089 | Bacteria | 3117 |
| 346 | Ga0495614_0116947 | 3300048089 | Bacteria | 1174 |
| 347 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 348 | Ga0496100_0000016 | 3300048903 | Bacteria | 166058 |
| 349 | Ga0496100_0115937 | 3300048903 | Unclassified | 1868 |
| 350 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 351 | Ga0496101_0000038 | 3300048904 | Bacteria | 166058 |
| 352 | Ga0496102_0000139 | 3300048905 | Bacteria | 98670 |
| 353 | Ga0496102_0028807 | 3300048905 | Bacteria | 4964 |
| 354 | Ga0496102_0039225 | 3300048905 | Bacteria | 4279 |
| 355 | Ga0496102_0237235 | 3300048905 | Bacteria | 1720 |
| 356 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 357 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 358 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 359 | Ga0496104_0000139 | 3300048907 | Bacteria | 67432 |
| 360 | Ga0496104_0020392 | 3300048907 | Bacteria | 6077 |
| 361 | Ga0496104_0122943 | 3300048907 | Bacteria | 2491 |
| 362 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 363 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 364 | Ga0496105_0000054 | 3300048908 | Bacteria | 89081 |
| 365 | Ga0496105_0044309 | 3300048908 | Bacteria | 3669 |
| 366 | Ga0496105_0125616 | 3300048908 | Bacteria | 2114 |
| 367 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 368 | Ga0496106_0000027 | 3300048909 | Bacteria | 149560 |
| 369 | Ga0496106_0000117 | 3300048909 | Bacteria | 60781 |
| 370 | Ga0496106_0008800 | 3300048909 | Bacteria | 7459 |
| 371 | Ga0496106_0323022 | 3300048909 | Bacteria | 1239 |
| 372 | Ga0496106_0447390 | 3300048909 | Bacteria | 1038 |
| 373 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 374 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 375 | Ga0496107_0003522 | 3300048910 | Bacteria | 10476 |
| 376 | Ga0496107_0270395 | 3300048910 | Bacteria | 1265 |
| 377 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 378 | Ga0496108_0000110 | 3300048911 | Bacteria | 84585 |
| 379 | Ga0496108_0000221 | 3300048911 | Bacteria | 51191 |
| 380 | Ga0496108_0010893 | 3300048911 | Bacteria | 7381 |
| 381 | Ga0496108_0038134 | 3300048911 | Bacteria | 4003 |
| 382 | Ga0496108_0164444 | 3300048911 | Bacteria | 1918 |
| 383 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 384 | Ga0496109_0000046 | 3300048912 | Bacteria | 131025 |
| 385 | Ga0496109_0000087 | 3300048912 | Bacteria | 95196 |
| 386 | Ga0496109_0000195 | 3300048912 | Bacteria | 60380 |
| 387 | Ga0496109_0125282 | 3300048912 | Bacteria | 2395 |
| 388 | Ga0496109_0186371 | 3300048912 | Bacteria | 1949 |
| 389 | Ga0496109_0631908 | 3300048912 | Bacteria | 1007 |
| 390 | Ga0496110_0000004 | 3300048913 | Bacteria | 122867 |
| 391 | Ga0496110_0005662 | 3300048913 | Bacteria | 9804 |
| 392 | Ga0496110_0008159 | 3300048913 | Bacteria | 8414 |
| 393 | Ga0496110_0017387 | 3300048913 | Bacteria | 6015 |
| 394 | Ga0496110_0062260 | 3300048913 | Bacteria | 3295 |
| 395 | Ga0496110_0496278 | 3300048913 | Unclassified | 1112 |
| 396 | Ga0496111_0000002 | 3300048914 | Bacteria | 135794 |
| 397 | Ga0496111_0010397 | 3300048914 | Bacteria | 6243 |
| 398 | Ga0496111_0051383 | 3300048914 | Bacteria | 2975 |
| 399 | Ga0496111_0128461 | 3300048914 | Bacteria | 1874 |
| 400 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 401 | Ga0496112_0002086 | 3300048915 | Bacteria | 15849 |
| 402 | Ga0496112_0159145 | 3300048915 | Bacteria | 2225 |
| 403 | Ga0496113_0000012 | 3300048916 | Bacteria | 81903 |
| 404 | Ga0496113_0004020 | 3300048916 | Bacteria | 8951 |
| 405 | Ga0496113_0248360 | 3300048916 | Bacteria | 1420 |
| 406 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 407 | Ga0496114_0002667 | 3300048917 | Bacteria | 13622 |
| 408 | Ga0496114_0096332 | 3300048917 | Bacteria | 2519 |
| 409 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 410 | Ga0496115_0000710 | 3300048918 | Bacteria | 24673 |
| 411 | Ga0496115_0197200 | 3300048918 | Bacteria | 1664 |
| 412 | Ga0496115_0362666 | 3300048918 | Bacteria | 1180 |
| 413 | Ga0496125_0315111 | 3300048928 | Bacteria | 951 |
| 414 | Ga0501032_0096105 | 3300049569 | Bacteria | 1964 |
| 415 | Ga0501040_0149627 | 3300049576 | Bacteria | 1647 |
| 416 | Ga0501042_0027320 | 3300049578 | Bacteria | 4013 |
| 417 | Ga0501042_0047581 | 3300049578 | Bacteria | 3059 |
| 418 | Ga0501048_0293553 | 3300049582 | Bacteria | 1156 |
| 419 | Ga0501069_0021194 | 3300049585 | Bacteria | 3525 |
| 420 | Ga0501070_0112623 | 3300049586 | Bacteria | 2248 |
| 421 | Ga0501070_0334955 | 3300049586 | Bacteria | 1229 |
| 422 | Ga0501071_0131492 | 3300049587 | Bacteria | 1860 |
| 423 | Ga0501072_0214015 | 3300049588 | Bacteria | 1536 |
| 424 | Ga0501072_0221516 | 3300049588 | Bacteria | 1508 |
| 425 | Ga0501075_0021437 | 3300049591 | Bacteria | 4710 |
| 426 | Ga0501076_0033894 | 3300049592 | Bacteria | 3988 |
| 427 | Ga0501080_0134315 | 3300049742 | Bacteria | 2290 |
| 428 | Ga0501080_0611446 | 3300049742 | Unclassified | 967 |
| 429 | nmdc:mga03n38_150273_c1 | 3300050490 | Unclassified | 1171 |
| 430 | nmdc:mga00v17_75912_c1 | 3300050491 | Bacteria | 2090 |
| 431 | nmdc:mga00v17_99281_c1 | 3300050491 | Bacteria | 1836 |
| 432 | nmdc:mga0yw44_152764_c1 | 3300050492 | Unclassified | 1507 |
| 433 | nmdc:mga05p37_206880_c1 | 3300050507 | Bacteria | 2373 |
| 434 | nmdc:mga0qj67_75572_c1 | 3300050509 | Bacteria | 2693 |
| 435 | nmdc:mga08y16_368018_c1 | 3300050511 | Bacteria | 1475 |
| 436 | nmdc:mga0n895_277979_c1 | 3300050512 | Bacteria | 1698 |
| 437 | nmdc:mga0rr50_170004_c1 | 3300050513 | Bacteria | 1775 |
