F450306

General Info

Members Datasets Scaffolds Average Seq Length
469 255 469 245

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0020939|Ga0495602_0020939_4715_5596
Length 275
Sequence VALEKCHGFRAKARQYGTGLPRRGFIPIGFLVVSDGQNRGFGVAAGLDPAVARPLAERCAELGYGSMWSNDHPGAKGLETLAEFDAAAPGIDLGVAVIALDRTPPETIAVDIERLDLDPARLWLGVGAGFSKKPLTRMAEMGPKMCALAGSGFDGAFFNWMTPEFAVRSRELVEAGAREMGRDTPPVFGYVRTAVGPDAPERLAKEESFYRDLHPGYRNHFNRLAEPEGTVGVAAADAPEAEQKLAAYTALDTVVVRGLASATVEAMTAVAAAAA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
252 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 14.07
Rhizosphere 82.3
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1001440 3300002074 Bacteria 2618
2 JGI24034J26672_10000567 3300002239 Bacteria 4710
3 Ga0070683_100004550 3300005329 Bacteria 11445
4 Ga0070683_100065971 3300005329 Bacteria 3371
5 Ga0070683_100103824 3300005329 Bacteria 2679
6 Ga0070683_100133596 3300005329 Bacteria 2349
7 Ga0070677_10000030 3300005333 Bacteria 41834
8 Ga0070680_100063191 3300005336 Bacteria 3032
9 Ga0070682_100000057 3300005337 Bacteria 108832
10 Ga0070682_100000100 3300005337 Bacteria 77054
11 Ga0070682_100501483 3300005337 Bacteria 941
12 Ga0068868_100047588 3300005338 Bacteria 3362
13 Ga0068868_100269549 3300005338 Unclassified 1438
14 Ga0070691_10003021 3300005341 Bacteria 7535
15 Ga0070691_10123658 3300005341 Bacteria 1305
16 Ga0070661_100000031 3300005344 Bacteria 113816
17 Ga0070668_100021473 3300005347 Bacteria 4877
18 Ga0070668_100030816 3300005347 Bacteria 4080
19 Ga0070675_100000073 3300005354 Bacteria 57652
20 Ga0070674_100000003 3300005356 Bacteria 258221
21 Ga0070674_100023861 3300005356 Bacteria 3966
22 Ga0070673_100062059 3300005364 Bacteria 2968
23 Ga0070688_100000506 3300005365 Bacteria 19723
24 Ga0070688_100000848 3300005365 Bacteria 15156
25 Ga0070659_100002416 3300005366 Bacteria 13275
26 Ga0070667_100055937 3300005367 Bacteria 3332
27 Ga0070714_100120443 3300005435 Bacteria 2334
28 Ga0070713_100000040 3300005436 Bacteria 82527
29 Ga0070713_100126582 3300005436 Bacteria 2248
30 Ga0070701_10044345 3300005438 Bacteria 2278
31 Ga0070711_100006965 3300005439 Bacteria 6856
32 Ga0070700_100015791 3300005441 Bacteria 4289
33 Ga0070700_100023617 3300005441 Bacteria 3598
34 Ga0070694_100557601 3300005444 Bacteria 918
35 Ga0070708_100335039 3300005445 Bacteria 1426
36 Ga0070663_100063976 3300005455 Bacteria 2658
37 Ga0070678_100022773 3300005456 Bacteria 4160
38 Ga0070678_100172703 3300005456 Unclassified 1762
39 Ga0070662_100000005 3300005457 Bacteria 183056
40 Ga0070681_10003375 3300005458 Bacteria 14931
41 Ga0070685_10000932 3300005466 Bacteria 15756
42 Ga0070685_10002367 3300005466 Bacteria 9704
43 Ga0070679_100000342 3300005530 Bacteria 39556
44 Ga0070684_100030495 3300005535 Bacteria 4582
45 Ga0070684_100058588 3300005535 Bacteria 3366
46 Ga0068853_100010810 3300005539 Bacteria 7393
47 Ga0068853_100290377 3300005539 Bacteria 1509
48 Ga0070672_100000023 3300005543 Bacteria 68631
49 Ga0070686_100021305 3300005544 Bacteria 3850
50 Ga0070693_100000815 3300005547 Bacteria 13820
51 Ga0070665_100000159 3300005548 Bacteria 122613
52 Ga0070665_100005655 3300005548 Bacteria 12855
53 Ga0070665_100051337 3300005548 Bacteria 4136
54 Ga0070665_100206134 3300005548 Bacteria 1967
55 Ga0070704_100011003 3300005549 Bacteria 5521
56 Ga0070704_100804640 3300005549 Unclassified 840
57 Ga0068855_100217765 3300005563 Bacteria 2143
58 Ga0070664_100032745 3300005564 Bacteria 4348
59 Ga0068857_100086637 3300005577 Bacteria 2801
60 Ga0068857_100319347 3300005577 Bacteria 1434
61 Ga0068854_100000228 3300005578 Bacteria 38071
62 Ga0068854_100044691 3300005578 Bacteria 3146
63 Ga0068856_100011606 3300005614 Bacteria 8546
64 Ga0068856_100017999 3300005614 Bacteria 6850
65 Ga0068856_100036276 3300005614 Bacteria 4834
66 Ga0068852_100000131 3300005616 Bacteria 50602
67 Ga0068852_100023662 3300005616 Bacteria 4948
68 Ga0068852_100213667 3300005616 Bacteria 1831
69 Ga0068864_100000262 3300005618 Bacteria 47006
70 Ga0068866_10000002 3300005718 Bacteria 394090
71 Ga0068866_10018222 3300005718 Bacteria 3172
72 Ga0068861_100183345 3300005719 Bacteria 1744
73 Ga0068851_10001684 3300005834 Bacteria 9671
74 Ga0068851_10021394 3300005834 Bacteria 3140
75 Ga0068863_100000032 3300005841 Bacteria 172402
76 Ga0068863_100030645 3300005841 Bacteria 5136
77 Ga0068858_100000043 3300005842 Bacteria 132444
78 Ga0068858_100000049 3300005842 Bacteria 122693
79 Ga0068860_100008225 3300005843 Bacteria 10383
80 Ga0068860_100224887 3300005843 Bacteria 1823
81 Ga0081455_10041442 3300005937 Bacteria 4048
82 Ga0081455_10090771 3300005937 Bacteria 2476
83 Ga0081455_10232850 3300005937 Bacteria 1358
84 Ga0081538_10008571 3300005981 Bacteria 8653
85 Ga0081540_1000025 3300005983 Bacteria 157742
86 Ga0081540_1062711 3300005983 Bacteria 1763
87 Ga0081539_10001602 3300005985 Bacteria 37290
88 Ga0075365_10202300 3300006038 Bacteria 1391
89 Ga0075365_10215812 3300006038 Bacteria 1345
90 Ga0075363_100030246 3300006048 Unclassified 2802
91 Ga0075364_10040728 3300006051 Bacteria 3014
92 Ga0075364_10109866 3300006051 Unclassified 1839
93 Ga0070715_10000012 3300006163 Bacteria 173731
94 Ga0070712_100004470 3300006175 Bacteria 8632
95 Ga0070712_100023424 3300006175 Bacteria 4079
96 Ga0068871_100186873 3300006358 Bacteria 1783
97 Ga0075430_100113990 3300006846 Bacteria 2253
98 Ga0075431_100013519 3300006847 Bacteria 8246
99 Ga0075431_100061325 3300006847 Bacteria 3881
100 Ga0075433_10000093 3300006852 Bacteria 42077
101 Ga0075433_10008121 3300006852 Bacteria 8359
102 Ga0068865_100000001 3300006881 Bacteria 288199
103 Ga0111539_10243271 3300009094 Bacteria 2095
104 Ga0105245_10000091 3300009098 Bacteria 89925
105 Ga0105245_10000955 3300009098 Bacteria 26277
106 Ga0105245_10001248 3300009098 Bacteria 22969
107 Ga0105245_10001267 3300009098 Bacteria 22830
108 Ga0105245_10001725 3300009098 Bacteria 19939
109 Ga0105245_10237132 3300009098 Bacteria 1767
110 Ga0114129_10239477 3300009147 Bacteria 2439
111 Ga0105243_10041345 3300009148 Bacteria 3606
112 Ga0105243_10174056 3300009148 Bacteria 1867
113 Ga0105241_10105944 3300009174 Bacteria 2243
114 Ga0105242_10000575 3300009176 Bacteria 29085
115 Ga0105242_10411471 3300009176 Unclassified 1265
116 Ga0105248_10000466 3300009177 Bacteria 46063
117 Ga0105249_10000192 3300009553 Bacteria 69997
118 Ga0105249_10944388 3300009553 Unclassified 930
119 Ga0105239_10108396 3300010375 Bacteria 3077
120 Ga0105239_10290788 3300010375 Bacteria 1840
121 Ga0105239_10374275 3300010375 Bacteria 1610
122 Ga0105246_10025900 3300011119 Bacteria 3826
123 Ga0105246_10143545 3300011119 Bacteria 1798
124 Ga0157342_1014853 3300012507 Bacteria 847
125 Ga0157370_10027409 3300013104 Bacteria 5617
126 Ga0157369_10000128 3300013105 Bacteria 108576