| 438 | nmdc:mga0a205_124_c2 | 3300050515 | Bacteria | 20732 |
| 439 | nmdc:mga0a205_12_c2 | 3300050515 | Bacteria | 69190 |
| 440 | Ga0495601_0000080 | 3300053077 | Bacteria | 51518 |
| 441 | Ga0495601_0000098 | 3300053077 | Bacteria | 48076 |
| 442 | Ga0495601_0020657 | 3300053077 | Bacteria | 4023 |
| 443 | Ga0495601_0095533 | 3300053077 | Bacteria | 1916 |
| 444 | Ga0495601_0111687 | 3300053077 | Bacteria | 1770 |
| 445 | Ga0495601_0199146 | 3300053077 | Bacteria | 1309 |
| 446 | Ga0495612_0000358 | 3300053078 | Bacteria | 18497 |
| 447 | Ga0495612_0008591 | 3300053078 | Bacteria | 4143 |
| 448 | Ga0495655_0000007 | 3300053083 | Bacteria | 201058 |
| 449 | Ga0495655_0000970 | 3300053083 | Bacteria | 4450 |
| 450 | Ga0495595_0000069 | 3300053084 | Bacteria | 50835 |
| 451 | Ga0495595_0000187 | 3300053084 | Bacteria | 24981 |
| 452 | Ga0495595_0014790 | 3300053084 | Bacteria | 3318 |
| 453 | Ga0495595_0052663 | 3300053084 | Bacteria | 1889 |
| 454 | Ga0495619_0000024 | 3300053085 | Bacteria | 180821 |
| 455 | Ga0495619_0000038 | 3300053085 | Bacteria | 121365 |
| 456 | Ga0495619_0000542 | 3300053085 | Bacteria | 24940 |
| 457 | Ga0495619_0000785 | 3300053085 | Bacteria | 20772 |
| 458 | Ga0495619_0002211 | 3300053085 | Bacteria | 12886 |
| 459 | Ga0495619_0015759 | 3300053085 | Bacteria | 4784 |
| 460 | Ga0495619_0043703 | 3300053085 | Bacteria | 2939 |
| 461 | Ga0495619_0109701 | 3300053085 | Bacteria | 1884 |
| 462 | Ga0495619_0395890 | 3300053085 | Bacteria | 954 |
| 463 | Ga0500566_0002540 | 3300053094 | Bacteria | 10846 |
| 464 | Ga0500641_0004606 | 3300053096 | Bacteria | 4874 |
| 465 | Ga0500554_008245 | 3300053102 | Bacteria | 2440 |
| 466 | Ga0500614_003156 | 3300053123 | Bacteria | 3575 |
| 467 | Ga0500628_000003 | 3300053129 | Bacteria | 204304 |
| 468 | Ga0501082_0669902 | 3300060353 | Bacteria | 908 |
| 469 | Ga0530510_0138761 | 3300061734 | Bacteria | 1791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053096 | Ga0500641_0004606 | Ga0500641_0004606_1102_1884 | 196 |
| 2 | 3300046536 | Ga0495587_0138687 | Ga0495587_0138687_618_1304 | 210 |
| 3 | 3300013104 | Ga0157370_10027409 | Ga0157370_100274092 | 211 |
| 4 | 3300009098 | Ga0105245_10001248 | Ga0105245_1000124811 | 212 |
| 5 | 3300025944 | Ga0207661_10004186 | Ga0207661_100041863 | 212 |
| 6 | 3300046455 | Ga0495603_0022441 | Ga0495603_0022441_86_772 | 212 |
| 7 | 3300046535 | Ga0495586_0000384 | Ga0495586_0000384_5712_6419 | 212 |
| 8 | 3300046543 | Ga0495645_0506122 | Ga0495645_0506122_23_709 | 212 |
| 9 | 3300046678 | Ga0495599_0029441 | Ga0495599_0029441_2267_2953 | 212 |
| 10 | 3300047317 | Ga0495604_0109373 | Ga0495604_0109373_1276_1968 | 212 |
| 11 | 3300047446 | Ga0495679_075964 | Ga0495679_075964_244_930 | 212 |
| 12 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_395085_395774 | 212 |
| 13 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_395047_395736 | 212 |
| 14 | 3300048928 | Ga0496125_0315111 | Ga0496125_0315111_201_890 | 212 |
| 15 | 3300046454 | Ga0495592_0141577 | Ga0495592_0141577_925_1620 | 213 |
| 16 | 3300053085 | Ga0495619_0395890 | Ga0495619_0395890_25_711 | 213 |
| 17 | 3300046476 | Ga0495662_0000121 | Ga0495662_0000121_28180_28881 | 217 |
| 18 | 3300044842 | Ga0466957_0003682 | Ga0466957_0003682_4539_5282 | 226 |
| 19 | 3300047673 | Ga0495593_0018008 | Ga0495593_0018008_3065_3805 | 226 |
| 20 | 3300005337 | Ga0070682_100000100 | Ga0070682_10000010016 | 227 |
| 21 | 3300010375 | Ga0105239_10108396 | Ga0105239_101083963 | 227 |
| 22 | 3300005444 | Ga0070694_100557601 | Ga0070694_1005576011 | 228 |
| 23 | 3300009098 | Ga0105245_10000091 | Ga0105245_1000009128 | 228 |
| 24 | 3300037418 | Ga0395900_0096233 | Ga0395900_0096233_511_1296 | 228 |
| 25 | 3300045976 | Ga0466967_0000007 | Ga0466967_0000007_106760_107527 | 228 |
| 26 | 3300046615 | Ga0495656_0114475 | Ga0495656_0114475_242_1024 | 228 |
| 27 | 3300048911 | Ga0496108_0038134 | Ga0496108_0038134_1254_1997 | 228 |
| 28 | 3300048912 | Ga0496109_0000046 | Ga0496109_0000046_65381_66124 | 228 |
| 29 | 3300050490 | nmdc:mga03n38_150273_c1 | nmdc:mga03n38_150273_c1_57_800 | 228 |
| 30 | 3300050492 | nmdc:mga0yw44_152764_c1 | nmdc:mga0yw44_152764_c1_162_905 | 228 |
| 31 | 3300005543 | Ga0070672_100000023 | Ga0070672_10000002313 | 229 |
| 32 | 3300025940 | Ga0207691_10000172 | Ga0207691_1000017271 | 229 |
| 33 | 3300038443 | Ga0395901_0125976 | Ga0395901_0125976_1854_2636 | 229 |
| 34 | 3300046694 | Ga0495649_0005045 | Ga0495649_0005045_6823_7557 | 229 |
| 35 | 3300048908 | Ga0496105_0044309 | Ga0496105_0044309_2925_3659 | 229 |
| 36 | 3300053077 | Ga0495601_0095533 | Ga0495601_0095533_425_1207 | 229 |
| 37 | 3300005937 | Ga0081455_10090771 | Ga0081455_100907713 | 230 |
| 38 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_516339_517091 | 230 |
| 39 | 3300010375 | Ga0105239_10374275 | Ga0105239_103742752 | 231 |
| 40 | 3300037418 | Ga0395900_0228438 | Ga0395900_0228438_1074_1853 | 231 |
| 41 | 3300046557 | Ga0495622_0000026 | Ga0495622_0000026_118544_119326 | 231 |
| 42 | 3300048911 | Ga0496108_0000110 | Ga0496108_0000110_79146_79901 | 231 |
| 43 | 3300048912 | Ga0496109_0000087 | Ga0496109_0000087_79146_79901 | 231 |
| 44 | 3300048915 | Ga0496112_0002086 | Ga0496112_0002086_1488_2243 | 231 |
| 45 | 3300048916 | Ga0496113_0000012 | Ga0496113_0000012_57382_58137 | 231 |
| 46 | 3300050491 | nmdc:mga00v17_75912_c1 | nmdc:mga00v17_75912_c1_1227_1970 | 231 |
| 47 | 3300047317 | Ga0495604_0000344 | Ga0495604_0000344_8904_9689 | 232 |