127 Ga0157374_10010028 3300013296 Bacteria 8132
128 Ga0157374_10027538 3300013296 Bacteria 5131
129 Ga0157378_10074028 3300013297 Bacteria 3064
130 Ga0157372_10000121 3300013307 Bacteria 83548
131 Ga0157375_10051373 3300013308 Bacteria 4048
132 Ga0157375_10057327 3300013308 Bacteria 3850
133 Ga0157375_10084307 3300013308 Bacteria 3226
134 Ga0157375_10085865 3300013308 Bacteria 3197
135 Ga0163163_10376506 3300014325 Bacteria 1477
136 Ga0157380_10000373 3300014326 Bacteria 26937
137 Ga0157379_10218254 3300014968 Bacteria 1727
138 Ga0163161_10000073 3300017792 Bacteria 102053
139 Ga0163161_10405360 3300017792 Unclassified 1094
140 Ga0207656_10012500 3300025321 Bacteria 3230
141 Ga0207656_10063223 3300025321 Bacteria 1629
142 Ga0207682_10000003 3300025893 Bacteria 128548
143 Ga0207642_10000001 3300025899 Bacteria 714030
144 Ga0207642_10000003 3300025899 Bacteria 650651
145 Ga0207642_10000004 3300025899 Bacteria 407822
146 Ga0207642_10011311 3300025899 Bacteria 3178
147 Ga0207685_10000001 3300025905 Bacteria 604473
148 Ga0207654_10049517 3300025911 Bacteria 2410
149 Ga0207707_10021445 3300025912 Bacteria 5647
150 Ga0207693_10002303 3300025915 Bacteria 16597
151 Ga0207693_10002931 3300025915 Bacteria 14766
152 Ga0207663_10004537 3300025916 Bacteria 6914
153 Ga0207660_10043074 3300025917 Bacteria 3171
154 Ga0207649_10000021 3300025920 Bacteria 209660
155 Ga0207652_10000351 3300025921 Bacteria 47656
156 Ga0207659_10000082 3300025926 Bacteria 57573
157 Ga0207687_10000012 3300025927 Bacteria 370729
158 Ga0207687_10000042 3300025927 Bacteria 108169
159 Ga0207687_10000613 3300025927 Bacteria 24053
160 Ga0207700_10000032 3300025928 Bacteria 125088
161 Ga0207700_10286312 3300025928 Bacteria 1419
162 Ga0207644_10062240 3300025931 Bacteria 2706
163 Ga0207690_10001263 3300025932 Bacteria 16002
164 Ga0207686_10000042 3300025934 Bacteria 122852
165 Ga0207686_10004598 3300025934 Bacteria 7395
166 Ga0207686_10037675 3300025934 Bacteria 2920
167 Ga0207709_10022401 3300025935 Bacteria 3583
168 Ga0207709_10051350 3300025935 Bacteria 2527
169 Ga0207709_10137193 3300025935 Bacteria 1676
170 Ga0207670_10182725 3300025936 Bacteria 1581
171 Ga0207669_10000023 3300025937 Bacteria 96638
172 Ga0207704_10000012 3300025938 Bacteria 178319
173 Ga0207665_10071435 3300025939 Bacteria 2370
174 Ga0207691_10000172 3300025940 Bacteria 60310
175 Ga0207711_10000085 3300025941 Bacteria 99467
176 Ga0207661_10000192 3300025944 Bacteria 39824
177 Ga0207661_10002060 3300025944 Bacteria 13837
178 Ga0207661_10004186 3300025944 Bacteria 10093
179 Ga0207661_10026767 3300025944 Bacteria 4398
180 Ga0207661_10066564 3300025944 Bacteria 2927
181 Ga0207679_10018749 3300025945 Bacteria 4642
182 Ga0207667_10145184 3300025949 Bacteria 2443
183 Ga0207651_10001007 3300025960 Bacteria 12456
184 Ga0207712_10000003 3300025961 Bacteria 615314
185 Ga0207668_10075892 3300025972 Bacteria 2418
186 Ga0207640_10000026 3300025981 Bacteria 142343
187 Ga0207640_10007305 3300025981 Bacteria 6098
188 Ga0207658_10029105 3300025986 Bacteria 3897
189 Ga0207677_10000902 3300026023 Bacteria 16642
190 Ga0207677_10179848 3300026023 Bacteria 1663
191 Ga0207703_10000053 3300026035 Bacteria 143924
192 Ga0207703_10000132 3300026035 Bacteria 90163
193 Ga0207639_10017445 3300026041 Bacteria 5089
194 Ga0207678_10410801 3300026067 Bacteria 1173
195 Ga0207708_10039590 3300026075 Bacteria 3592
196 Ga0207708_10154910 3300026075 Bacteria 1807
197 Ga0207702_10000316 3300026078 Bacteria 55327
198 Ga0207702_10022211 3300026078 Bacteria 5259
199 Ga0207702_10025971 3300026078 Bacteria 4862
200 Ga0207641_10000071 3300026088 Bacteria 151812
201 Ga0207648_10001595 3300026089 Bacteria 24839
202 Ga0207648_10035542 3300026089 Bacteria 4389
203 Ga0207676_10000038 3300026095 Bacteria 171492
204 Ga0207675_100126694 3300026118 Bacteria 2419
205 Ga0207675_100786606 3300026118 Bacteria 964
206 Ga0207683_10038680 3300026121 Bacteria 4160
207 Ga0207683_10097553 3300026121 Bacteria 2621
208 Ga0207698_10000009 3300026142 Bacteria 281300
209 Ga0207698_10150520 3300026142 Bacteria 2019
210 Ga0268266_10000023 3300028379 Bacteria 501899
211 Ga0268266_10011667 3300028379 Bacteria 7627
212 Ga0268266_10034171 3300028379 Bacteria 4324
213 Ga0268266_10078323 3300028379 Bacteria 2876
214 Ga0268264_10003521 3300028381 Bacteria 13496
215 Ga0265337_1006261 3300028556 Bacteria 4613
216 Ga0265326_10000027 3300028558 Bacteria 110843
217 Ga0265319_1000548 3300028563 Bacteria 25570
218 Ga0265322_10000003 3300028654 Bacteria 468671
219 Ga0265338_10000047 3300028800 Bacteria 220905
220 Ga0265324_10000103 3300029957 Bacteria 67507
221 Ga0265328_10010469 3300031239 Bacteria 3731
222 Ga0265320_10000001 3300031240 Bacteria 847191
223 Ga0265329_10001629 3300031242 Bacteria 10760
224 Ga0265331_10002979 3300031250 Bacteria 11146
225 Ga0265327_10000003 3300031251 Bacteria 852750
226 Ga0265316_10023411 3300031344 Bacteria 5189
227 Ga0265314_10001375 3300031711 Bacteria 27314
228 Ga0316576_10002289 3300031727 Bacteria 10851
229 Ga0307415_100142799 3300032126 Bacteria 1831
230 Ga0316574_0013026 3300035398 Bacteria 4771
231 Ga0373937_0006840 3300036401 Bacteria 9841
232 Ga0373937_0195038 3300036401 Bacteria 1903
233 Ga0316584_0009370 3300036712 Bacteria 6792
234 Ga0395900_0096233 3300037418 Bacteria 3042
235 Ga0395900_0228438 3300037418 Bacteria 1873
236 Ga0395901_0065476 3300038443 Bacteria 3784
237 Ga0395901_0125976 3300038443 Bacteria 2692
238 Ga0451833_0353539 3300041491 Bacteria 2162
239 Ga0451853_2266777 3300041512 Bacteria 3683
240 Ga0466963_0022205 3300044694 Bacteria 4016
241 Ga0466963_0080948 3300044694 Bacteria 2199
242 Ga0466957_0003682 3300044842 Bacteria 8460
243 Ga0466967_0000007 3300045976 Bacteria 135597
244 Ga0466967_0045840 3300045976 Bacteria 3802
245 Ga0495592_0006735 3300046454 Bacteria 8570
246 Ga0495592_0141577 3300046454 Bacteria 1672
247 Ga0495592_0183159 3300046454 Bacteria 1425
248 Ga0495603_0000044 3300046455 Bacteria 53548
249 Ga0495603_0000291 3300046455 Bacteria 26643
250 Ga0495603_0022441 3300046455 Bacteria 3820
251 Ga0495629_0000976 3300046459 Bacteria 22977
252 Ga0495629_0008682 3300046459 Bacteria 7482
253 Ga0495629_0013552 3300046459 Bacteria 5882
254 Ga0495641_0000012 3300046461 Bacteria 144818
255 Ga0495641_0018220 3300046461 Bacteria 3629
256 Ga0495651_0370730 3300046462 Unclassified 941
257 Ga0495653_0067382 3300046463 Bacteria 2689
258 Ga0495653_0071876 3300046463 Bacteria 2585
259 Ga0495653_0107155 3300046463 Unclassified 2014
260 Ga0495582_0000007 3300046473 Bacteria 139882
261 Ga0495582_0096569 3300046473 Bacteria 1652
262 Ga0495662_0000121 3300046476 Bacteria 28985
263 Ga0495662_0007156 3300046476 Bacteria 5529
264 Ga0495664_0194423 3300046477 Bacteria 1230
265 Ga0495594_0000005 3300046499 Bacteria 175437
266 Ga0495606_0000082 3300046507 Bacteria 159585
267 Ga0495608_0000590 3300046511 Bacteria 24984
268 Ga0495608_0001675 3300046511 Bacteria 15943
269 Ga0495608_0099559 3300046511 Bacteria 1875
270 Ga0495618_0000003 3300046514 Bacteria 256269
271 Ga0495620_0000446 3300046515 Bacteria 27496
272 Ga0495628_0002265 3300046516 Bacteria 17396
273 Ga0495628_0009797 3300046516 Bacteria 8160
274 Ga0495628_0051003 3300046516 Bacteria 3272
275 Ga0495628_0053122 3300046516 Bacteria 3199
276 Ga0495628_0505270 3300046516 Bacteria 872
277 Ga0495630_0000007 3300046517 Bacteria 376915
278 Ga0495630_0005868 3300046517 Bacteria 8685
279 Ga0495630_0011828 3300046517 Bacteria 6323
280 Ga0495630_0036118 3300046517 Bacteria 3694
281 Ga0495630_0087146 3300046517 Bacteria 2358
282 Ga0495644_0001081 3300046523 Bacteria 11303
283 Ga0495652_0000060 3300046529 Bacteria 111891
284 Ga0495652_0000061 3300046529 Bacteria 111729
285 Ga0495640_0081934 3300046533 Bacteria 2144
286 Ga0495586_0000384 3300046535 Bacteria 27060
287 Ga0495587_0001311 3300046536 Bacteria 16514
288 Ga0495587_0053463 3300046536 Bacteria 2381
289 Ga0495587_0054477 3300046536 Bacteria 2357
290 Ga0495587_0138687 3300046536 Bacteria 1388
291 Ga0495598_0021713 3300046537 Bacteria 1710
292 Ga0495621_0014670 3300046539 Unclassified 2484
293 Ga0495645_0022954 3300046543 Bacteria 4516
294 Ga0495645_0506122 3300046543 Bacteria 754
295 Ga0495622_0000026 3300046557 Bacteria 137934
296 Ga0495667_0000042 3300046559 Bacteria 124237
297 Ga0495667_0119236 3300046559 Bacteria 1704
298 Ga0495656_0003197 3300046615 Bacteria 5519
299 Ga0495656_0114475 3300046615 Unclassified 1266
300 Ga0495634_0009750 3300046642 Bacteria 7066
301 Ga0495634_0173984 3300046642 Bacteria 1352
302 Ga0495625_0000319 3300046660 Bacteria 73241
303 Ga0495635_0000009 3300046663 Bacteria 259024
304 Ga0495635_0005067 3300046663 Bacteria 9160
305 Ga0495588_0000241 3300046674 Bacteria 46762
306 Ga0495657_0000992 3300046675 Bacteria 24981
307 Ga0495657_0090708 3300046675 Bacteria 1961
308 Ga0495599_0029441 3300046678 Bacteria 3443
309 Ga0495647_0000014 3300046681 Bacteria 87792
310 Ga0495647_0001518 3300046681 Bacteria 7170
311 Ga0495647_0015756 3300046681 Bacteria 2652
312 Ga0495658_0000007 3300046683 Bacteria 139822
313 Ga0495658_0002331 3300046683 Bacteria 9585
314 Ga0495669_0000074 3300046684 Bacteria 66373
315 Ga0495669_0015907 3300046684 Bacteria 3221
316 Ga0495613_0000003 3300046689 Bacteria 248826
317 Ga0495613_0000522 3300046689 Bacteria 32082
318 Ga0495613_0171883 3300046689 Bacteria 1537
319 Ga0495613_0216634 3300046689 Unclassified 1345
320 Ga0495624_0000002 3300046690 Bacteria 189957
321 Ga0495624_0000256 3300046690 Bacteria 42059
322 Ga0495670_0026482 3300046691 Bacteria 2870
323 Ga0495649_0005045 3300046694 Bacteria 8487
324 Ga0495600_0010225 3300046809 Bacteria 5816
325 Ga0495600_0105048 3300046809 Bacteria 1840
326 Ga0495604_0000084 3300047317 Bacteria 82199
327 Ga0495604_0000344 3300047317 Bacteria 41631
328 Ga0495604_0019113 3300047317 Bacteria 5486
329 Ga0495604_0109373 3300047317 Bacteria 2017
330 Ga0495674_0000027 3300047319 Bacteria 132744
331 Ga0495676_0014161 3300047321 Bacteria 7140
332 Ga0495676_0023243 3300047321 Bacteria 5384
333 Ga0495676_0131550 3300047321 Bacteria 1805
334 Ga0495680_0000255 3300047322 Bacteria 58745
335 Ga0495680_0001247 3300047322 Bacteria 27898
336 Ga0495680_0010811 3300047322 Bacteria 8129
337 Ga0495680_0015114 3300047322 Bacteria 6666
338 Ga0495675_0000520 3300047444 Bacteria 24971
339 Ga0495679_075964 3300047446 Unclassified 961
340 Ga0495686_0230407 3300047472 Bacteria 1049
341 Ga0495593_0018008 3300047673 Bacteria 3973
342 Ga0495602_0000008 3300048088 Bacteria 260157
343 Ga0495602_0006000 3300048088 Bacteria 12757
344 Ga0495602_0020939 3300048088 Bacteria 6449
345 Ga0495614_0017462 3300048089 Bacteria 3117
346 Ga0495614_0116947 3300048089 Bacteria 1174
347 Ga0496100_0000008 3300048903 Bacteria 231974
348 Ga0496100_0000016 3300048903 Bacteria 166058
349 Ga0496100_0115937 3300048903 Unclassified 1868
350 Ga0496101_0000016 3300048904 Bacteria 240753
351 Ga0496101_0000038 3300048904 Bacteria 166058
352 Ga0496102_0000139 3300048905 Bacteria 98670
353 Ga0496102_0028807 3300048905 Bacteria 4964
354 Ga0496102_0039225 3300048905 Bacteria 4279
355 Ga0496102_0237235 3300048905 Bacteria 1720
356 Ga0496103_0000001 3300048906 Bacteria 643471
357 Ga0496104_0000003 3300048907 Bacteria 669219
358 Ga0496104_0000007 3300048907 Bacteria 524804
359 Ga0496104_0000139 3300048907 Bacteria 67432
360 Ga0496104_0020392 3300048907 Bacteria 6077
361 Ga0496104_0122943 3300048907 Bacteria 2491
362 Ga0496105_0000002 3300048908 Bacteria 753215
363 Ga0496105_0000008 3300048908 Bacteria 335652
364 Ga0496105_0000054 3300048908 Bacteria 89081
365 Ga0496105_0044309 3300048908 Bacteria 3669
366 Ga0496105_0125616 3300048908 Bacteria 2114
367 Ga0496106_0000013 3300048909 Bacteria 202263
368 Ga0496106_0000027 3300048909 Bacteria 149560
369 Ga0496106_0000117 3300048909 Bacteria 60781
370 Ga0496106_0008800 3300048909 Bacteria 7459
371 Ga0496106_0323022 3300048909 Bacteria 1239
372 Ga0496106_0447390 3300048909 Bacteria 1038
373 Ga0496107_0000003 3300048910 Bacteria 304038
374 Ga0496107_0000009 3300048910 Bacteria 231682
375 Ga0496107_0003522 3300048910 Bacteria 10476
376 Ga0496107_0270395 3300048910 Bacteria 1265
377 Ga0496108_0000002 3300048911 Bacteria 700890
378 Ga0496108_0000110 3300048911 Bacteria 84585
379 Ga0496108_0000221 3300048911 Bacteria 51191
380 Ga0496108_0010893 3300048911 Bacteria 7381
381 Ga0496108_0038134 3300048911 Bacteria 4003
382 Ga0496108_0164444 3300048911 Bacteria 1918
383 Ga0496109_0000001 3300048912 Bacteria 700852
384 Ga0496109_0000046 3300048912 Bacteria 131025
385 Ga0496109_0000087 3300048912 Bacteria 95196
386 Ga0496109_0000195 3300048912 Bacteria 60380
387 Ga0496109_0125282 3300048912 Bacteria 2395
388 Ga0496109_0186371 3300048912 Bacteria 1949
389 Ga0496109_0631908 3300048912 Bacteria 1007
390 Ga0496110_0000004 3300048913 Bacteria 122867
391 Ga0496110_0005662 3300048913 Bacteria 9804
392 Ga0496110_0008159 3300048913 Bacteria 8414
393 Ga0496110_0017387 3300048913 Bacteria 6015
394 Ga0496110_0062260 3300048913 Bacteria 3295
395 Ga0496110_0496278 3300048913 Unclassified 1112
396 Ga0496111_0000002 3300048914 Bacteria 135794
397 Ga0496111_0010397 3300048914 Bacteria 6243
398 Ga0496111_0051383 3300048914 Bacteria 2975
399 Ga0496111_0128461 3300048914 Bacteria 1874
400 Ga0496112_0000002 3300048915 Bacteria 782039
401 Ga0496112_0002086 3300048915 Bacteria 15849
402 Ga0496112_0159145 3300048915 Bacteria 2225
403 Ga0496113_0000012 3300048916 Bacteria 81903
404 Ga0496113_0004020 3300048916 Bacteria 8951
405 Ga0496113_0248360 3300048916 Bacteria 1420