| 48 | 3300046536 | Ga0495587_0001311 | Ga0495587_0001311_9486_10247 | 233 |
| 49 | 3300049576 | Ga0501040_0149627 | Ga0501040_0149627_129_890 | 233 |
| 50 | 3300049588 | Ga0501072_0221516 | Ga0501072_0221516_684_1445 | 233 |
| 51 | 3300046559 | Ga0495667_0119236 | Ga0495667_0119236_265_1035 | 234 |
| 52 | 3300005549 | Ga0070704_100804640 | Ga0070704_1008046401 | 235 |
| 53 | 3300011119 | Ga0105246_10025900 | Ga0105246_100259001 | 235 |
| 54 | 3300046689 | Ga0495613_0000003 | Ga0495613_0000003_25352_26110 | 235 |
| 55 | 3300048907 | Ga0496104_0000139 | Ga0496104_0000139_61711_62511 | 235 |
| 56 | 3300048908 | Ga0496105_0000054 | Ga0496105_0000054_13364_14164 | 235 |
| 57 | 3300005329 | Ga0070683_100004550 | Ga0070683_10000455013 | 236 |
| 58 | 3300005535 | Ga0070684_100030495 | Ga0070684_1000304952 | 236 |
| 59 | 3300046454 | Ga0495592_0006735 | Ga0495592_0006735_5419_6177 | 236 |
| 60 | 3300053102 | Ga0500554_008245 | Ga0500554_008245_473_1255 | 236 |
| 61 | 3300005337 | Ga0070682_100501483 | Ga0070682_1005014831 | 237 |
| 62 | 3300005439 | Ga0070711_100006965 | Ga0070711_1000069653 | 237 |
| 63 | 3300017792 | Ga0163161_10405360 | Ga0163161_104053601 | 237 |
| 64 | 3300025916 | Ga0207663_10004537 | Ga0207663_100045378 | 237 |
| 65 | 3300046499 | Ga0495594_0000005 | Ga0495594_0000005_156295_157071 | 237 |
| 66 | 3300046523 | Ga0495644_0001081 | Ga0495644_0001081_2099_2857 | 237 |
| 67 | 3300046529 | Ga0495652_0000060 | Ga0495652_0000060_23453_24229 | 237 |
| 68 | 3300046529 | Ga0495652_0000061 | Ga0495652_0000061_87888_88664 | 237 |
| 69 | 3300046537 | Ga0495598_0021713 | Ga0495598_0021713_387_1148 | 237 |
| 70 | 3300046559 | Ga0495667_0000042 | Ga0495667_0000042_43506_44282 | 237 |
| 71 | 3300047322 | Ga0495680_0010811 | Ga0495680_0010811_5633_6409 | 237 |
| 72 | 3300049578 | Ga0501042_0027320 | Ga0501042_0027320_764_1540 | 237 |
| 73 | 3300053077 | Ga0495601_0199146 | Ga0495601_0199146_211_978 | 237 |
| 74 | 3300005341 | Ga0070691_10003021 | Ga0070691_100030218 | 238 |
| 75 | 3300005445 | Ga0070708_100335039 | Ga0070708_1003350392 | 238 |
| 76 | 3300005455 | Ga0070663_100063976 | Ga0070663_1000639764 | 238 |
| 77 | 3300005937 | Ga0081455_10041442 | Ga0081455_100414423 | 238 |
| 78 | 3300005981 | Ga0081538_10008571 | Ga0081538_100085716 | 238 |
| 79 | 3300006175 | Ga0070712_100004470 | Ga0070712_1000044705 | 238 |
| 80 | 3300013308 | Ga0157375_10085865 | Ga0157375_100858653 | 238 |
| 81 | 3300025915 | Ga0207693_10002303 | Ga0207693_1000230314 | 238 |
| 82 | 3300025986 | Ga0207658_10029105 | Ga0207658_100291054 | 238 |
| 83 | 3300026067 | Ga0207678_10410801 | Ga0207678_104108011 | 238 |
| 84 | 3300046455 | Ga0495603_0000044 | Ga0495603_0000044_665_1441 | 238 |
| 85 | 3300046476 | Ga0495662_0007156 | Ga0495662_0007156_4717_5493 | 238 |
| 86 | 3300046539 | Ga0495621_0014670 | Ga0495621_0014670_46_834 | 238 |
| 87 | 3300048088 | Ga0495602_0020939 | Ga0495602_0020939_4715_5596 | 238 |
| 88 | 3300048089 | Ga0495614_0017462 | Ga0495614_0017462_1160_1942 | 238 |
| 89 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_21108_21887 | 238 |
| 90 | 3300048918 | Ga0496115_0000710 | Ga0496115_0000710_2787_3566 | 238 |
| 91 | 3300005329 | Ga0070683_100133596 | Ga0070683_1001335963 | 239 |
| 92 | 3300005341 | Ga0070691_10123658 | Ga0070691_101236582 | 239 |
| 93 | 3300005436 | Ga0070713_100000040 | Ga0070713_10000004040 | 239 |
| 94 | 3300005441 | Ga0070700_100023617 | Ga0070700_1000236173 | 239 |
| 95 | 3300005456 | Ga0070678_100172703 | Ga0070678_1001727032 | 239 |
| 96 | 3300005544 | Ga0070686_100021305 | Ga0070686_1000213055 | 239 |
| 97 | 3300005548 | Ga0070665_100000159 | Ga0070665_10000015919 | 239 |
| 98 | 3300005549 | Ga0070704_100011003 | Ga0070704_1000110034 | 239 |
| 99 | 3300005718 | Ga0068866_10018222 | Ga0068866_100182223 | 239 |
| 100 | 3300005841 | Ga0068863_100030645 | Ga0068863_1000306452 | 239 |
| 101 | 3300005842 | Ga0068858_100000043 | Ga0068858_10000004325 | 239 |
| 102 | 3300005842 | Ga0068858_100000049 | Ga0068858_100000049124 | 239 |
| 103 | 3300005983 | Ga0081540_1000025 | Ga0081540_100002514 | 239 |
| 104 | 3300006048 | Ga0075363_100030246 | Ga0075363_1000302463 | 239 |
| 105 | 3300006051 | Ga0075364_10109866 | Ga0075364_101098662 | 239 |
| 106 | 3300006175 | Ga0070712_100023424 | Ga0070712_1000234241 | 239 |
| 107 | 3300006847 | Ga0075431_100061325 | Ga0075431_1000613254 | 239 |
| 108 | 3300006852 | Ga0075433_10008121 | Ga0075433_100081217 | 239 |
| 109 | 3300009098 | Ga0105245_10000955 | Ga0105245_100009554 | 239 |
| 110 | 3300009176 | Ga0105242_10411471 | Ga0105242_104114712 | 239 |
| 111 | 3300009553 | Ga0105249_10944388 | Ga0105249_109443881 | 239 |
| 112 | 3300010375 | Ga0105239_10290788 | Ga0105239_102907882 | 239 |
| 113 | 3300013308 | Ga0157375_10051373 | Ga0157375_100513733 | 239 |
| 114 | 3300013308 | Ga0157375_10057327 | Ga0157375_100573275 | 239 |
| 115 | 3300013308 | Ga0157375_10084307 | Ga0157375_100843072 | 239 |
| 116 | 3300025899 | Ga0207642_10011311 | Ga0207642_100113113 | 239 |
| 117 | 3300025915 | Ga0207693_10002931 | Ga0207693_1000293112 | 239 |
| 118 | 3300025928 | Ga0207700_10000032 | Ga0207700_1000003285 | 239 |
| 119 | 3300025939 | Ga0207665_10071435 | Ga0207665_100714352 | 239 |
| 120 | 3300025944 | Ga0207661_10000192 | Ga0207661_100001926 | 239 |
| 121 | 3300025944 | Ga0207661_10002060 | Ga0207661_100020605 | 239 |
| 122 | 3300026035 | Ga0207703_10000053 | Ga0207703_10000053137 | 239 |
| 123 | 3300026035 | Ga0207703_10000132 | Ga0207703_1000013291 | 239 |