406 Ga0496114_0000010 3300048917 Bacteria 363396
407 Ga0496114_0002667 3300048917 Bacteria 13622
408 Ga0496114_0096332 3300048917 Bacteria 2519
409 Ga0496115_0000005 3300048918 Bacteria 290756
410 Ga0496115_0000710 3300048918 Bacteria 24673
411 Ga0496115_0197200 3300048918 Bacteria 1664
412 Ga0496115_0362666 3300048918 Bacteria 1180
413 Ga0496125_0315111 3300048928 Bacteria 951
414 Ga0501032_0096105 3300049569 Bacteria 1964
415 Ga0501040_0149627 3300049576 Bacteria 1647
416 Ga0501042_0027320 3300049578 Bacteria 4013
417 Ga0501042_0047581 3300049578 Bacteria 3059
418 Ga0501048_0293553 3300049582 Bacteria 1156
419 Ga0501069_0021194 3300049585 Bacteria 3525
420 Ga0501070_0112623 3300049586 Bacteria 2248
421 Ga0501070_0334955 3300049586 Bacteria 1229
422 Ga0501071_0131492 3300049587 Bacteria 1860
423 Ga0501072_0214015 3300049588 Bacteria 1536
424 Ga0501072_0221516 3300049588 Bacteria 1508
425 Ga0501075_0021437 3300049591 Bacteria 4710
426 Ga0501076_0033894 3300049592 Bacteria 3988
427 Ga0501080_0134315 3300049742 Bacteria 2290
428 Ga0501080_0611446 3300049742 Unclassified 967
429 nmdc:mga03n38_150273_c1 3300050490 Unclassified 1171
430 nmdc:mga00v17_75912_c1 3300050491 Bacteria 2090
431 nmdc:mga00v17_99281_c1 3300050491 Bacteria 1836
432 nmdc:mga0yw44_152764_c1 3300050492 Unclassified 1507
433 nmdc:mga05p37_206880_c1 3300050507 Bacteria 2373
434 nmdc:mga0qj67_75572_c1 3300050509 Bacteria 2693
435 nmdc:mga08y16_368018_c1 3300050511 Bacteria 1475
436 nmdc:mga0n895_277979_c1 3300050512 Bacteria 1698
437 nmdc:mga0rr50_170004_c1 3300050513 Bacteria 1775
438 nmdc:mga0a205_124_c2 3300050515 Bacteria 20732
439 nmdc:mga0a205_12_c2 3300050515 Bacteria 69190
440 Ga0495601_0000080 3300053077 Bacteria 51518
441 Ga0495601_0000098 3300053077 Bacteria 48076
442 Ga0495601_0020657 3300053077 Bacteria 4023
443 Ga0495601_0095533 3300053077 Bacteria 1916
444 Ga0495601_0111687 3300053077 Bacteria 1770
445 Ga0495601_0199146 3300053077 Bacteria 1309
446 Ga0495612_0000358 3300053078 Bacteria 18497
447 Ga0495612_0008591 3300053078 Bacteria 4143
448 Ga0495655_0000007 3300053083 Bacteria 201058
449 Ga0495655_0000970 3300053083 Bacteria 4450
450 Ga0495595_0000069 3300053084 Bacteria 50835
451 Ga0495595_0000187 3300053084 Bacteria 24981
452 Ga0495595_0014790 3300053084 Bacteria 3318
453 Ga0495595_0052663 3300053084 Bacteria 1889
454 Ga0495619_0000024 3300053085 Bacteria 180821
455 Ga0495619_0000038 3300053085 Bacteria 121365
456 Ga0495619_0000542 3300053085 Bacteria 24940
457 Ga0495619_0000785 3300053085 Bacteria 20772
458 Ga0495619_0002211 3300053085 Bacteria 12886
459 Ga0495619_0015759 3300053085 Bacteria 4784
460 Ga0495619_0043703 3300053085 Bacteria 2939
461 Ga0495619_0109701 3300053085 Bacteria 1884
462 Ga0495619_0395890 3300053085 Bacteria 954
463 Ga0500566_0002540 3300053094 Bacteria 10846
464 Ga0500641_0004606 3300053096 Bacteria 4874
465 Ga0500554_008245 3300053102 Bacteria 2440
466 Ga0500614_003156 3300053123 Bacteria 3575
467 Ga0500628_000003 3300053129 Bacteria 204304
468 Ga0501082_0669902 3300060353 Bacteria 908
469 Ga0530510_0138761 3300061734 Bacteria 1791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0004606 Ga0500641_0004606_1102_1884 196
2 3300046536 Ga0495587_0138687 Ga0495587_0138687_618_1304 210
3 3300013104 Ga0157370_10027409 Ga0157370_100274092 211
4 3300009098 Ga0105245_10001248 Ga0105245_1000124811 212
5 3300025944 Ga0207661_10004186 Ga0207661_100041863 212
6 3300046455 Ga0495603_0022441 Ga0495603_0022441_86_772 212
7 3300046535 Ga0495586_0000384 Ga0495586_0000384_5712_6419 212
8 3300046543 Ga0495645_0506122 Ga0495645_0506122_23_709 212
9 3300046678 Ga0495599_0029441 Ga0495599_0029441_2267_2953 212
10 3300047317 Ga0495604_0109373 Ga0495604_0109373_1276_1968 212
11 3300047446 Ga0495679_075964 Ga0495679_075964_244_930 212
12 3300048911 Ga0496108_0000002 Ga0496108_0000002_395085_395774 212
13 3300048912 Ga0496109_0000001 Ga0496109_0000001_395047_395736 212
14 3300048928 Ga0496125_0315111 Ga0496125_0315111_201_890 212
15 3300046454 Ga0495592_0141577 Ga0495592_0141577_925_1620 213
16 3300053085 Ga0495619_0395890 Ga0495619_0395890_25_711 213
17 3300046476 Ga0495662_0000121 Ga0495662_0000121_28180_28881 217
18 3300044842 Ga0466957_0003682 Ga0466957_0003682_4539_5282 226
19 3300047673 Ga0495593_0018008 Ga0495593_0018008_3065_3805 226
20 3300005337 Ga0070682_100000100 Ga0070682_10000010016 227
21 3300010375 Ga0105239_10108396 Ga0105239_101083963 227
22 3300005444 Ga0070694_100557601 Ga0070694_1005576011 228
23 3300009098 Ga0105245_10000091 Ga0105245_1000009128 228
24 3300037418 Ga0395900_0096233 Ga0395900_0096233_511_1296 228
25 3300045976 Ga0466967_0000007 Ga0466967_0000007_106760_107527 228
26 3300046615 Ga0495656_0114475 Ga0495656_0114475_242_1024 228
27 3300048911 Ga0496108_0038134 Ga0496108_0038134_1254_1997 228
28 3300048912 Ga0496109_0000046 Ga0496109_0000046_65381_66124 228
29 3300050490 nmdc:mga03n38_150273_c1 nmdc:mga03n38_150273_c1_57_800 228
30 3300050492 nmdc:mga0yw44_152764_c1 nmdc:mga0yw44_152764_c1_162_905 228
31 3300005543 Ga0070672_100000023 Ga0070672_10000002313 229
32 3300025940 Ga0207691_10000172 Ga0207691_1000017271 229
33 3300038443 Ga0395901_0125976 Ga0395901_0125976_1854_2636 229
34 3300046694 Ga0495649_0005045 Ga0495649_0005045_6823_7557 229
35 3300048908 Ga0496105_0044309 Ga0496105_0044309_2925_3659 229
36 3300053077 Ga0495601_0095533 Ga0495601_0095533_425_1207 229
37 3300005937 Ga0081455_10090771 Ga0081455_100907713 230
38 3300048915 Ga0496112_0000002 Ga0496112_0000002_516339_517091 230
39 3300010375 Ga0105239_10374275 Ga0105239_103742752 231
40 3300037418 Ga0395900_0228438 Ga0395900_0228438_1074_1853 231
41 3300046557 Ga0495622_0000026 Ga0495622_0000026_118544_119326 231
42 3300048911 Ga0496108_0000110 Ga0496108_0000110_79146_79901 231
43 3300048912 Ga0496109_0000087 Ga0496109_0000087_79146_79901 231
44 3300048915 Ga0496112_0002086 Ga0496112_0002086_1488_2243 231
45 3300048916 Ga0496113_0000012 Ga0496113_0000012_57382_58137 231
46 3300050491 nmdc:mga00v17_75912_c1 nmdc:mga00v17_75912_c1_1227_1970 231
47 3300047317 Ga0495604_0000344 Ga0495604_0000344_8904_9689 232
48 3300046536 Ga0495587_0001311 Ga0495587_0001311_9486_10247 233
49 3300049576 Ga0501040_0149627 Ga0501040_0149627_129_890 233
50 3300049588 Ga0501072_0221516 Ga0501072_0221516_684_1445 233
51 3300046559 Ga0495667_0119236 Ga0495667_0119236_265_1035 234
52 3300005549 Ga0070704_100804640 Ga0070704_1008046401 235
53 3300011119 Ga0105246_10025900 Ga0105246_100259001 235
54 3300046689 Ga0495613_0000003 Ga0495613_0000003_25352_26110 235
55 3300048907 Ga0496104_0000139 Ga0496104_0000139_61711_62511 235
56 3300048908 Ga0496105_0000054 Ga0496105_0000054_13364_14164 235
57 3300005329 Ga0070683_100004550 Ga0070683_10000455013 236