| 124 | 3300026075 | Ga0207708_10154910 | Ga0207708_101549102 | 239 |
| 125 | 3300026118 | Ga0207675_100786606 | Ga0207675_1007866062 | 239 |
| 126 | 3300026121 | Ga0207683_10097553 | Ga0207683_100975532 | 239 |
| 127 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023239 | 239 |
| 128 | 3300032126 | Ga0307415_100142799 | Ga0307415_1001427992 | 239 |
| 129 | 3300041491 | Ga0451833_0353539 | Ga0451833_0353539_719_1495 | 239 |
| 130 | 3300046459 | Ga0495629_0000976 | Ga0495629_0000976_3855_4640 | 239 |
| 131 | 3300046459 | Ga0495629_0013552 | Ga0495629_0013552_4019_4795 | 239 |
| 132 | 3300046462 | Ga0495651_0370730 | Ga0495651_0370730_130_906 | 239 |
| 133 | 3300046473 | Ga0495582_0096569 | Ga0495582_0096569_759_1541 | 239 |
| 134 | 3300046507 | Ga0495606_0000082 | Ga0495606_0000082_117484_118269 | 239 |
| 135 | 3300046511 | Ga0495608_0000590 | Ga0495608_0000590_1849_2631 | 239 |
| 136 | 3300046543 | Ga0495645_0022954 | Ga0495645_0022954_2587_3366 | 239 |
| 137 | 3300046675 | Ga0495657_0000992 | Ga0495657_0000992_22351_23133 | 239 |
| 138 | 3300046681 | Ga0495647_0000014 | Ga0495647_0000014_37166_37954 | 239 |
| 139 | 3300046683 | Ga0495658_0002331 | Ga0495658_0002331_3932_4714 | 239 |
| 140 | 3300046689 | Ga0495613_0171883 | Ga0495613_0171883_299_1072 | 239 |
| 141 | 3300046690 | Ga0495624_0000002 | Ga0495624_0000002_49705_50493 | 239 |
| 142 | 3300047321 | Ga0495676_0131550 | Ga0495676_0131550_743_1525 | 239 |
| 143 | 3300047444 | Ga0495675_0000520 | Ga0495675_0000520_1834_2616 | 239 |
| 144 | 3300048089 | Ga0495614_0116947 | Ga0495614_0116947_121_903 | 239 |
| 145 | 3300048903 | Ga0496100_0115937 | Ga0496100_0115937_799_1581 | 239 |
| 146 | 3300048905 | Ga0496102_0028807 | Ga0496102_0028807_2219_3001 | 239 |
| 147 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_331387_332175 | 239 |
| 148 | 3300048907 | Ga0496104_0122943 | Ga0496104_0122943_1368_2150 | 239 |
| 149 | 3300048908 | Ga0496105_0000008 | Ga0496105_0000008_140692_141480 | 239 |
| 150 | 3300048908 | Ga0496105_0125616 | Ga0496105_0125616_731_1513 | 239 |
| 151 | 3300048909 | Ga0496106_0008800 | Ga0496106_0008800_4765_5547 | 239 |
| 152 | 3300048909 | Ga0496106_0323022 | Ga0496106_0323022_279_1055 | 239 |
| 153 | 3300048910 | Ga0496107_0003522 | Ga0496107_0003522_8081_8863 | 239 |
| 154 | 3300048911 | Ga0496108_0164444 | Ga0496108_0164444_795_1577 | 239 |
| 155 | 3300048912 | Ga0496109_0186371 | Ga0496109_0186371_209_991 | 239 |
| 156 | 3300048913 | Ga0496110_0005662 | Ga0496110_0005662_5143_5925 | 239 |
| 157 | 3300048913 | Ga0496110_0062260 | Ga0496110_0062260_1644_2423 | 239 |
| 158 | 3300048914 | Ga0496111_0051383 | Ga0496111_0051383_72_854 | 239 |
| 159 | 3300048917 | Ga0496114_0002667 | Ga0496114_0002667_7871_8653 | 239 |
| 160 | 3300048918 | Ga0496115_0197200 | Ga0496115_0197200_103_882 | 239 |
| 161 | 3300048918 | Ga0496115_0362666 | Ga0496115_0362666_359_1141 | 239 |
| 162 | 3300049587 | Ga0501071_0131492 | Ga0501071_0131492_940_1743 | 239 |
| 163 | 3300049592 | Ga0501076_0033894 | Ga0501076_0033894_3132_3914 | 239 |
| 164 | 3300050515 | nmdc:mga0a205_124_c2 | nmdc:mga0a205_124_c2_8301_9074 | 239 |
| 165 | 3300053084 | Ga0495595_0000187 | Ga0495595_0000187_1849_2631 | 239 |
| 166 | 3300053085 | Ga0495619_0000024 | Ga0495619_0000024_158378_159154 | 239 |
| 167 | 3300053085 | Ga0495619_0000038 | Ga0495619_0000038_98673_99449 | 239 |
| 168 | 3300053085 | Ga0495619_0000542 | Ga0495619_0000542_22310_23092 | 239 |
| 169 | 3300053085 | Ga0495619_0043703 | Ga0495619_0043703_1003_1818 | 239 |
| 170 | 3300005356 | Ga0070674_100000003 | Ga0070674_10000000384 | 240 |
| 171 | 3300005366 | Ga0070659_100002416 | Ga0070659_10000241610 | 240 |
| 172 | 3300005436 | Ga0070713_100126582 | Ga0070713_1001265822 | 240 |
| 173 | 3300005456 | Ga0070678_100022773 | Ga0070678_1000227733 | 240 |
| 174 | 3300005539 | Ga0068853_100290377 | Ga0068853_1002903772 | 240 |
| 175 | 3300005577 | Ga0068857_100319347 | Ga0068857_1003193472 | 240 |
| 176 | 3300005578 | Ga0068854_100000228 | Ga0068854_1000002287 | 240 |
| 177 | 3300005614 | Ga0068856_100017999 | Ga0068856_1000179993 | 240 |
| 178 | 3300005614 | Ga0068856_100036276 | Ga0068856_1000362762 | 240 |
| 179 | 3300005616 | Ga0068852_100000131 | Ga0068852_1000001315 | 240 |
| 180 | 3300005616 | Ga0068852_100023662 | Ga0068852_1000236626 | 240 |
| 181 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002327 | 240 |
| 182 | 3300005834 | Ga0068851_10001684 | Ga0068851_100016842 | 240 |
| 183 | 3300005841 | Ga0068863_100000032 | Ga0068863_100000032153 | 240 |
| 184 | 3300005843 | Ga0068860_100008225 | Ga0068860_1000082255 | 240 |
| 185 | 3300006163 | Ga0070715_10000012 | Ga0070715_10000012176 | 240 |
| 186 | 3300006852 | Ga0075433_10000093 | Ga0075433_1000009338 | 240 |
| 187 | 3300009098 | Ga0105245_10001725 | Ga0105245_1000172521 | 240 |
| 188 | 3300009098 | Ga0105245_10237132 | Ga0105245_102371323 | 240 |
| 189 | 3300009174 | Ga0105241_10105944 | Ga0105241_101059442 | 240 |
| 190 | 3300009176 | Ga0105242_10000575 | Ga0105242_1000057534 | 240 |
| 191 | 3300009177 | Ga0105248_10000466 | Ga0105248_100004664 | 240 |
| 192 | 3300011119 | Ga0105246_10143545 | Ga0105246_101435452 | 240 |
| 193 | 3300013307 | Ga0157372_10000121 | Ga0157372_1000012170 | 240 |
| 194 | 3300017792 | Ga0163161_10000073 | Ga0163161_1000007355 | 240 |
| 195 | 3300025321 | Ga0207656_10063223 | Ga0207656_100632232 | 240 |
| 196 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001291 | 240 |