58 3300005535 Ga0070684_100030495 Ga0070684_1000304952 236
59 3300046454 Ga0495592_0006735 Ga0495592_0006735_5419_6177 236
60 3300053102 Ga0500554_008245 Ga0500554_008245_473_1255 236
61 3300005337 Ga0070682_100501483 Ga0070682_1005014831 237
62 3300005439 Ga0070711_100006965 Ga0070711_1000069653 237
63 3300017792 Ga0163161_10405360 Ga0163161_104053601 237
64 3300025916 Ga0207663_10004537 Ga0207663_100045378 237
65 3300046499 Ga0495594_0000005 Ga0495594_0000005_156295_157071 237
66 3300046523 Ga0495644_0001081 Ga0495644_0001081_2099_2857 237
67 3300046529 Ga0495652_0000060 Ga0495652_0000060_23453_24229 237
68 3300046529 Ga0495652_0000061 Ga0495652_0000061_87888_88664 237
69 3300046537 Ga0495598_0021713 Ga0495598_0021713_387_1148 237
70 3300046559 Ga0495667_0000042 Ga0495667_0000042_43506_44282 237
71 3300047322 Ga0495680_0010811 Ga0495680_0010811_5633_6409 237
72 3300049578 Ga0501042_0027320 Ga0501042_0027320_764_1540 237
73 3300053077 Ga0495601_0199146 Ga0495601_0199146_211_978 237
74 3300005341 Ga0070691_10003021 Ga0070691_100030218 238
75 3300005445 Ga0070708_100335039 Ga0070708_1003350392 238
76 3300005455 Ga0070663_100063976 Ga0070663_1000639764 238
77 3300005937 Ga0081455_10041442 Ga0081455_100414423 238
78 3300005981 Ga0081538_10008571 Ga0081538_100085716 238
79 3300006175 Ga0070712_100004470 Ga0070712_1000044705 238
80 3300013308 Ga0157375_10085865 Ga0157375_100858653 238
81 3300025915 Ga0207693_10002303 Ga0207693_1000230314 238
82 3300025986 Ga0207658_10029105 Ga0207658_100291054 238
83 3300026067 Ga0207678_10410801 Ga0207678_104108011 238
84 3300046455 Ga0495603_0000044 Ga0495603_0000044_665_1441 238
85 3300046476 Ga0495662_0007156 Ga0495662_0007156_4717_5493 238
86 3300046539 Ga0495621_0014670 Ga0495621_0014670_46_834 238
87 3300048088 Ga0495602_0020939 Ga0495602_0020939_4715_5596 238
88 3300048089 Ga0495614_0017462 Ga0495614_0017462_1160_1942 238
89 3300048917 Ga0496114_0000010 Ga0496114_0000010_21108_21887 238
90 3300048918 Ga0496115_0000710 Ga0496115_0000710_2787_3566 238
91 3300005329 Ga0070683_100133596 Ga0070683_1001335963 239
92 3300005341 Ga0070691_10123658 Ga0070691_101236582 239
93 3300005436 Ga0070713_100000040 Ga0070713_10000004040 239
94 3300005441 Ga0070700_100023617 Ga0070700_1000236173 239
95 3300005456 Ga0070678_100172703 Ga0070678_1001727032 239
96 3300005544 Ga0070686_100021305 Ga0070686_1000213055 239
97 3300005548 Ga0070665_100000159 Ga0070665_10000015919 239
98 3300005549 Ga0070704_100011003 Ga0070704_1000110034 239
99 3300005718 Ga0068866_10018222 Ga0068866_100182223 239
100 3300005841 Ga0068863_100030645 Ga0068863_1000306452 239
101 3300005842 Ga0068858_100000043 Ga0068858_10000004325 239
102 3300005842 Ga0068858_100000049 Ga0068858_100000049124 239
103 3300005983 Ga0081540_1000025 Ga0081540_100002514 239
104 3300006048 Ga0075363_100030246 Ga0075363_1000302463 239
105 3300006051 Ga0075364_10109866 Ga0075364_101098662 239
106 3300006175 Ga0070712_100023424 Ga0070712_1000234241 239
107 3300006847 Ga0075431_100061325 Ga0075431_1000613254 239
108 3300006852 Ga0075433_10008121 Ga0075433_100081217 239
109 3300009098 Ga0105245_10000955 Ga0105245_100009554 239
110 3300009176 Ga0105242_10411471 Ga0105242_104114712 239
111 3300009553 Ga0105249_10944388 Ga0105249_109443881 239
112 3300010375 Ga0105239_10290788 Ga0105239_102907882 239
113 3300013308 Ga0157375_10051373 Ga0157375_100513733 239
114 3300013308 Ga0157375_10057327 Ga0157375_100573275 239
115 3300013308 Ga0157375_10084307 Ga0157375_100843072 239
116 3300025899 Ga0207642_10011311 Ga0207642_100113113 239
117 3300025915 Ga0207693_10002931 Ga0207693_1000293112 239
118 3300025928 Ga0207700_10000032 Ga0207700_1000003285 239
119 3300025939 Ga0207665_10071435 Ga0207665_100714352 239
120 3300025944 Ga0207661_10000192 Ga0207661_100001926 239
121 3300025944 Ga0207661_10002060 Ga0207661_100020605 239
122 3300026035 Ga0207703_10000053 Ga0207703_10000053137 239
123 3300026035 Ga0207703_10000132 Ga0207703_1000013291 239
124 3300026075 Ga0207708_10154910 Ga0207708_101549102 239
125 3300026118 Ga0207675_100786606 Ga0207675_1007866062 239
126 3300026121 Ga0207683_10097553 Ga0207683_100975532 239
127 3300028379 Ga0268266_10000023 Ga0268266_10000023239 239
128 3300032126 Ga0307415_100142799 Ga0307415_1001427992 239
129 3300041491 Ga0451833_0353539 Ga0451833_0353539_719_1495 239
130 3300046459 Ga0495629_0000976 Ga0495629_0000976_3855_4640 239
131 3300046459 Ga0495629_0013552 Ga0495629_0013552_4019_4795 239
132 3300046462 Ga0495651_0370730 Ga0495651_0370730_130_906 239
133 3300046473 Ga0495582_0096569 Ga0495582_0096569_759_1541 239
134 3300046507 Ga0495606_0000082 Ga0495606_0000082_117484_118269 239
135 3300046511 Ga0495608_0000590 Ga0495608_0000590_1849_2631 239
136 3300046543 Ga0495645_0022954 Ga0495645_0022954_2587_3366 239
137 3300046675 Ga0495657_0000992 Ga0495657_0000992_22351_23133 239
138 3300046681 Ga0495647_0000014 Ga0495647_0000014_37166_37954 239
139 3300046683 Ga0495658_0002331 Ga0495658_0002331_3932_4714 239
140 3300046689 Ga0495613_0171883 Ga0495613_0171883_299_1072 239
141 3300046690 Ga0495624_0000002 Ga0495624_0000002_49705_50493 239
142 3300047321 Ga0495676_0131550 Ga0495676_0131550_743_1525 239
143 3300047444 Ga0495675_0000520 Ga0495675_0000520_1834_2616 239
144 3300048089 Ga0495614_0116947 Ga0495614_0116947_121_903 239
145 3300048903 Ga0496100_0115937 Ga0496100_0115937_799_1581 239
146 3300048905 Ga0496102_0028807 Ga0496102_0028807_2219_3001 239
147 3300048907 Ga0496104_0000003 Ga0496104_0000003_331387_332175 239
148 3300048907 Ga0496104_0122943 Ga0496104_0122943_1368_2150 239
149 3300048908 Ga0496105_0000008 Ga0496105_0000008_140692_141480 239
150 3300048908 Ga0496105_0125616 Ga0496105_0125616_731_1513 239
151 3300048909 Ga0496106_0008800 Ga0496106_0008800_4765_5547 239
152 3300048909 Ga0496106_0323022 Ga0496106_0323022_279_1055 239
153 3300048910 Ga0496107_0003522 Ga0496107_0003522_8081_8863 239
154 3300048911 Ga0496108_0164444 Ga0496108_0164444_795_1577 239
155 3300048912 Ga0496109_0186371 Ga0496109_0186371_209_991 239
156 3300048913 Ga0496110_0005662 Ga0496110_0005662_5143_5925 239
157 3300048913 Ga0496110_0062260 Ga0496110_0062260_1644_2423 239
158 3300048914 Ga0496111_0051383 Ga0496111_0051383_72_854 239
159 3300048917 Ga0496114_0002667 Ga0496114_0002667_7871_8653 239
160 3300048918 Ga0496115_0197200 Ga0496115_0197200_103_882 239
161 3300048918 Ga0496115_0362666 Ga0496115_0362666_359_1141 239
162 3300049587 Ga0501071_0131492 Ga0501071_0131492_940_1743 239
163 3300049592 Ga0501076_0033894 Ga0501076_0033894_3132_3914 239
164 3300050515 nmdc:mga0a205_124_c2 nmdc:mga0a205_124_c2_8301_9074 239
165 3300053084 Ga0495595_0000187 Ga0495595_0000187_1849_2631 239
166 3300053085 Ga0495619_0000024 Ga0495619_0000024_158378_159154 239
167 3300053085 Ga0495619_0000038 Ga0495619_0000038_98673_99449 239
168 3300053085 Ga0495619_0000542 Ga0495619_0000542_22310_23092 239
169 3300053085 Ga0495619_0043703 Ga0495619_0043703_1003_1818 239
170 3300005356 Ga0070674_100000003 Ga0070674_10000000384 240
171 3300005366 Ga0070659_100002416 Ga0070659_10000241610 240
172 3300005436 Ga0070713_100126582 Ga0070713_1001265822 240
173 3300005456 Ga0070678_100022773 Ga0070678_1000227733 240
174 3300005539 Ga0068853_100290377 Ga0068853_1002903772 240
175 3300005577 Ga0068857_100319347 Ga0068857_1003193472 240
176 3300005578 Ga0068854_100000228 Ga0068854_1000002287 240
177 3300005614 Ga0068856_100017999 Ga0068856_1000179993 240
178 3300005614 Ga0068856_100036276 Ga0068856_1000362762 240
179 3300005616 Ga0068852_100000131 Ga0068852_1000001315 240
180 3300005616 Ga0068852_100023662 Ga0068852_1000236626 240
181 3300005718 Ga0068866_10000002 Ga0068866_10000002327 240
182 3300005834 Ga0068851_10001684 Ga0068851_100016842 240
183 3300005841 Ga0068863_100000032 Ga0068863_100000032153 240
184 3300005843 Ga0068860_100008225 Ga0068860_1000082255 240
185 3300006163 Ga0070715_10000012 Ga0070715_10000012176 240
186 3300006852 Ga0075433_10000093 Ga0075433_1000009338 240
187 3300009098 Ga0105245_10001725 Ga0105245_1000172521 240
188 3300009098 Ga0105245_10237132 Ga0105245_102371323 240
189 3300009174 Ga0105241_10105944 Ga0105241_101059442 240
190 3300009176 Ga0105242_10000575 Ga0105242_1000057534 240
191 3300009177 Ga0105248_10000466 Ga0105248_100004664 240
192 3300011119 Ga0105246_10143545 Ga0105246_101435452 240
193 3300013307 Ga0157372_10000121 Ga0157372_1000012170 240
194 3300017792 Ga0163161_10000073 Ga0163161_1000007355 240
195 3300025321 Ga0207656_10063223 Ga0207656_100632232 240
196 3300025899 Ga0207642_10000001 Ga0207642_10000001291 240
197 3300025899 Ga0207642_10000003 Ga0207642_10000003291 240
198 3300025899 Ga0207642_10000004 Ga0207642_10000004291 240
199 3300025905 Ga0207685_10000001 Ga0207685_10000001592 240
200 3300025911 Ga0207654_10049517 Ga0207654_100495172 240
201 3300025928 Ga0207700_10286312 Ga0207700_102863121 240
202 3300025932 Ga0207690_10001263 Ga0207690_1000126312 240
203 3300025934 Ga0207686_10000042 Ga0207686_1000004274 240
204 3300025937 Ga0207669_10000023 Ga0207669_1000002387 240
205 3300025941 Ga0207711_10000085 Ga0207711_1000008558 240
206 3300025981 Ga0207640_10000026 Ga0207640_10000026108 240
207 3300026078 Ga0207702_10022211 Ga0207702_100222113 240
208 3300026078 Ga0207702_10025971 Ga0207702_100259712 240
209 3300026088 Ga0207641_10000071 Ga0207641_10000071153 240
210 3300026121 Ga0207683_10038680 Ga0207683_100386806 240
211 3300026142 Ga0207698_10000009 Ga0207698_10000009214 240
212 3300028381 Ga0268264_10003521 Ga0268264_1000352114 240
213 3300028556 Ga0265337_1006261 Ga0265337_10062616 240
214 3300028558 Ga0265326_10000027 Ga0265326_1000002754 240
215 3300028654 Ga0265322_10000003 Ga0265322_10000003235 240
216 3300029957 Ga0265324_10000103 Ga0265324_1000010320 240
217 3300031239 Ga0265328_10010469 Ga0265328_100104694 240
218 3300031240 Ga0265320_10000001 Ga0265320_10000001235 240
219 3300031242 Ga0265329_10001629 Ga0265329_100016294 240
220 3300031250 Ga0265331_10002979 Ga0265331_100029791 240
221 3300031251 Ga0265327_10000003 Ga0265327_10000003235 240
222 3300031344 Ga0265316_10023411 Ga0265316_100234112 240
223 3300031711 Ga0265314_10001375 Ga0265314_1000137520 240
224 3300046454 Ga0495592_0183159 Ga0495592_0183159_479_1267 240
225 3300046455 Ga0495603_0000291 Ga0495603_0000291_8240_9022 240
226 3300046463 Ga0495653_0071876 Ga0495653_0071876_1642_2430 240
227 3300046463 Ga0495653_0107155 Ga0495653_0107155_1069_1848 240
228 3300046477 Ga0495664_0194423 Ga0495664_0194423_10_786 240
229 3300046511 Ga0495608_0001675 Ga0495608_0001675_9968_10762 240
230 3300046536 Ga0495587_0054477 Ga0495587_0054477_29_841 240
231 3300046681 Ga0495647_0001518 Ga0495647_0001518_3558_4334 240
232 3300046681 Ga0495647_0015756 Ga0495647_0015756_1061_1846 240
233 3300046691 Ga0495670_0026482 Ga0495670_0026482_1309_2160 240
234 3300047322 Ga0495680_0015114 Ga0495680_0015114_756_1544 240
235 3300048905 Ga0496102_0000139 Ga0496102_0000139_19342_20118 240
236 3300048906 Ga0496103_0000001 Ga0496103_0000001_144958_145734 240
237 3300048913 Ga0496110_0000004 Ga0496110_0000004_77235_78020 240
238 3300048914 Ga0496111_0000002 Ga0496111_0000002_115651_116436 240
239 3300048917 Ga0496114_0096332 Ga0496114_0096332_1010_1786 240
240 3300048918 Ga0496115_0000005 Ga0496115_0000005_287523_288299 240
241 3300050515 nmdc:mga0a205_12_c2 nmdc:mga0a205_12_c2_31430_32209 240
242 3300053083 Ga0495655_0000007 Ga0495655_0000007_56308_57084 240
243 3300053083 Ga0495655_0000970 Ga0495655_0000970_1585_2373 240
244 3300053084 Ga0495595_0000069 Ga0495595_0000069_25647_26435 240
245 3300053129 Ga0500628_000003 Ga0500628_000003_116384_117160 240
246 3300005336 Ga0070680_100063191 Ga0070680_1000631912 241
247 3300005337 Ga0070682_100000057 Ga0070682_10000005750 241
248 3300005347 Ga0070668_100021473 Ga0070668_1000214733 241
249 3300005356 Ga0070674_100023861 Ga0070674_1000238613 241
250 3300005364 Ga0070673_100062059 Ga0070673_1000620593 241
251 3300005438 Ga0070701_10044345 Ga0070701_100443452 241
252 3300005458 Ga0070681_10003375 Ga0070681_100033755 241
253 3300005530 Ga0070679_100000342 Ga0070679_10000034239 241
254 3300005539 Ga0068853_100010810 Ga0068853_1000108105 241
255 3300005618 Ga0068864_100000262 Ga0068864_10000026216 241
256 3300005719 Ga0068861_100183345 Ga0068861_1001833452 241
257 3300005843 Ga0068860_100224887 Ga0068860_1002248872 241
258 3300005937 Ga0081455_10232850 Ga0081455_102328502 241
259 3300005983 Ga0081540_1062711 Ga0081540_10627113 241
260 3300005985 Ga0081539_10001602 Ga0081539_100016022 241
261 3300006358 Ga0068871_100186873 Ga0068871_1001868732 241
262 3300009098 Ga0105245_10001267 Ga0105245_1000126718 241
263 3300013105 Ga0157369_10000128 Ga0157369_1000012858 241
264 3300013296 Ga0157374_10010028 Ga0157374_100100289 241
265 3300013296 Ga0157374_10027538 Ga0157374_100275383 241
266 3300013297 Ga0157378_10074028 Ga0157378_100740283 241
267 3300014968 Ga0157379_10218254 Ga0157379_102182542 241
268 3300025912 Ga0207707_10021445 Ga0207707_100214454 241
269 3300025917 Ga0207660_10043074 Ga0207660_100430743 241
270 3300025921 Ga0207652_10000351 Ga0207652_1000035137 241
271 3300025927 Ga0207687_10000012 Ga0207687_10000012118 241
272 3300025927 Ga0207687_10000042 Ga0207687_1000004287 241
273 3300025927 Ga0207687_10000613 Ga0207687_1000061311 241
274 3300025931 Ga0207644_10062240 Ga0207644_100622402 241
275 3300025934 Ga0207686_10004598 Ga0207686_100045986 241
276 3300025934 Ga0207686_10037675 Ga0207686_100376753 241