| 197 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003291 | 240 |
| 198 | 3300025899 | Ga0207642_10000004 | Ga0207642_10000004291 | 240 |
| 199 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001592 | 240 |
| 200 | 3300025911 | Ga0207654_10049517 | Ga0207654_100495172 | 240 |
| 201 | 3300025928 | Ga0207700_10286312 | Ga0207700_102863121 | 240 |
| 202 | 3300025932 | Ga0207690_10001263 | Ga0207690_1000126312 | 240 |
| 203 | 3300025934 | Ga0207686_10000042 | Ga0207686_1000004274 | 240 |
| 204 | 3300025937 | Ga0207669_10000023 | Ga0207669_1000002387 | 240 |
| 205 | 3300025941 | Ga0207711_10000085 | Ga0207711_1000008558 | 240 |
| 206 | 3300025981 | Ga0207640_10000026 | Ga0207640_10000026108 | 240 |
| 207 | 3300026078 | Ga0207702_10022211 | Ga0207702_100222113 | 240 |
| 208 | 3300026078 | Ga0207702_10025971 | Ga0207702_100259712 | 240 |
| 209 | 3300026088 | Ga0207641_10000071 | Ga0207641_10000071153 | 240 |
| 210 | 3300026121 | Ga0207683_10038680 | Ga0207683_100386806 | 240 |
| 211 | 3300026142 | Ga0207698_10000009 | Ga0207698_10000009214 | 240 |
| 212 | 3300028381 | Ga0268264_10003521 | Ga0268264_1000352114 | 240 |
| 213 | 3300028556 | Ga0265337_1006261 | Ga0265337_10062616 | 240 |
| 214 | 3300028558 | Ga0265326_10000027 | Ga0265326_1000002754 | 240 |
| 215 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003235 | 240 |
| 216 | 3300029957 | Ga0265324_10000103 | Ga0265324_1000010320 | 240 |
| 217 | 3300031239 | Ga0265328_10010469 | Ga0265328_100104694 | 240 |
| 218 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001235 | 240 |
| 219 | 3300031242 | Ga0265329_10001629 | Ga0265329_100016294 | 240 |
| 220 | 3300031250 | Ga0265331_10002979 | Ga0265331_100029791 | 240 |
| 221 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003235 | 240 |
| 222 | 3300031344 | Ga0265316_10023411 | Ga0265316_100234112 | 240 |
| 223 | 3300031711 | Ga0265314_10001375 | Ga0265314_1000137520 | 240 |
| 224 | 3300046454 | Ga0495592_0183159 | Ga0495592_0183159_479_1267 | 240 |
| 225 | 3300046455 | Ga0495603_0000291 | Ga0495603_0000291_8240_9022 | 240 |
| 226 | 3300046463 | Ga0495653_0071876 | Ga0495653_0071876_1642_2430 | 240 |
| 227 | 3300046463 | Ga0495653_0107155 | Ga0495653_0107155_1069_1848 | 240 |
| 228 | 3300046477 | Ga0495664_0194423 | Ga0495664_0194423_10_786 | 240 |
| 229 | 3300046511 | Ga0495608_0001675 | Ga0495608_0001675_9968_10762 | 240 |
| 230 | 3300046536 | Ga0495587_0054477 | Ga0495587_0054477_29_841 | 240 |
| 231 | 3300046681 | Ga0495647_0001518 | Ga0495647_0001518_3558_4334 | 240 |
| 232 | 3300046681 | Ga0495647_0015756 | Ga0495647_0015756_1061_1846 | 240 |
| 233 | 3300046691 | Ga0495670_0026482 | Ga0495670_0026482_1309_2160 | 240 |
| 234 | 3300047322 | Ga0495680_0015114 | Ga0495680_0015114_756_1544 | 240 |
| 235 | 3300048905 | Ga0496102_0000139 | Ga0496102_0000139_19342_20118 | 240 |
| 236 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_144958_145734 | 240 |
| 237 | 3300048913 | Ga0496110_0000004 | Ga0496110_0000004_77235_78020 | 240 |
| 238 | 3300048914 | Ga0496111_0000002 | Ga0496111_0000002_115651_116436 | 240 |
| 239 | 3300048917 | Ga0496114_0096332 | Ga0496114_0096332_1010_1786 | 240 |
| 240 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_287523_288299 | 240 |
| 241 | 3300050515 | nmdc:mga0a205_12_c2 | nmdc:mga0a205_12_c2_31430_32209 | 240 |
| 242 | 3300053083 | Ga0495655_0000007 | Ga0495655_0000007_56308_57084 | 240 |
| 243 | 3300053083 | Ga0495655_0000970 | Ga0495655_0000970_1585_2373 | 240 |
| 244 | 3300053084 | Ga0495595_0000069 | Ga0495595_0000069_25647_26435 | 240 |
| 245 | 3300053129 | Ga0500628_000003 | Ga0500628_000003_116384_117160 | 240 |
| 246 | 3300005336 | Ga0070680_100063191 | Ga0070680_1000631912 | 241 |
| 247 | 3300005337 | Ga0070682_100000057 | Ga0070682_10000005750 | 241 |
| 248 | 3300005347 | Ga0070668_100021473 | Ga0070668_1000214733 | 241 |
| 249 | 3300005356 | Ga0070674_100023861 | Ga0070674_1000238613 | 241 |
| 250 | 3300005364 | Ga0070673_100062059 | Ga0070673_1000620593 | 241 |
| 251 | 3300005438 | Ga0070701_10044345 | Ga0070701_100443452 | 241 |
| 252 | 3300005458 | Ga0070681_10003375 | Ga0070681_100033755 | 241 |
| 253 | 3300005530 | Ga0070679_100000342 | Ga0070679_10000034239 | 241 |
| 254 | 3300005539 | Ga0068853_100010810 | Ga0068853_1000108105 | 241 |
| 255 | 3300005618 | Ga0068864_100000262 | Ga0068864_10000026216 | 241 |
| 256 | 3300005719 | Ga0068861_100183345 | Ga0068861_1001833452 | 241 |
| 257 | 3300005843 | Ga0068860_100224887 | Ga0068860_1002248872 | 241 |
| 258 | 3300005937 | Ga0081455_10232850 | Ga0081455_102328502 | 241 |
| 259 | 3300005983 | Ga0081540_1062711 | Ga0081540_10627113 | 241 |
| 260 | 3300005985 | Ga0081539_10001602 | Ga0081539_100016022 | 241 |
| 261 | 3300006358 | Ga0068871_100186873 | Ga0068871_1001868732 | 241 |
| 262 | 3300009098 | Ga0105245_10001267 | Ga0105245_1000126718 | 241 |
| 263 | 3300013105 | Ga0157369_10000128 | Ga0157369_1000012858 | 241 |
| 264 | 3300013296 | Ga0157374_10010028 | Ga0157374_100100289 | 241 |
| 265 | 3300013296 | Ga0157374_10027538 | Ga0157374_100275383 | 241 |
| 266 | 3300013297 | Ga0157378_10074028 | Ga0157378_100740283 | 241 |
| 267 | 3300014968 | Ga0157379_10218254 | Ga0157379_102182542 | 241 |
| 268 | 3300025912 | Ga0207707_10021445 | Ga0207707_100214454 | 241 |
| 269 | 3300025917 | Ga0207660_10043074 | Ga0207660_100430743 | 241 |
| 270 | 3300025921 | Ga0207652_10000351 | Ga0207652_1000035137 | 241 |
| 271 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012118 | 241 |