277 3300025935 Ga0207709_10051350 Ga0207709_100513503 241
278 3300025936 Ga0207670_10182725 Ga0207670_101827251 241
279 3300025960 Ga0207651_10001007 Ga0207651_1000100710 241
280 3300026041 Ga0207639_10017445 Ga0207639_100174456 241
281 3300026095 Ga0207676_10000038 Ga0207676_1000003816 241
282 3300026118 Ga0207675_100126694 Ga0207675_1001266942 241
283 3300028563 Ga0265319_1000548 Ga0265319_10005481 241
284 3300028800 Ga0265338_10000047 Ga0265338_10000047130 241
285 3300036401 Ga0373937_0195038 Ga0373937_0195038_31_810 241
286 3300038443 Ga0395901_0065476 Ga0395901_0065476_723_1505 241
287 3300046459 Ga0495629_0008682 Ga0495629_0008682_3924_4715 241
288 3300046461 Ga0495641_0000012 Ga0495641_0000012_120070_120864 241
289 3300046463 Ga0495653_0067382 Ga0495653_0067382_923_1702 241
290 3300046511 Ga0495608_0099559 Ga0495608_0099559_690_1469 241
291 3300046515 Ga0495620_0000446 Ga0495620_0000446_15271_16059 241
292 3300046516 Ga0495628_0051003 Ga0495628_0051003_26_814 241
293 3300046516 Ga0495628_0053122 Ga0495628_0053122_2361_3146 241
294 3300046516 Ga0495628_0505270 Ga0495628_0505270_67_843 241
295 3300046517 Ga0495630_0000007 Ga0495630_0000007_58295_59077 241
296 3300046517 Ga0495630_0011828 Ga0495630_0011828_3938_4714 241
297 3300046517 Ga0495630_0087146 Ga0495630_0087146_722_1498 241
298 3300046642 Ga0495634_0173984 Ga0495634_0173984_258_1043 241
299 3300046660 Ga0495625_0000319 Ga0495625_0000319_30661_31446 241
300 3300046675 Ga0495657_0090708 Ga0495657_0090708_808_1596 241
301 3300046684 Ga0495669_0000074 Ga0495669_0000074_15324_16115 241
302 3300046809 Ga0495600_0010225 Ga0495600_0010225_4177_4959 241
303 3300047317 Ga0495604_0000084 Ga0495604_0000084_55749_56537 241
304 3300047321 Ga0495676_0014161 Ga0495676_0014161_101_877 241
305 3300047322 Ga0495680_0000255 Ga0495680_0000255_45266_46054 241
306 3300047322 Ga0495680_0001247 Ga0495680_0001247_641_1429 241
307 3300048903 Ga0496100_0000008 Ga0496100_0000008_217655_218431 241
308 3300048903 Ga0496100_0000016 Ga0496100_0000016_142463_143254 241
309 3300048904 Ga0496101_0000016 Ga0496101_0000016_226437_227213 241
310 3300048904 Ga0496101_0000038 Ga0496101_0000038_22805_23596 241
311 3300048905 Ga0496102_0039225 Ga0496102_0039225_33_809 241
312 3300048907 Ga0496104_0020392 Ga0496104_0020392_5112_5897 241
313 3300048909 Ga0496106_0000013 Ga0496106_0000013_50925_51713 241
314 3300048909 Ga0496106_0000027 Ga0496106_0000027_6319_7110 241
315 3300048909 Ga0496106_0000117 Ga0496106_0000117_13516_14292 241
316 3300048910 Ga0496107_0000003 Ga0496107_0000003_160785_161576 241
317 3300048910 Ga0496107_0000009 Ga0496107_0000009_217369_218145 241
318 3300048911 Ga0496108_0010893 Ga0496108_0010893_108_893 241
319 3300048912 Ga0496109_0125282 Ga0496109_0125282_88_873 241
320 3300048913 Ga0496110_0017387 Ga0496110_0017387_2200_2988 241
321 3300048914 Ga0496111_0128461 Ga0496111_0128461_939_1724 241
322 3300048916 Ga0496113_0004020 Ga0496113_0004020_1071_1856 241
323 3300048916 Ga0496113_0248360 Ga0496113_0248360_285_1085 241
324 3300053077 Ga0495601_0000080 Ga0495601_0000080_26160_26948 241
325 3300053077 Ga0495601_0020657 Ga0495601_0020657_2741_3517 241
326 3300053077 Ga0495601_0111687 Ga0495601_0111687_78_854 241
327 3300053078 Ga0495612_0008591 Ga0495612_0008591_590_1366 241
328 3300053084 Ga0495595_0052663 Ga0495595_0052663_162_941 241
329 3300053085 Ga0495619_0002211 Ga0495619_0002211_414_1199 241
330 3300053085 Ga0495619_0015759 Ga0495619_0015759_1615_2394 241
331 3300053094 Ga0500566_0002540 Ga0500566_0002540_690_1481 241
332 3300053123 Ga0500614_003156 Ga0500614_003156_452_1246 241
333 3300002074 JGI24748J21848_1001440 JGI24748J21848_10014402 242
334 3300002239 JGI24034J26672_10000567 JGI24034J26672_100005675 242
335 3300005329 Ga0070683_100065971 Ga0070683_1000659713 242
336 3300005329 Ga0070683_100103824 Ga0070683_1001038242 242
337 3300005333 Ga0070677_10000030 Ga0070677_100000304 242
338 3300005338 Ga0068868_100047588 Ga0068868_1000475884 242
339 3300005338 Ga0068868_100269549 Ga0068868_1002695492 242
340 3300005344 Ga0070661_100000031 Ga0070661_10000003190 242
341 3300005347 Ga0070668_100030816 Ga0070668_1000308162 242
342 3300005354 Ga0070675_100000073 Ga0070675_10000007358 242
343 3300005365 Ga0070688_100000506 Ga0070688_10000050612 242
344 3300005365 Ga0070688_100000848 Ga0070688_1000008488 242
345 3300005367 Ga0070667_100055937 Ga0070667_1000559372 242
346 3300005435 Ga0070714_100120443 Ga0070714_1001204433 242
347 3300005441 Ga0070700_100015791 Ga0070700_1000157915 242
348 3300005457 Ga0070662_100000005 Ga0070662_100000005136 242
349 3300005466 Ga0070685_10000932 Ga0070685_1000093211 242
350 3300005466 Ga0070685_10002367 Ga0070685_100023679 242
351 3300005535 Ga0070684_100058588 Ga0070684_1000585883 242
352 3300005547 Ga0070693_100000815 Ga0070693_1000008156 242
353 3300005548 Ga0070665_100005655 Ga0070665_10000565510 242
354 3300005548 Ga0070665_100051337 Ga0070665_1000513372 242
355 3300005548 Ga0070665_100206134 Ga0070665_1002061342 242
356 3300005563 Ga0068855_100217765 Ga0068855_1002177653 242
357 3300005564 Ga0070664_100032745 Ga0070664_1000327454 242
358 3300005577 Ga0068857_100086637 Ga0068857_1000866373 242
359 3300005578 Ga0068854_100044691 Ga0068854_1000446913 242
360 3300005614 Ga0068856_100011606 Ga0068856_1000116063 242
361 3300005616 Ga0068852_100213667 Ga0068852_1002136672 242
362 3300005834 Ga0068851_10021394 Ga0068851_100213942 242
363 3300006038 Ga0075365_10202300 Ga0075365_102023002 242
364 3300006038 Ga0075365_10215812 Ga0075365_102158122 242
365 3300006051 Ga0075364_10040728 Ga0075364_100407285 242
366 3300006846 Ga0075430_100113990 Ga0075430_1001139902 242
367 3300006847 Ga0075431_100013519 Ga0075431_1000135196 242
368 3300006881 Ga0068865_100000001 Ga0068865_10000000145 242
369 3300009094 Ga0111539_10243271 Ga0111539_102432712 242
370 3300009147 Ga0114129_10239477 Ga0114129_102394772 242
371 3300009148 Ga0105243_10041345 Ga0105243_100413453 242
372 3300009148 Ga0105243_10174056 Ga0105243_101740562 242
373 3300009553 Ga0105249_10000192 Ga0105249_1000019212 242
374 3300012507 Ga0157342_1014853 Ga0157342_10148531 242
375 3300014325 Ga0163163_10376506 Ga0163163_103765062 242
376 3300014326 Ga0157380_10000373 Ga0157380_100003739 242
377 3300025321 Ga0207656_10012500 Ga0207656_100125002 242
378 3300025893 Ga0207682_10000003 Ga0207682_1000000378 242
379 3300025920 Ga0207649_10000021 Ga0207649_10000021179 242
380 3300025926 Ga0207659_10000082 Ga0207659_1000008258 242
381 3300025935 Ga0207709_10022401 Ga0207709_100224014 242
382 3300025935 Ga0207709_10137193 Ga0207709_101371932 242
383 3300025938 Ga0207704_10000012 Ga0207704_10000012117 242
384 3300025944 Ga0207661_10026767 Ga0207661_100267673 242
385 3300025944 Ga0207661_10066564 Ga0207661_100665642 242
386 3300025945 Ga0207679_10018749 Ga0207679_100187495 242
387 3300025949 Ga0207667_10145184 Ga0207667_101451842 242
388 3300025961 Ga0207712_10000003 Ga0207712_10000003347 242
389 3300025972 Ga0207668_10075892 Ga0207668_100758922 242
390 3300025981 Ga0207640_10007305 Ga0207640_100073053 242
391 3300026023 Ga0207677_10000902 Ga0207677_1000090220 242
392 3300026023 Ga0207677_10179848 Ga0207677_101798482 242
393 3300026075 Ga0207708_10039590 Ga0207708_100395902 242
394 3300026078 Ga0207702_10000316 Ga0207702_1000031665 242
395 3300026089 Ga0207648_10001595 Ga0207648_1000159514 242
396 3300026089 Ga0207648_10035542 Ga0207648_100355422 242
397 3300026142 Ga0207698_10150520 Ga0207698_101505203 242
398 3300028379 Ga0268266_10011667 Ga0268266_100116674 242
399 3300028379 Ga0268266_10034171 Ga0268266_100341714 242
400 3300028379 Ga0268266_10078323 Ga0268266_100783233 242
401 3300031727 Ga0316576_10002289 Ga0316576_100022896 242
402 3300035398 Ga0316574_0013026 Ga0316574_0013026_3639_4433 242
403 3300036401 Ga0373937_0006840 Ga0373937_0006840_7076_7864 242
404 3300036712 Ga0316584_0009370 Ga0316584_0009370_3314_4108 242
405 3300041512 Ga0451853_2266777 Ga0451853_2266777_620_1408 242
406 3300044694 Ga0466963_0022205 Ga0466963_0022205_2371_3162 242
407 3300044694 Ga0466963_0080948 Ga0466963_0080948_1194_1970 242
408 3300045976 Ga0466967_0045840 Ga0466967_0045840_739_1527 242
409 3300046461 Ga0495641_0018220 Ga0495641_0018220_376_1152 242
410 3300046473 Ga0495582_0000007 Ga0495582_0000007_43127_43915 242
411 3300046514 Ga0495618_0000003 Ga0495618_0000003_83860_84711 242
412 3300046516 Ga0495628_0002265 Ga0495628_0002265_6054_6830 242
413 3300046516 Ga0495628_0009797 Ga0495628_0009797_1669_2457 242
414 3300046517 Ga0495630_0005868 Ga0495630_0005868_3995_4786 242
415 3300046517 Ga0495630_0036118 Ga0495630_0036118_38_826 242
416 3300046533 Ga0495640_0081934 Ga0495640_0081934_1324_2112 242
417 3300046536 Ga0495587_0053463 Ga0495587_0053463_657_1433 242
418 3300046615 Ga0495656_0003197 Ga0495656_0003197_1271_2053 242
419 3300046642 Ga0495634_0009750 Ga0495634_0009750_5201_5986 242
420 3300046663 Ga0495635_0000009 Ga0495635_0000009_160567_161388 242
421 3300046663 Ga0495635_0005067 Ga0495635_0005067_7811_8596 242
422 3300046674 Ga0495588_0000241 Ga0495588_0000241_31140_31928 242
423 3300046683 Ga0495658_0000007 Ga0495658_0000007_43121_43909 242
424 3300046684 Ga0495669_0015907 Ga0495669_0015907_264_1040 242
425 3300046689 Ga0495613_0000522 Ga0495613_0000522_15178_15963 242
426 3300046689 Ga0495613_0216634 Ga0495613_0216634_94_882 242
427 3300046690 Ga0495624_0000256 Ga0495624_0000256_16972_17757 242
428 3300046809 Ga0495600_0105048 Ga0495600_0105048_56_907 242
429 3300047317 Ga0495604_0019113 Ga0495604_0019113_1996_2781 242
430 3300047319 Ga0495674_0000027 Ga0495674_0000027_89879_90655 242
431 3300047321 Ga0495676_0023243 Ga0495676_0023243_71_847 242
432 3300047472 Ga0495686_0230407 Ga0495686_0230407_39_815 242
433 3300048088 Ga0495602_0000008 Ga0495602_0000008_35131_35916 242
434 3300048088 Ga0495602_0006000 Ga0495602_0006000_4520_5296 242
435 3300048905 Ga0496102_0237235 Ga0496102_0237235_507_1319 242
436 3300048907 Ga0496104_0000007 Ga0496104_0000007_322256_323035 242
437 3300048908 Ga0496105_0000002 Ga0496105_0000002_525195_525974 242
438 3300048909 Ga0496106_0447390 Ga0496106_0447390_196_1008 242
439 3300048910 Ga0496107_0270395 Ga0496107_0270395_390_1202 242
440 3300048911 Ga0496108_0000221 Ga0496108_0000221_5054_5830 242
441 3300048912 Ga0496109_0000195 Ga0496109_0000195_11872_12648 242
442 3300048912 Ga0496109_0631908 Ga0496109_0631908_10_795 242
443 3300048913 Ga0496110_0008159 Ga0496110_0008159_2174_2959 242
444 3300048913 Ga0496110_0496278 Ga0496110_0496278_245_1021 242
445 3300048914 Ga0496111_0010397 Ga0496111_0010397_2138_2923 242
446 3300048915 Ga0496112_0159145 Ga0496112_0159145_502_1278 242
447 3300049569 Ga0501032_0096105 Ga0501032_0096105_926_1708 242
448 3300049578 Ga0501042_0047581 Ga0501042_0047581_1879_2664 242
449 3300049582 Ga0501048_0293553 Ga0501048_0293553_120_902 242
450 3300049585 Ga0501069_0021194 Ga0501069_0021194_1606_2382 242
451 3300049586 Ga0501070_0112623 Ga0501070_0112623_1243_2019 242
452 3300049586 Ga0501070_0334955 Ga0501070_0334955_230_1012 242
453 3300049588 Ga0501072_0214015 Ga0501072_0214015_742_1518 242
454 3300049591 Ga0501075_0021437 Ga0501075_0021437_1527_2315 242
455 3300049742 Ga0501080_0134315 Ga0501080_0134315_229_1011 242
456 3300049742 Ga0501080_0611446 Ga0501080_0611446_148_945 242
457 3300050491 nmdc:mga00v17_99281_c1 nmdc:mga00v17_99281_c1_650_1444 242
458 3300050507 nmdc:mga05p37_206880_c1 nmdc:mga05p37_206880_c1_937_1749 242
459 3300050509 nmdc:mga0qj67_75572_c1 nmdc:mga0qj67_75572_c1_1400_2203 242
460 3300050511 nmdc:mga08y16_368018_c1 nmdc:mga08y16_368018_c1_366_1154 242
461 3300050512 nmdc:mga0n895_277979_c1 nmdc:mga0n895_277979_c1_486_1298 242
462 3300050513 nmdc:mga0rr50_170004_c1 nmdc:mga0rr50_170004_c1_401_1213 242
463 3300053077 Ga0495601_0000098 Ga0495601_0000098_38439_39224 242
464 3300053078 Ga0495612_0000358 Ga0495612_0000358_9680_10459 242
465 3300053084 Ga0495595_0014790 Ga0495595_0014790_1070_1855 242
466 3300053085 Ga0495619_0000785 Ga0495619_0000785_19211_19996 242
467 3300053085 Ga0495619_0109701 Ga0495619_0109701_917_1696 242
468 3300060353 Ga0501082_0669902 Ga0501082_0669902_55_843 242
469 3300061734 Ga0530510_0138761 Ga0530510_0138761_310_1107 242

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.7614 2 224
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.7464 3 224
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.7244 2 223
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.7243 2 239
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.7111 2 239
ID Description Score Start End Superfamily
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.802 16 241 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7887 1 238 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7742 1 238 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7516 16 241 3.20.20.30
1ezwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7465 3 224 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A7V9HSL8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9634 104 242 GO:0016705
AF-A0A7J9YZH5-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9546 2 242 GO:0016705
AF-A0A838UWV7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9492 2 242 GO:0016705
AF-A0A7J9YZH5-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9468 2 242 GO:0016705
AF-A0A838UWV7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9415 2 242 GO:0016705

Feature Viewer

pLDDT pTM Quality
90.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map