| 272 | 3300025927 | Ga0207687_10000042 | Ga0207687_1000004287 | 241 |
| 273 | 3300025927 | Ga0207687_10000613 | Ga0207687_1000061311 | 241 |
| 274 | 3300025931 | Ga0207644_10062240 | Ga0207644_100622402 | 241 |
| 275 | 3300025934 | Ga0207686_10004598 | Ga0207686_100045986 | 241 |
| 276 | 3300025934 | Ga0207686_10037675 | Ga0207686_100376753 | 241 |
| 277 | 3300025935 | Ga0207709_10051350 | Ga0207709_100513503 | 241 |
| 278 | 3300025936 | Ga0207670_10182725 | Ga0207670_101827251 | 241 |
| 279 | 3300025960 | Ga0207651_10001007 | Ga0207651_1000100710 | 241 |
| 280 | 3300026041 | Ga0207639_10017445 | Ga0207639_100174456 | 241 |
| 281 | 3300026095 | Ga0207676_10000038 | Ga0207676_1000003816 | 241 |
| 282 | 3300026118 | Ga0207675_100126694 | Ga0207675_1001266942 | 241 |
| 283 | 3300028563 | Ga0265319_1000548 | Ga0265319_10005481 | 241 |
| 284 | 3300028800 | Ga0265338_10000047 | Ga0265338_10000047130 | 241 |
| 285 | 3300036401 | Ga0373937_0195038 | Ga0373937_0195038_31_810 | 241 |
| 286 | 3300038443 | Ga0395901_0065476 | Ga0395901_0065476_723_1505 | 241 |
| 287 | 3300046459 | Ga0495629_0008682 | Ga0495629_0008682_3924_4715 | 241 |
| 288 | 3300046461 | Ga0495641_0000012 | Ga0495641_0000012_120070_120864 | 241 |
| 289 | 3300046463 | Ga0495653_0067382 | Ga0495653_0067382_923_1702 | 241 |
| 290 | 3300046511 | Ga0495608_0099559 | Ga0495608_0099559_690_1469 | 241 |
| 291 | 3300046515 | Ga0495620_0000446 | Ga0495620_0000446_15271_16059 | 241 |
| 292 | 3300046516 | Ga0495628_0051003 | Ga0495628_0051003_26_814 | 241 |
| 293 | 3300046516 | Ga0495628_0053122 | Ga0495628_0053122_2361_3146 | 241 |
| 294 | 3300046516 | Ga0495628_0505270 | Ga0495628_0505270_67_843 | 241 |
| 295 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_58295_59077 | 241 |
| 296 | 3300046517 | Ga0495630_0011828 | Ga0495630_0011828_3938_4714 | 241 |
| 297 | 3300046517 | Ga0495630_0087146 | Ga0495630_0087146_722_1498 | 241 |
| 298 | 3300046642 | Ga0495634_0173984 | Ga0495634_0173984_258_1043 | 241 |
| 299 | 3300046660 | Ga0495625_0000319 | Ga0495625_0000319_30661_31446 | 241 |
| 300 | 3300046675 | Ga0495657_0090708 | Ga0495657_0090708_808_1596 | 241 |
| 301 | 3300046684 | Ga0495669_0000074 | Ga0495669_0000074_15324_16115 | 241 |
| 302 | 3300046809 | Ga0495600_0010225 | Ga0495600_0010225_4177_4959 | 241 |
| 303 | 3300047317 | Ga0495604_0000084 | Ga0495604_0000084_55749_56537 | 241 |
| 304 | 3300047321 | Ga0495676_0014161 | Ga0495676_0014161_101_877 | 241 |
| 305 | 3300047322 | Ga0495680_0000255 | Ga0495680_0000255_45266_46054 | 241 |
| 306 | 3300047322 | Ga0495680_0001247 | Ga0495680_0001247_641_1429 | 241 |
| 307 | 3300048903 | Ga0496100_0000008 | Ga0496100_0000008_217655_218431 | 241 |
| 308 | 3300048903 | Ga0496100_0000016 | Ga0496100_0000016_142463_143254 | 241 |
| 309 | 3300048904 | Ga0496101_0000016 | Ga0496101_0000016_226437_227213 | 241 |
| 310 | 3300048904 | Ga0496101_0000038 | Ga0496101_0000038_22805_23596 | 241 |
| 311 | 3300048905 | Ga0496102_0039225 | Ga0496102_0039225_33_809 | 241 |
| 312 | 3300048907 | Ga0496104_0020392 | Ga0496104_0020392_5112_5897 | 241 |
| 313 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_50925_51713 | 241 |
| 314 | 3300048909 | Ga0496106_0000027 | Ga0496106_0000027_6319_7110 | 241 |
| 315 | 3300048909 | Ga0496106_0000117 | Ga0496106_0000117_13516_14292 | 241 |
| 316 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_160785_161576 | 241 |
| 317 | 3300048910 | Ga0496107_0000009 | Ga0496107_0000009_217369_218145 | 241 |
| 318 | 3300048911 | Ga0496108_0010893 | Ga0496108_0010893_108_893 | 241 |
| 319 | 3300048912 | Ga0496109_0125282 | Ga0496109_0125282_88_873 | 241 |
| 320 | 3300048913 | Ga0496110_0017387 | Ga0496110_0017387_2200_2988 | 241 |
| 321 | 3300048914 | Ga0496111_0128461 | Ga0496111_0128461_939_1724 | 241 |
| 322 | 3300048916 | Ga0496113_0004020 | Ga0496113_0004020_1071_1856 | 241 |
| 323 | 3300048916 | Ga0496113_0248360 | Ga0496113_0248360_285_1085 | 241 |
| 324 | 3300053077 | Ga0495601_0000080 | Ga0495601_0000080_26160_26948 | 241 |
| 325 | 3300053077 | Ga0495601_0020657 | Ga0495601_0020657_2741_3517 | 241 |
| 326 | 3300053077 | Ga0495601_0111687 | Ga0495601_0111687_78_854 | 241 |
| 327 | 3300053078 | Ga0495612_0008591 | Ga0495612_0008591_590_1366 | 241 |
| 328 | 3300053084 | Ga0495595_0052663 | Ga0495595_0052663_162_941 | 241 |
| 329 | 3300053085 | Ga0495619_0002211 | Ga0495619_0002211_414_1199 | 241 |
| 330 | 3300053085 | Ga0495619_0015759 | Ga0495619_0015759_1615_2394 | 241 |
| 331 | 3300053094 | Ga0500566_0002540 | Ga0500566_0002540_690_1481 | 241 |
| 332 | 3300053123 | Ga0500614_003156 | Ga0500614_003156_452_1246 | 241 |
| 333 | 3300002074 | JGI24748J21848_1001440 | JGI24748J21848_10014402 | 242 |
| 334 | 3300002239 | JGI24034J26672_10000567 | JGI24034J26672_100005675 | 242 |
| 335 | 3300005329 | Ga0070683_100065971 | Ga0070683_1000659713 | 242 |
| 336 | 3300005329 | Ga0070683_100103824 | Ga0070683_1001038242 | 242 |
| 337 | 3300005333 | Ga0070677_10000030 | Ga0070677_100000304 | 242 |
| 338 | 3300005338 | Ga0068868_100047588 | Ga0068868_1000475884 | 242 |
| 339 | 3300005338 | Ga0068868_100269549 | Ga0068868_1002695492 | 242 |
| 340 | 3300005344 | Ga0070661_100000031 | Ga0070661_10000003190 | 242 |
| 341 | 3300005347 | Ga0070668_100030816 | Ga0070668_1000308162 | 242 |
| 342 | 3300005354 | Ga0070675_100000073 | Ga0070675_10000007358 | 242 |
| 343 | 3300005365 | Ga0070688_100000506 | Ga0070688_10000050612 | 242 |
| 344 | 3300005365 | Ga0070688_100000848 | Ga0070688_1000008488 | 242 |
| 345 | 3300005367 | Ga0070667_100055937 | Ga0070667_1000559372 | 242 |
| 346 | 3300005435 | Ga0070714_100120443 | Ga0070714_1001204433 | 242 |
| 347 | 3300005441 | Ga0070700_100015791 | Ga0070700_1000157915 | 242 |
| 348 | 3300005457 | Ga0070662_100000005 | Ga0070662_100000005136 | 242 |
| 349 | 3300005466 | Ga0070685_10000932 | Ga0070685_1000093211 | 242 |
| 350 | 3300005466 | Ga0070685_10002367 | Ga0070685_100023679 | 242 |
| 351 | 3300005535 | Ga0070684_100058588 | Ga0070684_1000585883 | 242 |
| 352 | 3300005547 | Ga0070693_100000815 | Ga0070693_1000008156 | 242 |
| 353 | 3300005548 | Ga0070665_100005655 | Ga0070665_10000565510 | 242 |
| 354 | 3300005548 | Ga0070665_100051337 | Ga0070665_1000513372 | 242 |
| 355 | 3300005548 | Ga0070665_100206134 | Ga0070665_1002061342 | 242 |
| 356 | 3300005563 | Ga0068855_100217765 | Ga0068855_1002177653 | 242 |
| 357 | 3300005564 | Ga0070664_100032745 | Ga0070664_1000327454 | 242 |
| 358 | 3300005577 | Ga0068857_100086637 | Ga0068857_1000866373 | 242 |
| 359 | 3300005578 | Ga0068854_100044691 | Ga0068854_1000446913 | 242 |
| 360 | 3300005614 | Ga0068856_100011606 | Ga0068856_1000116063 | 242 |
| 361 | 3300005616 | Ga0068852_100213667 | Ga0068852_1002136672 | 242 |
| 362 | 3300005834 | Ga0068851_10021394 | Ga0068851_100213942 | 242 |
| 363 | 3300006038 | Ga0075365_10202300 | Ga0075365_102023002 | 242 |
| 364 | 3300006038 | Ga0075365_10215812 | Ga0075365_102158122 | 242 |
| 365 | 3300006051 | Ga0075364_10040728 | Ga0075364_100407285 | 242 |
| 366 | 3300006846 | Ga0075430_100113990 | Ga0075430_1001139902 | 242 |
| 367 | 3300006847 | Ga0075431_100013519 | Ga0075431_1000135196 | 242 |
| 368 | 3300006881 | Ga0068865_100000001 | Ga0068865_10000000145 | 242 |
| 369 | 3300009094 | Ga0111539_10243271 | Ga0111539_102432712 | 242 |
| 370 | 3300009147 | Ga0114129_10239477 | Ga0114129_102394772 | 242 |
| 371 | 3300009148 | Ga0105243_10041345 | Ga0105243_100413453 | 242 |
| 372 | 3300009148 | Ga0105243_10174056 | Ga0105243_101740562 | 242 |
| 373 | 3300009553 | Ga0105249_10000192 | Ga0105249_1000019212 | 242 |
| 374 | 3300012507 | Ga0157342_1014853 | Ga0157342_10148531 | 242 |
| 375 | 3300014325 | Ga0163163_10376506 | Ga0163163_103765062 | 242 |
| 376 | 3300014326 | Ga0157380_10000373 | Ga0157380_100003739 | 242 |
| 377 | 3300025321 | Ga0207656_10012500 | Ga0207656_100125002 | 242 |
| 378 | 3300025893 | Ga0207682_10000003 | Ga0207682_1000000378 | 242 |
| 379 | 3300025920 | Ga0207649_10000021 | Ga0207649_10000021179 | 242 |
| 380 | 3300025926 | Ga0207659_10000082 | Ga0207659_1000008258 | 242 |
| 381 | 3300025935 | Ga0207709_10022401 | Ga0207709_100224014 | 242 |
| 382 | 3300025935 | Ga0207709_10137193 | Ga0207709_101371932 | 242 |
| 383 | 3300025938 | Ga0207704_10000012 | Ga0207704_10000012117 | 242 |
| 384 | 3300025944 | Ga0207661_10026767 | Ga0207661_100267673 | 242 |
| 385 | 3300025944 | Ga0207661_10066564 | Ga0207661_100665642 | 242 |
| 386 | 3300025945 | Ga0207679_10018749 | Ga0207679_100187495 | 242 |
| 387 | 3300025949 | Ga0207667_10145184 | Ga0207667_101451842 | 242 |
| 388 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003347 | 242 |
| 389 | 3300025972 | Ga0207668_10075892 | Ga0207668_100758922 | 242 |
| 390 | 3300025981 | Ga0207640_10007305 | Ga0207640_100073053 | 242 |
| 391 | 3300026023 | Ga0207677_10000902 | Ga0207677_1000090220 | 242 |
| 392 | 3300026023 | Ga0207677_10179848 | Ga0207677_101798482 | 242 |
| 393 | 3300026075 | Ga0207708_10039590 | Ga0207708_100395902 | 242 |
| 394 | 3300026078 | Ga0207702_10000316 | Ga0207702_1000031665 | 242 |
| 395 | 3300026089 | Ga0207648_10001595 | Ga0207648_1000159514 | 242 |
| 396 | 3300026089 | Ga0207648_10035542 | Ga0207648_100355422 | 242 |
| 397 | 3300026142 | Ga0207698_10150520 | Ga0207698_101505203 | 242 |
| 398 | 3300028379 | Ga0268266_10011667 | Ga0268266_100116674 | 242 |
| 399 | 3300028379 | Ga0268266_10034171 | Ga0268266_100341714 | 242 |
| 400 | 3300028379 | Ga0268266_10078323 | Ga0268266_100783233 | 242 |
| 401 | 3300031727 | Ga0316576_10002289 | Ga0316576_100022896 | 242 |
| 402 | 3300035398 | Ga0316574_0013026 | Ga0316574_0013026_3639_4433 | 242 |
| 403 | 3300036401 | Ga0373937_0006840 | Ga0373937_0006840_7076_7864 | 242 |
| 404 | 3300036712 | Ga0316584_0009370 | Ga0316584_0009370_3314_4108 | 242 |
| 405 | 3300041512 | Ga0451853_2266777 | Ga0451853_2266777_620_1408 | 242 |
| 406 | 3300044694 | Ga0466963_0022205 | Ga0466963_0022205_2371_3162 | 242 |
| 407 | 3300044694 | Ga0466963_0080948 | Ga0466963_0080948_1194_1970 | 242 |
| 408 | 3300045976 | Ga0466967_0045840 | Ga0466967_0045840_739_1527 | 242 |
| 409 | 3300046461 | Ga0495641_0018220 | Ga0495641_0018220_376_1152 | 242 |
| 410 | 3300046473 | Ga0495582_0000007 | Ga0495582_0000007_43127_43915 | 242 |
| 411 | 3300046514 | Ga0495618_0000003 | Ga0495618_0000003_83860_84711 | 242 |
| 412 | 3300046516 | Ga0495628_0002265 | Ga0495628_0002265_6054_6830 | 242 |
| 413 | 3300046516 | Ga0495628_0009797 | Ga0495628_0009797_1669_2457 | 242 |
| 414 | 3300046517 | Ga0495630_0005868 | Ga0495630_0005868_3995_4786 | 242 |
| 415 | 3300046517 | Ga0495630_0036118 | Ga0495630_0036118_38_826 | 242 |
| 416 | 3300046533 | Ga0495640_0081934 | Ga0495640_0081934_1324_2112 | 242 |
| 417 | 3300046536 | Ga0495587_0053463 | Ga0495587_0053463_657_1433 | 242 |
| 418 | 3300046615 | Ga0495656_0003197 | Ga0495656_0003197_1271_2053 | 242 |
| 419 | 3300046642 | Ga0495634_0009750 | Ga0495634_0009750_5201_5986 | 242 |
| 420 | 3300046663 | Ga0495635_0000009 | Ga0495635_0000009_160567_161388 | 242 |
| 421 | 3300046663 | Ga0495635_0005067 | Ga0495635_0005067_7811_8596 | 242 |
| 422 | 3300046674 | Ga0495588_0000241 | Ga0495588_0000241_31140_31928 | 242 |
| 423 | 3300046683 | Ga0495658_0000007 | Ga0495658_0000007_43121_43909 | 242 |
| 424 | 3300046684 | Ga0495669_0015907 | Ga0495669_0015907_264_1040 | 242 |
| 425 | 3300046689 | Ga0495613_0000522 | Ga0495613_0000522_15178_15963 | 242 |
| 426 | 3300046689 | Ga0495613_0216634 | Ga0495613_0216634_94_882 | 242 |
| 427 | 3300046690 | Ga0495624_0000256 | Ga0495624_0000256_16972_17757 | 242 |
| 428 | 3300046809 | Ga0495600_0105048 | Ga0495600_0105048_56_907 | 242 |
| 429 | 3300047317 | Ga0495604_0019113 | Ga0495604_0019113_1996_2781 | 242 |
| 430 | 3300047319 | Ga0495674_0000027 | Ga0495674_0000027_89879_90655 | 242 |
| 431 | 3300047321 | Ga0495676_0023243 | Ga0495676_0023243_71_847 | 242 |
| 432 | 3300047472 | Ga0495686_0230407 | Ga0495686_0230407_39_815 | 242 |
| 433 | 3300048088 | Ga0495602_0000008 | Ga0495602_0000008_35131_35916 | 242 |
| 434 | 3300048088 | Ga0495602_0006000 | Ga0495602_0006000_4520_5296 | 242 |
| 435 | 3300048905 | Ga0496102_0237235 | Ga0496102_0237235_507_1319 | 242 |
| 436 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_322256_323035 | 242 |
| 437 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_525195_525974 | 242 |
| 438 | 3300048909 | Ga0496106_0447390 | Ga0496106_0447390_196_1008 | 242 |
| 439 | 3300048910 | Ga0496107_0270395 | Ga0496107_0270395_390_1202 | 242 |
| 440 | 3300048911 | Ga0496108_0000221 | Ga0496108_0000221_5054_5830 | 242 |
| 441 | 3300048912 | Ga0496109_0000195 | Ga0496109_0000195_11872_12648 | 242 |
| 442 | 3300048912 | Ga0496109_0631908 | Ga0496109_0631908_10_795 | 242 |
| 443 | 3300048913 | Ga0496110_0008159 | Ga0496110_0008159_2174_2959 | 242 |
| 444 | 3300048913 | Ga0496110_0496278 | Ga0496110_0496278_245_1021 | 242 |
| 445 | 3300048914 | Ga0496111_0010397 | Ga0496111_0010397_2138_2923 | 242 |
| 446 | 3300048915 | Ga0496112_0159145 | Ga0496112_0159145_502_1278 | 242 |
| 447 | 3300049569 | Ga0501032_0096105 | Ga0501032_0096105_926_1708 | 242 |
| 448 | 3300049578 | Ga0501042_0047581 | Ga0501042_0047581_1879_2664 | 242 |
| 449 | 3300049582 | Ga0501048_0293553 | Ga0501048_0293553_120_902 | 242 |
| 450 | 3300049585 | Ga0501069_0021194 | Ga0501069_0021194_1606_2382 | 242 |
| 451 | 3300049586 | Ga0501070_0112623 | Ga0501070_0112623_1243_2019 | 242 |
| 452 | 3300049586 | Ga0501070_0334955 | Ga0501070_0334955_230_1012 | 242 |
| 453 | 3300049588 | Ga0501072_0214015 | Ga0501072_0214015_742_1518 | 242 |
| 454 | 3300049591 | Ga0501075_0021437 | Ga0501075_0021437_1527_2315 | 242 |
| 455 | 3300049742 | Ga0501080_0134315 | Ga0501080_0134315_229_1011 | 242 |
| 456 | 3300049742 | Ga0501080_0611446 | Ga0501080_0611446_148_945 | 242 |
| 457 | 3300050491 | nmdc:mga00v17_99281_c1 | nmdc:mga00v17_99281_c1_650_1444 | 242 |
| 458 | 3300050507 | nmdc:mga05p37_206880_c1 | nmdc:mga05p37_206880_c1_937_1749 | 242 |
| 459 | 3300050509 | nmdc:mga0qj67_75572_c1 | nmdc:mga0qj67_75572_c1_1400_2203 | 242 |
| 460 | 3300050511 | nmdc:mga08y16_368018_c1 | nmdc:mga08y16_368018_c1_366_1154 | 242 |
| 461 | 3300050512 | nmdc:mga0n895_277979_c1 | nmdc:mga0n895_277979_c1_486_1298 | 242 |
| 462 | 3300050513 | nmdc:mga0rr50_170004_c1 | nmdc:mga0rr50_170004_c1_401_1213 | 242 |
| 463 | 3300053077 | Ga0495601_0000098 | Ga0495601_0000098_38439_39224 | 242 |
| 464 | 3300053078 | Ga0495612_0000358 | Ga0495612_0000358_9680_10459 | 242 |
| 465 | 3300053084 | Ga0495595_0014790 | Ga0495595_0014790_1070_1855 | 242 |
| 466 | 3300053085 | Ga0495619_0000785 | Ga0495619_0000785_19211_19996 | 242 |
| 467 | 3300053085 | Ga0495619_0109701 | Ga0495619_0109701_917_1696 | 242 |
| 468 | 3300060353 | Ga0501082_0669902 | Ga0501082_0669902_55_843 | 242 |
| 469 | 3300061734 | Ga0530510_0138761 | Ga0530510_0138761_310_1107 | 242 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z69-assembly1.cif.gz_B | crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 | 0.7614 | 2 | 224 |
| 1ezw-assembly1.cif.gz_A | structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri | 0.7464 | 3 | 224 |
| 1xkj-assembly1.cif.gz_B | bacterial luciferase beta2 homodimer | 0.7244 | 2 | 223 |
| 1f07-assembly1.cif.gz_A | structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum | 0.7243 | 2 | 239 |
| 1f07-assembly1.cif.gz_A | structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum | 0.7111 | 2 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05772_7_317_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.802 | 16 | 241 | 3.20.20.30 |
| af_O53565_5_346_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7887 | 1 | 238 | 3.20.20.30 |
| af_O53565_5_346_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7742 | 1 | 238 | 3.20.20.30 |
| af_O05772_7_317_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7516 | 16 | 241 | 3.20.20.30 |
| 1ezwA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.7465 | 3 | 224 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9HSL8-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9634 | 104 | 242 |
GO:0016705
|
| AF-A0A7J9YZH5-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9546 | 2 | 242 |
GO:0016705
|
| AF-A0A838UWV7-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9492 | 2 | 242 |
GO:0016705
|
| AF-A0A7J9YZH5-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9468 | 2 | 242 |
GO:0016705
|
| AF-A0A838UWV7-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9415 | 2 | 242 |
GO:0016705
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar