F450313

General Info

Members Datasets Scaffolds Average Seq Length
469 235 938 213

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0001748|Ga0496125_0001748_21130_21900
Length 256
Sequence MFIPELCRCHPTPMITALRALFIDPERANSPARSLQGRVKKDQRMTAFHDILFPLDISMRSSGGPERRTEIVSFGSGREQRNARWAQSRRRYDAGYGIKTLEALQAVVAFFEERRGRLHGFRWRDRLDHASAAPGHAVSPDDQGIGIGDGATASFQLVKIYGSGFAPYAREIAKPVAGSVRVAVGGVEADAAAFSCDAATGLVTFAGGHIPGAGQAITAGFMFDVPVRFDADYLEVDLSAFAAGAIPKIPLVEVRP

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
207 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
229 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
230 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
231 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
232 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
233 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
234 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
235 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.32
Nodule 0
Rhizoplane 1.71
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0001748 3300048928 Bacteria 30160
2 2214656042 2209111006 Bacteria 4881
3 ARcpr5oldR_c000502 3300000041 Bacteria 4969
4 ARSoilYngRDRAFT_c00683 3300000042 Bacteria 3238
5 ARcpr5yngRDRAFT_c000348 3300000043 Bacteria 6161
6 ARSoilOldRDRAFT_c000031 3300000044 Bacteria 31209
7 ARCol0yngRDRAFT_1000148 3300000652 Bacteria 12495
8 JGI25406J46586_10000283 3300003203 Bacteria 22726
9 Ga0065716_1003522 3300005277 Bacteria 1197
10 Ga0065712_10001175 3300005290 Bacteria 8151
11 Ga0065715_10001020 3300005293 Bacteria 7864
12 Ga0070658_10339190 3300005327 Bacteria 1285
13 Ga0070690_100061769 3300005330 Bacteria 2415
14 Ga0070666_10170045 3300005335 Bacteria 1526
15 Ga0070680_100035488 3300005336 Bacteria 4026
16 Ga0070680_100045311 3300005336 Bacteria 3575
17 Ga0070680_100093161 3300005336 Bacteria 2496
18 Ga0070660_100065067 3300005339 Bacteria 2837
19 Ga0070689_100196815 3300005340 Bacteria 1643
20 Ga0070691_10023543 3300005341 Bacteria 2861
21 Ga0070674_100205157 3300005356 Bacteria 1525
22 Ga0070673_100168208 3300005364 Bacteria 1870
23 Ga0070688_100006849 3300005365 Bacteria 6115
24 Ga0070659_100113196 3300005366 Bacteria 2192
25 Ga0070667_100052360 3300005367 Bacteria 3445
26 Ga0070701_10308181 3300005438 Bacteria 976
27 Ga0070711_100058239 3300005439 Bacteria 2678
28 Ga0070705_100083106 3300005440 Bacteria 1972
29 Ga0070700_100063480 3300005441 Bacteria 2337
30 Ga0070663_100022185 3300005455 Bacteria 4240
31 Ga0070662_100013418 3300005457 Bacteria 5452
32 Ga0070681_10341989 3300005458 Bacteria 1406
33 Ga0070685_10025238 3300005466 Bacteria 3271
34 Ga0070685_10200142 3300005466 Bacteria 1298
35 Ga0070679_100345666 3300005530 Bacteria 1435
36 Ga0068853_100171855 3300005539 Bacteria 1961
37 Ga0070695_100100459 3300005545 Bacteria 1947
38 Ga0070696_100027138 3300005546 Bacteria 3898
39 Ga0070704_100037747 3300005549 Bacteria 3304
40 Ga0068854_100331407 3300005578 Bacteria 1240
41 Ga0068859_100012302 3300005617 Bacteria 8610
42 Ga0068858_100151668 3300005842 Bacteria 2179
43 Ga0068858_100553647 3300005842 Bacteria 1113
44 Ga0068862_100033782 3300005844 Bacteria 4326
45 Ga0081455_10051294 3300005937 Unclassified 3539
46 Ga0081539_10000051 3300005985 Bacteria 268337
47 Ga0070717_10956273 3300006028 Bacteria 780
48 Ga0075368_10039850 3300006042 Bacteria 1843
49 Ga0075363_100024756 3300006048 Bacteria 3054
50 Ga0075364_10030156 3300006051 Bacteria 3480
51 Ga0070712_100736239 3300006175 Bacteria 843
52 Ga0075369_10024421 3300006186 Bacteria 2504
53 Ga0075427_10032697 3300006194 Bacteria 858
54 Ga0075366_10018347 3300006195 Bacteria 4038
55 Ga0075370_10010869 3300006353 Bacteria 4771
56 Ga0075428_100033202 3300006844 Bacteria 5699
57 Ga0075430_100000235 3300006846 Bacteria 38221
58 Ga0075431_100034657 3300006847 Bacteria 5200
59 Ga0075433_10000016 3300006852 Bacteria 67444
60 Ga0075434_100001218 3300006871 Bacteria 21378
61 Ga0075434_100518476 3300006871 Bacteria 1212
62 Ga0075429_100016309 3300006880 Bacteria 6440
63 Ga0097620_100012302 3300006931 Bacteria 8610
64 Ga0075435_100157999 3300007076 Viruses 1908
65 Ga0105240_11047740 3300009093 Bacteria 870
66 Ga0111539_10001853 3300009094 Bacteria 28094
67 Ga0111539_10001856 3300009094 Bacteria 28053
68 Ga0111539_10273797 3300009094 Bacteria 1965
69 Ga0105245_10638438 3300009098 Bacteria 1094
70 Ga0114129_10071090 3300009147 Bacteria 4852
71 Ga0105237_10015452 3300009545 Bacteria 7945
72 Ga0105239_10072292 3300010375 Bacteria 3791
73 Ga0105246_10044565 3300011119 Bacteria 3015
74 Ga0157339_1003451 3300012505 Bacteria 1142
75 Ga0157373_10398688 3300013100 Bacteria 986
76 Ga0157371_10033891 3300013102 Bacteria 3666
77 Ga0157370_10108718 3300013104 Bacteria 2592
78 Ga0157370_10714641 3300013104 Bacteria 914
79 Ga0157369_10761554 3300013105 Bacteria 996
80 Ga0157378_10314465 3300013297 Bacteria 1520
81 Ga0157378_10384266 3300013297 Bacteria 1379
82 Ga0163162_10023387 3300013306 Bacteria 6099
83 Ga0163162_11461882 3300013306 Bacteria 778
84 Ga0157372_10209537 3300013307 Bacteria 2258
85 Ga0157375_10019292 3300013308 Bacteria 6200
86 Ga0163163_10562066 3300014325 Bacteria 1203
87 Ga0157379_10367469 3300014968 Bacteria 1319
88 Ga0207666_1002112 3300025271 Bacteria 2382
89 Ga0209564_1001227 3300025295 Bacteria 28939
90 Ga0207688_10371439 3300025901 Bacteria 884
91 Ga0207680_10425599 3300025903 Bacteria 940
92 Ga0207705_10014918 3300025909 Bacteria 5588
93 Ga0207705_10307142 3300025909 Bacteria 1217
94 Ga0207707_10286790 3300025912 Bacteria 1425
95 Ga0207671_10211910 3300025914 Bacteria 1516
96 Ga0207660_10040557 3300025917 Bacteria 3260
97 Ga0207660_10265944 3300025917 Bacteria 1357
98 Ga0207660_10648415 3300025917 Bacteria 861
99 Ga0207662_10049172 3300025918 Bacteria 2501
100 Ga0207657_10012483 3300025919 Bacteria 8385
101 Ga0207652_10071333 3300025921 Bacteria 3018
102 Ga0207652_10197845 3300025921 Bacteria 1809
103 Ga0207652_10629637 3300025921 Bacteria 960
104 Ga0207681_10936960 3300025923 Bacteria 726
105 Ga0207659_10080614 3300025926 Bacteria 2405
106 Ga0207690_10041308 3300025932 Bacteria 3021
107 Ga0207690_10108675 3300025932 Bacteria 1994
108 Ga0207706_10009111 3300025933 Bacteria 9127
109 Ga0207670_10446323 3300025936 Bacteria 1042
110 Ga0207712_10079471 3300025961 Bacteria 2383
111 Ga0207703_10192633 3300026035 Bacteria 1807
112 Ga0207708_10015064 3300026075 Bacteria 5796
113 Ga0207641_10463181 3300026088 Bacteria 1227
114 Ga0209982_1009697 3300027552 Bacteria 1425
115 Ga0209998_10000522 3300027717 Bacteria 10470
116 Ga0209974_10077396 3300027876 Bacteria 1140
117 Ga0207428_10000175 3300027907 Bacteria 89715
118 Ga0207428_10000678 3300027907 Bacteria 39859
119 Ga0268264_10173789 3300028381 Viruses 1951
120 Ga0265330_10033857 3300031235 Bacteria 2283
121 Ga0265330_10200054 3300031235 Bacteria 845
122 Ga0265340_10039623 3300031247 Bacteria 2323
123 Ga0265316_10115616 3300031344 Bacteria 2028
124 Ga0265313_10026988 3300031595 Bacteria 3013
125 Ga0265313_10058903 3300031595 Bacteria 1808
126 Ga0316575_10113953 3300031665 Bacteria 1104
127 Ga0265314_10025913 3300031711 Bacteria 4415
128 Ga0265314_10026736 3300031711 Bacteria 4332
129 Ga0265342_10017639 3300031712 Bacteria 4639
130 Ga0265342_10028719 3300031712 Bacteria 3461
131 Ga0265342_10249904 3300031712 Bacteria 947
132 Ga0373930_0001151 3300034816 Bacteria 3861
133 Ga0373948_0000399 3300034817 Bacteria 5349
134 Ga0373950_0002795 3300034818 Bacteria 2441
135 Ga0373959_0003415 3300034820 Bacteria 2527
136 Ga0373938_0000326 3300034957 Bacteria 7580
137 Ga0373928_0000993 3300035084 Bacteria 5572
138 Ga0373929_0001032 3300035085 Bacteria 5399
139 Ga0373940_0000016 3300035088 Bacteria 20620
140 Ga0373949_0002178 3300035090 Bacteria 5136
141 Ga0373951_0000398 3300035091 Bacteria 12859
142 Ga0373952_0000317 3300035092 Bacteria 8102
143 Ga0373932_0000531 3300035112 Bacteria 11704
144 Ga0373939_0004388 3300035114 Bacteria 3332
145 Ga0373939_0041713 3300035114 Bacteria 1384
146 Ga0373941_0004335 3300035115 Bacteria 3269
147 Ga0373961_0001592 3300035241 Bacteria 6456
148 Ga0373961_0003540 3300035241 Bacteria 3847
149 Ga0373962_0000418 3300035242 Bacteria 9314
150 Ga0373931_0016777 3300035691 Bacteria 3610
151 Ga0316584_0245286 3300036712 Bacteria 1310
152 Ga0395899_0148139 3300037312 Bacteria 1665
153 Ga0395899_0425440 3300037312 Bacteria 874
154 Ga0395900_0043808 3300037418 Bacteria 4612
155 Ga0395900_0248810 3300037418 Bacteria 1780
156 Ga0395900_0303423 3300037418 Bacteria 1582
157 Ga0395898_0110759 3300037466 Bacteria 2631
158 Ga0395901_0010927 3300038443 Bacteria 9199
159 Ga0395901_0079313 3300038443 Bacteria 3428
160 Ga0395901_0190825 3300038443 Bacteria 2149
161 Ga0395901_0256253 3300038443 Bacteria 1822
162 Ga0400483_264117 3300039062 Bacteria 5050
163 Ga0439455_0028196 3300042012 Bacteria 1381
164 Ga0439463_035163 3300042016 Bacteria 1268
165 Ga0439460_0034982 3300042461 Bacteria 1451
166 Ga0495638_0041615 3300046460 Bacteria 2905
167 Ga0495638_0041646 3300046460 Bacteria 2904
168 Ga0495606_0014419 3300046507 Bacteria 6170
169 Ga0495610_0033653 3300046512 Bacteria 2647
170 Ga0495648_0134205 3300046524 Bacteria 1312
171 Ga0495654_0034410 3300046530 Bacteria 2556
172 Ga0495622_0118558 3300046557 Bacteria 1209
173 Ga0495668_0211371 3300046616 Bacteria 1062
174 Ga0495588_0201204 3300046674 Bacteria 1052
175 Ga0495670_0020045 3300046691 Bacteria 3295
176 Ga0495626_0049966 3300048091 Bacteria 1934
177 Ga0496107_0428665 3300048910 Bacteria 983
178 Ga0496108_0377946 3300048911 Bacteria 1237
179 Ga0496110_0542873 3300048913 Bacteria 1057
180 Ga0496111_0198168 3300048914 Bacteria 1493
181 Ga0496112_0000004 3300048915 Bacteria 553294
182 Ga0496112_0060765 3300048915 Bacteria 3724
183 Ga0496113_0258635 3300048916 Bacteria 1391
184 Ga0496113_0847129 3300048916 Bacteria 725
185 Ga0496116_0005365 3300048919 Bacteria 11931
186 Ga0496117_0022880 3300048920 Bacteria 5004
187 Ga0496117_0077565 3300048920 Bacteria 2198
188 Ga0496117_0180237 3300048920 Bacteria 1215
189 Ga0496118_0081467 3300048921 Bacteria 2272
190 Ga0496121_0040619 3300048924 Bacteria 4078
191 Ga0496121_0097810 3300048924 Bacteria 2273
192 Ga0496121_0114268 3300048924 Bacteria 2052
193 Ga0496121_0300367 3300048924 Bacteria 1090
194 Ga0496122_0023705 3300048925 Bacteria 5396
195 Ga0496122_0082694 3300048925 Bacteria 2229
196 Ga0496123_0019373 3300048926 Bacteria 5365
197 Ga0496123_0068018 3300048926 Bacteria 2246
198 Ga0496123_0143172 3300048926 Bacteria 1303
199 Ga0496125_0000040 3300048928 Bacteria 314478
200 Ga0496125_0053974 3300048928 Bacteria 3289
201 Ga0496126_0093285 3300048929 Bacteria 2643
202 Ga0496126_0141754 3300048929 Bacteria 2068
203 Ga0496126_0497892 3300048929 Bacteria 974
204 Ga0501031_0003427 3300049568 Bacteria 10174
205 Ga0501031_0004533 3300049568 Bacteria 9003
206 Ga0501031_0010485 3300049568 Bacteria 6037
207 Ga0501031_0037543 3300049568 Bacteria 3161
208 Ga0501031_0066181 3300049568 Bacteria 2354
209 Ga0501031_0501212 3300049568 Bacteria 783
210 Ga0501031_0566908 3300049568 Bacteria 731
211 Ga0501032_0006057 3300049569 Bacteria 8916
212 Ga0501032_0019243 3300049569 Bacteria 4777
213 Ga0501032_0031574 3300049569 Bacteria 3632
214 Ga0501032_0031660 3300049569 Bacteria 3626
215 Ga0501032_0043806 3300049569 Bacteria 3030
216 Ga0501032_0047164 3300049569 Bacteria 2910
217 Ga0501032_0131292 3300049569 Bacteria 1653
218 Ga0501032_0141065 3300049569 Bacteria 1586
219 Ga0501032_0194758 3300049569 Bacteria 1324
220 Ga0501032_0202878 3300049569 Bacteria 1294
221 Ga0501032_0238071 3300049569 Bacteria 1183
222 Ga0501032_0285759 3300049569 Bacteria 1067
223 Ga0501033_0001237 3300049570 Bacteria 22932
224 Ga0501033_0010949 3300049570 Bacteria 6951
225 Ga0501033_0026474 3300049570 Bacteria 4364
226 Ga0501033_0032442 3300049570 Bacteria 3923
227 Ga0501033_0068838 3300049570 Bacteria 2602
228 Ga0501033_0103303 3300049570 Bacteria 2078
229 Ga0501033_0109709 3300049570 Bacteria 2009
230 Ga0501033_0309808 3300049570 Bacteria 1110
231 Ga0501033_0323930 3300049570 Bacteria 1082
232 Ga0501034_0001325 3300049571 Bacteria 33444
233 Ga0501034_0035620 3300049571 Bacteria 5045
234 Ga0501034_0040759 3300049571 Bacteria 4698
235 Ga0501034_0048460 3300049571 Bacteria 4287
236 Ga0501034_0089862 3300049571 Bacteria 3069
237 Ga0501034_0107181 3300049571 Bacteria 2787
238 Ga0501034_0176503 3300049571 Bacteria 2102
239 Ga0501034_0185314 3300049571 Bacteria 2045
240 Ga0501034_0194618 3300049571 Bacteria 1988
241 Ga0501034_0204618 3300049571 Bacteria 1930
242 Ga0501034_0443835 3300049571 Bacteria 1216
243 Ga0501034_0451374 3300049571 Bacteria 1203
244 Ga0501034_0595558 3300049571 Bacteria 1011
245 Ga0501034_0648768 3300049571 Bacteria 957
246 Ga0501034_0949216 3300049571 Bacteria 746
247 Ga0501036_0004460 3300049572 Bacteria 11316
248 Ga0501036_0005699 3300049572 Bacteria 10101
249 Ga0501036_0023433 3300049572 Bacteria 5201
250 Ga0501036_0026982 3300049572 Bacteria 4854
251 Ga0501036_0080972 3300049572 Bacteria 2744
252 Ga0501036_0109584 3300049572 Bacteria 2333
253 Ga0501036_0172589 3300049572 Bacteria 1821
254 Ga0501036_0433140 3300049572 Bacteria 1096
255 Ga0501037_0000988 3300049573 Bacteria 21083
256 Ga0501037_0001402 3300049573 Bacteria 17666
257 Ga0501037_0046087 3300049573 Bacteria 3198
258 Ga0501037_0064253 3300049573 Bacteria 2675
259 Ga0501037_0167359 3300049573 Bacteria 1564
260 Ga0501037_0207767 3300049573 Bacteria 1382
261 Ga0501037_0223093 3300049573 Bacteria 1325
262 Ga0501037_0282794 3300049573 Bacteria 1155
263 Ga0501037_0422370 3300049573 Bacteria 912
264 Ga0501037_0626359 3300049573 Bacteria 721
265 Ga0501038_0003897 3300049574 Bacteria 13872
266 Ga0501038_0003906 3300049574 Bacteria 13864
267 Ga0501038_0009943 3300049574 Bacteria 8711
268 Ga0501038_0029989 3300049574 Bacteria 4814
269 Ga0501038_0050912 3300049574 Bacteria 3577
270 Ga0501038_0058684 3300049574 Bacteria 3298
271 Ga0501038_0081068 3300049574 Bacteria 2734
272 Ga0501038_0084427 3300049574 Bacteria 2671
273 Ga0501038_0086918 3300049574 Bacteria 2626
274 Ga0501038_0233583 3300049574 Bacteria 1462
275 Ga0501038_0263841 3300049574 Bacteria 1360
276 Ga0501038_0272748 3300049574 Bacteria 1333
277 Ga0501038_0392680 3300049574 Bacteria 1074
278 Ga0501039_0003536 3300049575 Bacteria 11707
279 Ga0501039_0046237 3300049575 Bacteria 3362
280 Ga0501039_0072130 3300049575 Bacteria 2684
281 Ga0501039_0092556 3300049575 Bacteria 2356
282 Ga0501039_0138720 3300049575 Bacteria 1910
283 Ga0501039_0140717 3300049575 Bacteria 1895
284 Ga0501039_0150204 3300049575 Bacteria 1830
285 Ga0501039_0197889 3300049575 Bacteria 1580
286 Ga0501040_0049428 3300049576 Bacteria 2875
287 Ga0501040_0261290 3300049576 Bacteria 1235
288 Ga0501042_0006124 3300049578 Bacteria 7794
289 Ga0501042_0063076 3300049578 Bacteria 2648
290 Ga0501043_0001351 3300049579 Bacteria 21483
291 Ga0501043_0004164 3300049579 Bacteria 11820
292 Ga0501043_0008281 3300049579 Bacteria 8187
293 Ga0501043_0015017 3300049579 Bacteria 6064
294 Ga0501043_0046071 3300049579 Bacteria 3428
295 Ga0501043_0052154 3300049579 Bacteria 3214
296 Ga0501043_0103624 3300049579 Bacteria 2235
297 Ga0501043_0120521 3300049579 Bacteria 2057
298 Ga0501043_0169187 3300049579 Bacteria 1705
299 Ga0501043_0202397 3300049579 Bacteria 1541
300 Ga0501043_0325411 3300049579 Bacteria 1171
301 Ga0501046_0001731 3300049580 Bacteria 20832
302 Ga0501046_0018960 3300049580 Bacteria 5712
303 Ga0501046_0044900 3300049580 Bacteria 3512
304 Ga0501047_0000412 3300049581 Bacteria 47833
305 Ga0501047_0011604 3300049581 Bacteria 8339
306 Ga0501047_0036493 3300049581 Bacteria 4750
307 Ga0501047_0038497 3300049581 Bacteria 4627
308 Ga0501047_0040366 3300049581 Bacteria 4513
309 Ga0501047_0157101 3300049581 Bacteria 2147
310 Ga0501047_0202632 3300049581 Bacteria 1845
311 Ga0501047_0309263 3300049581 Bacteria 1421
312 Ga0501047_0409138 3300049581 Bacteria 1189
313 Ga0501047_0421286 3300049581 Bacteria 1166
314 Ga0501048_0002742 3300049582 Bacteria 13429
315 Ga0501048_0009512 3300049582 Bacteria 7294
316 Ga0501048_0037513 3300049582 Bacteria 3480
317 Ga0501048_0038730 3300049582 Bacteria 3421
318 Ga0501048_0186467 3300049582 Bacteria 1470
319 Ga0501067_0026145 3300049583 Bacteria 3234
320 Ga0501067_0173308 3300049583 Bacteria 1202
321 Ga0501068_0013439 3300049584 Bacteria 4658
322 Ga0501068_0077437 3300049584 Bacteria 2036
323 Ga0501068_0220768 3300049584 Bacteria 1205
324 Ga0501068_0228826 3300049584 Bacteria 1182
325 Ga0501068_0289346 3300049584 Bacteria 1048
326 Ga0501069_0006468 3300049585 Bacteria 6127
327 Ga0501069_0199967 3300049585 Bacteria 1158
328 Ga0501069_0236667 3300049585 Bacteria 1064
329 Ga0501070_0004439 3300049586 Bacteria 12052
330 Ga0501070_0077699 3300049586 Bacteria 2747
331 Ga0501070_0083483 3300049586 Bacteria 2644
332 Ga0501070_0097028 3300049586 Bacteria 2438
333 Ga0501070_0122705 3300049586 Bacteria 2147
334 Ga0501070_0125042 3300049586 Bacteria 2125
335 Ga0501070_0258680 3300049586 Bacteria 1423
336 Ga0501070_0321156 3300049586 Bacteria 1259
337 Ga0501070_0390691 3300049586 Bacteria 1126
338 Ga0501070_0435424 3300049586 Bacteria 1058
339 Ga0501070_0513190 3300049586 Bacteria 962
340 Ga0501071_0001855 3300049587 Bacteria 12528
341 Ga0501071_0042212 3300049587 Bacteria 3267
342 Ga0501071_0220262 3300049587 Bacteria 1428
343 Ga0501072_0117455 3300049588 Bacteria 2119
344 Ga0501072_0122778 3300049588 Bacteria 2069
345 Ga0501072_0225209 3300049588 Bacteria 1494
346 Ga0501073_0015758 3300049589 Bacteria 5478
347 Ga0501073_0092371 3300049589 Bacteria 2103
348 Ga0501073_0227507 3300049589 Bacteria 1288
349 Ga0501073_0352851 3300049589 Bacteria 1016
350 Ga0501073_0374909 3300049589 Bacteria 983
351 Ga0501073_0381631 3300049589 Bacteria 973
352 Ga0501074_0003500 3300049590 Bacteria 11145
353 Ga0501074_0042515 3300049590 Bacteria 3288
354 Ga0501074_0415543 3300049590 Bacteria 954
355 Ga0501075_0024240 3300049591 Bacteria 4446
356 Ga0501076_0055766 3300049592 Bacteria 3134
357 Ga0501077_0502757 3300049593 Bacteria 777
358 Ga0501079_0163603 3300049741 Bacteria 1735
359 Ga0501079_0247058 3300049741 Bacteria 1394
360 Ga0501079_0555404 3300049741 Bacteria 903
361 Ga0501080_0006327 3300049742 Bacteria 10626
362 Ga0501080_0068440 3300049742 Bacteria 3302
363 Ga0501080_0094981 3300049742 Bacteria 2769
364 Ga0501080_0095498 3300049742 Bacteria 2760
365 Ga0501080_0125579 3300049742 Bacteria 2376
366 Ga0501080_0177710 3300049742 Bacteria 1960
367 Ga0501080_0220121 3300049742 Bacteria 1737
368 Ga0501081_0088908 3300049743 Bacteria 2170
369 Ga0501081_0646445 3300049743 Bacteria 793
370 Ga0501081_0802874 3300049743 Bacteria 708
371 Ga0501083_0000166 3300049744 Bacteria 43156
372 Ga0501083_0004596 3300049744 Bacteria 9753
373 Ga0501083_0064811 3300049744 Bacteria 2434
374 Ga0501083_0153204 3300049744 Bacteria 1509
375 Ga0501083_0482402 3300049744 Bacteria 807
376 Ga0501035_0002760 3300049822 Bacteria 17025
377 Ga0501035_0002881 3300049822 Bacteria 16596
378 Ga0501035_0029236 3300049822 Bacteria 5025
379 Ga0501035_0035044 3300049822 Bacteria 4558
380 Ga0501035_0047341 3300049822 Bacteria 3860
381 Ga0501035_0090023 3300049822 Bacteria 2701
382 Ga0501035_0094532 3300049822 Bacteria 2628
383 Ga0501035_0131336 3300049822 Bacteria 2183
384 Ga0501035_0143170 3300049822 Bacteria 2077
385 Ga0501035_0158494 3300049822 Bacteria 1960
386 Ga0501035_0323025 3300049822 Bacteria 1296
387 Ga0501035_0389273 3300049822 Bacteria 1161
388 Ga0501035_0470943 3300049822 Bacteria 1037
389 Ga0501035_0484110 3300049822 Bacteria 1020
390 Ga0501044_0000361 3300049823 Bacteria 56979
391 Ga0501044_0001876 3300049823 Bacteria 24349
392 Ga0501044_0007471 3300049823 Bacteria 12021
393 Ga0501044_0019676 3300049823 Bacteria 7215
394 Ga0501044_0019784 3300049823 Bacteria 7192
395 Ga0501044_0026230 3300049823 Bacteria 6170
396 Ga0501044_0029105 3300049823 Bacteria 5825
397 Ga0501044_0084347 3300049823 Bacteria 3211
398 Ga0501044_0084992 3300049823 Bacteria 3197
399 Ga0501044_0094796 3300049823 Bacteria 3008
400 Ga0501044_0114721 3300049823 Bacteria 2699
401 Ga0501044_0147518 3300049823 Bacteria 2336
402 Ga0501044_0176204 3300049823 Bacteria 2107
403 Ga0501044_0198663 3300049823 Bacteria 1964
404 Ga0501044_0359380 3300049823 Bacteria 1374
405 Ga0501044_0412060 3300049823 Bacteria 1262
406 Ga0501044_0438038 3300049823 Bacteria 1215
407 Ga0501044_0465347 3300049823 Bacteria 1169
408 Ga0501044_0601687 3300049823 Bacteria 992
409 Ga0501045_0139532 3300049824 Bacteria 1802
410 Ga0501045_0393440 3300049824 Bacteria 1032
411 nmdc:mga00v17_5379_c1 3300050491 Bacteria 6740
412 nmdc:mga0k408_34434_c1 3300050493 Bacteria 2899
413 nmdc:mga05p37_17534_c1 3300050507 Bacteria 8644
414 nmdc:mga0qj67_3575_c1 3300050509 Bacteria 11218
415 nmdc:mga06r32_7846_c1 3300050510 Bacteria 9590
416 nmdc:mga08y16_103419_c1 3300050511 Bacteria 2966
417 nmdc:mga08y16_1205_c1 3300050511 Bacteria 25551
418 nmdc:mga08y16_397846_c1 3300050511 Bacteria 1410
419 nmdc:mga0n895_446_c1 3300050512 Bacteria 27670
420 nmdc:mga0rr50_90756_c1 3300050513 Bacteria 2378
421 nmdc:mga0a205_112948_c1 3300050515 Bacteria 2616
422 nmdc:mga0a205_155772_c1 3300050515 Bacteria 2183
423 nmdc:mga0sz30_14718_c1 3300050516 Bacteria 3084
424 Ga0500643_040991 3300053087 Bacteria 1362
425 Ga0500644_0026475 3300053088 Bacteria 1795
426 Ga0500581_201033 3300053089 Bacteria 884
427 Ga0500566_0118301 3300053094 Bacteria 1432
428 Ga0500641_0010244 3300053096 Bacteria 3383
429 Ga0500641_0138394 3300053096 Bacteria 1051
430 Ga0500650_0001550 3300053098 Bacteria 7021
431 Ga0500554_070940 3300053102 Bacteria 1134
432 Ga0500556_0000002 3300053104 Bacteria 773626
433 Ga0500562_070132 3300053108 Bacteria 945
434 Ga0500595_000002 3300053119 Bacteria 1074388
435 Ga0500595_040174 3300053119 Bacteria 1510
436 Ga0500608_106575 3300053122 Bacteria 1290
437 Ga0500618_009130 3300053125 Bacteria 2724
438 Ga0500618_009820 3300053125 Bacteria 2598
439 Ga0500642_0000034 3300053130 Bacteria 110440
440 Ga0500652_017488 3300053131 Bacteria 2630
441 Ga0500658_0126920 3300053134 Bacteria 1135
442 Ga0500559_0000275 3300053136 Bacteria 39820
443 Ga0500564_149200 3300053138 Bacteria 998
444 Ga0500568_0000190 3300053139 Bacteria 53492
445 Ga0500586_000336 3300053145 Bacteria 9307
446 Ga0500604_0092487 3300053151 Bacteria 989
447 Ga0500616_0001298 3300053153 Bacteria 24834
448 Ga0500616_0019894 3300053153 Bacteria 3777
449 Ga0500622_0015876 3300053156 Bacteria 4031
450 Ga0500622_0205646 3300053156 Bacteria 892
451 Ga0500634_0107926 3300053161 Bacteria 1380
452 Ga0500645_068333 3300053730 Bacteria 1022
453 Ga0501084_0007902 3300054114 Bacteria 8756
454 Ga0501084_0359486 3300054114 Bacteria 1230
455 Ga0501082_0011345 3300060353 Bacteria 7661
456 Ga0501082_0103779 3300060353 Bacteria 2459
457 Ga0501082_0161722 3300060353 Bacteria 1946
458 Ga0501082_0346355 3300060353 Bacteria 1295
459 Ga0501082_0375442 3300060353 Bacteria 1240
460 Ga0501082_0652938 3300060353 Bacteria 920
461 Ga0530510_0097036 3300061734 Bacteria 2154
462 2643757068 2643221547 Bacteria 4740017
463 2828306980 2828305725 Bacteria 4916900
464 2899278771 2899275550 Bacteria 3958688
465 2919075831 2919073203 Bacteria 6531949
466 2919452922 2919450847 Bacteria 5631160
467 8001850745 8001845381 Bacteria 5804942
468 8002063056 8002060224 Bacteria 4026565
469 8057135534 8057132660 Bacteria 4061191
470 Ga0496125_0001748
471 2214656042
472 ARcpr5oldR_c000502
473 ARSoilYngRDRAFT_c00683
474 ARcpr5yngRDRAFT_c000348
475 ARSoilOldRDRAFT_c000031
476 ARCol0yngRDRAFT_1000148
477 JGI25406J46586_10000283
478 Ga0065716_1003522
479 Ga0065712_10001175
480 Ga0065715_10001020
481 Ga0070658_10339190
482 Ga0070690_100061769
483 Ga0070666_10170045
484 Ga0070680_100035488
485 Ga0070680_100045311
486 Ga0070680_100093161
487 Ga0070660_100065067
488 Ga0070689_100196815
489 Ga0070691_10023543
490 Ga0070674_100205157
491 Ga0070673_100168208
492 Ga0070688_100006849
493 Ga0070659_100113196
494 Ga0070667_100052360
495 Ga0070701_10308181
496 Ga0070711_100058239
497 Ga0070705_100083106
498 Ga0070700_100063480
499 Ga0070663_100022185
500 Ga0070662_100013418
501 Ga0070681_10341989
502 Ga0070685_10025238
503 Ga0070685_10200142
504 Ga0070679_100345666
505 Ga0068853_100171855
506 Ga0070695_100100459
507 Ga0070696_100027138
508 Ga0070704_100037747
509 Ga0068854_100331407
510 Ga0068859_100012302
511 Ga0068858_100151668
512 Ga0068858_100553647
513 Ga0068862_100033782
514 Ga0081455_10051294
515 Ga0081539_10000051
516 Ga0070717_10956273
517 Ga0075368_10039850
518 Ga0075363_100024756
519 Ga0075364_10030156
520 Ga0070712_100736239
521 Ga0075369_10024421
522 Ga0075427_10032697
523 Ga0075366_10018347
524 Ga0075370_10010869
525 Ga0075428_100033202
526 Ga0075430_100000235
527 Ga0075431_100034657
528 Ga0075433_10000016
529 Ga0075434_100001218
530 Ga0075434_100518476
531 Ga0075429_100016309
532 Ga0097620_100012302
533 Ga0075435_100157999
534 Ga0105240_11047740
535 Ga0111539_10001853
536 Ga0111539_10001856
537 Ga0111539_10273797
538 Ga0105245_10638438
539 Ga0114129_10071090
540 Ga0105237_10015452
541 Ga0105239_10072292
542 Ga0105246_10044565
543 Ga0157339_1003451
544 Ga0157373_10398688
545 Ga0157371_10033891
546 Ga0157370_10108718
547 Ga0157370_10714641
548 Ga0157369_10761554
549 Ga0157378_10314465
550 Ga0157378_10384266
551 Ga0163162_10023387
552 Ga0163162_11461882
553 Ga0157372_10209537
554 Ga0157375_10019292
555 Ga0163163_10562066
556 Ga0157379_10367469
557 Ga0207666_1002112
558 Ga0209564_1001227
559 Ga0207688_10371439
560 Ga0207680_10425599
561 Ga0207705_10014918
562 Ga0207705_10307142
563 Ga0207707_10286790
564 Ga0207671_10211910
565 Ga0207660_10040557
566 Ga0207660_10265944
567 Ga0207660_10648415
568 Ga0207662_10049172
569 Ga0207657_10012483
570 Ga0207652_10071333
571 Ga0207652_10197845
572 Ga0207652_10629637
573 Ga0207681_10936960
574 Ga0207659_10080614
575 Ga0207690_10041308
576 Ga0207690_10108675
577 Ga0207706_10009111
578 Ga0207670_10446323
579 Ga0207712_10079471
580 Ga0207703_10192633
581 Ga0207708_10015064
582 Ga0207641_10463181
583 Ga0209982_1009697
584 Ga0209998_10000522
585 Ga0209974_10077396
586 Ga0207428_10000175
587 Ga0207428_10000678
588 Ga0268264_10173789
589 Ga0265330_10033857
590 Ga0265330_10200054
591 Ga0265340_10039623
592 Ga0265316_10115616
593 Ga0265313_10026988
594 Ga0265313_10058903
595 Ga0316575_10113953
596 Ga0265314_10025913
597 Ga0265314_10026736
598 Ga0265342_10017639
599 Ga0265342_10028719
600 Ga0265342_10249904
601 Ga0373930_0001151
602 Ga0373948_0000399
603 Ga0373950_0002795
604 Ga0373959_0003415
605 Ga0373938_0000326
606 Ga0373928_0000993
607 Ga0373929_0001032
608 Ga0373940_0000016
609 Ga0373949_0002178
610 Ga0373951_0000398
611 Ga0373952_0000317
612 Ga0373932_0000531
613 Ga0373939_0004388
614 Ga0373939_0041713
615 Ga0373941_0004335
616 Ga0373961_0001592
617 Ga0373961_0003540
618 Ga0373962_0000418
619 Ga0373931_0016777
620 Ga0316584_0245286
621 Ga0395899_0148139
622 Ga0395899_0425440
623 Ga0395900_0043808
624 Ga0395900_0248810
625 Ga0395900_0303423
626 Ga0395898_0110759
627 Ga0395901_0010927
628 Ga0395901_0079313
629 Ga0395901_0190825
630 Ga0395901_0256253
631 Ga0400483_264117
632 Ga0439455_0028196
633 Ga0439463_035163
634 Ga0439460_0034982
635 Ga0495638_0041615
636 Ga0495638_0041646
637 Ga0495606_0014419
638 Ga0495610_0033653
639 Ga0495648_0134205
640 Ga0495654_0034410
641 Ga0495622_0118558
642 Ga0495668_0211371
643 Ga0495588_0201204
644 Ga0495670_0020045
645 Ga0495626_0049966
646 Ga0496107_0428665
647 Ga0496108_0377946
648 Ga0496110_0542873
649 Ga0496111_0198168
650 Ga0496112_0000004
651 Ga0496112_0060765
652 Ga0496113_0258635
653 Ga0496113_0847129
654 Ga0496116_0005365
655 Ga0496117_0022880
656 Ga0496117_0077565
657 Ga0496117_0180237
658 Ga0496118_0081467
659 Ga0496121_0040619
660 Ga0496121_0097810
661 Ga0496121_0114268
662 Ga0496121_0300367
663 Ga0496122_0023705
664 Ga0496122_0082694
665 Ga0496123_0019373
666 Ga0496123_0068018
667 Ga0496123_0143172
668 Ga0496125_0000040
669 Ga0496125_0053974
670 Ga0496126_0093285
671 Ga0496126_0141754
672 Ga0496126_0497892
673 Ga0501031_0003427
674 Ga0501031_0004533
675 Ga0501031_0010485
676 Ga0501031_0037543
677 Ga0501031_0066181
678 Ga0501031_0501212
679 Ga0501031_0566908
680 Ga0501032_0006057
681 Ga0501032_0019243
682 Ga0501032_0031574
683 Ga0501032_0031660
684 Ga0501032_0043806
685 Ga0501032_0047164
686 Ga0501032_0131292
687 Ga0501032_0141065
688 Ga0501032_0194758
689 Ga0501032_0202878
690 Ga0501032_0238071
691 Ga0501032_0285759
692 Ga0501033_0001237
693 Ga0501033_0010949
694 Ga0501033_0026474
695 Ga0501033_0032442
696 Ga0501033_0068838
697 Ga0501033_0103303
698 Ga0501033_0109709
699 Ga0501033_0309808
700 Ga0501033_0323930
701 Ga0501034_0001325
702 Ga0501034_0035620
703 Ga0501034_0040759
704 Ga0501034_0048460
705 Ga0501034_0089862
706 Ga0501034_0107181
707 Ga0501034_0176503
708 Ga0501034_0185314
709 Ga0501034_0194618
710 Ga0501034_0204618
711 Ga0501034_0443835
712 Ga0501034_0451374
713 Ga0501034_0595558
714 Ga0501034_0648768
715 Ga0501034_0949216
716 Ga0501036_0004460
717 Ga0501036_0005699
718 Ga0501036_0023433
719 Ga0501036_0026982
720 Ga0501036_0080972
721 Ga0501036_0109584
722 Ga0501036_0172589
723 Ga0501036_0433140
724 Ga0501037_0000988
725 Ga0501037_0001402
726 Ga0501037_0046087
727 Ga0501037_0064253
728 Ga0501037_0167359
729 Ga0501037_0207767
730 Ga0501037_0223093
731 Ga0501037_0282794
732 Ga0501037_0422370
733 Ga0501037_0626359
734 Ga0501038_0003897
735 Ga0501038_0003906
736 Ga0501038_0009943
737 Ga0501038_0029989
738 Ga0501038_0050912
739 Ga0501038_0058684
740 Ga0501038_0081068
741 Ga0501038_0084427
742 Ga0501038_0086918
743 Ga0501038_0233583
744 Ga0501038_0263841
745 Ga0501038_0272748
746 Ga0501038_0392680
747 Ga0501039_0003536
748 Ga0501039_0046237
749 Ga0501039_0072130
750 Ga0501039_0092556
751 Ga0501039_0138720
752 Ga0501039_0140717
753 Ga0501039_0150204
754 Ga0501039_0197889
755 Ga0501040_0049428
756 Ga0501040_0261290
757 Ga0501042_0006124
758 Ga0501042_0063076
759 Ga0501043_0001351
760 Ga0501043_0004164
761 Ga0501043_0008281
762 Ga0501043_0015017
763 Ga0501043_0046071
764 Ga0501043_0052154
765 Ga0501043_0103624
766 Ga0501043_0120521
767 Ga0501043_0169187
768 Ga0501043_0202397
769 Ga0501043_0325411
770 Ga0501046_0001731
771 Ga0501046_0018960
772 Ga0501046_0044900
773 Ga0501047_0000412
774 Ga0501047_0011604
775 Ga0501047_0036493
776 Ga0501047_0038497
777 Ga0501047_0040366
778 Ga0501047_0157101
779 Ga0501047_0202632
780 Ga0501047_0309263
781 Ga0501047_0409138
782 Ga0501047_0421286
783 Ga0501048_0002742
784 Ga0501048_0009512
785 Ga0501048_0037513
786 Ga0501048_0038730
787 Ga0501048_0186467
788 Ga0501067_0026145
789 Ga0501067_0173308
790 Ga0501068_0013439
791 Ga0501068_0077437
792 Ga0501068_0220768
793 Ga0501068_0228826
794 Ga0501068_0289346
795 Ga0501069_0006468
796 Ga0501069_0199967
797 Ga0501069_0236667
798 Ga0501070_0004439
799 Ga0501070_0077699
800 Ga0501070_0083483
801 Ga0501070_0097028
802 Ga0501070_0122705
803 Ga0501070_0125042
804 Ga0501070_0258680
805 Ga0501070_0321156
806 Ga0501070_0390691
807 Ga0501070_0435424
808 Ga0501070_0513190
809 Ga0501071_0001855
810 Ga0501071_0042212
811 Ga0501071_0220262
812 Ga0501072_0117455
813 Ga0501072_0122778
814 Ga0501072_0225209
815 Ga0501073_0015758
816 Ga0501073_0092371
817 Ga0501073_0227507
818 Ga0501073_0352851
819 Ga0501073_0374909
820 Ga0501073_0381631
821 Ga0501074_0003500
822 Ga0501074_0042515
823 Ga0501074_0415543
824 Ga0501075_0024240
825 Ga0501076_0055766
826 Ga0501077_0502757
827 Ga0501079_0163603
828 Ga0501079_0247058
829 Ga0501079_0555404
830 Ga0501080_0006327
831 Ga0501080_0068440
832 Ga0501080_0094981
833 Ga0501080_0095498
834 Ga0501080_0125579
835 Ga0501080_0177710
836 Ga0501080_0220121
837 Ga0501081_0088908
838 Ga0501081_0646445
839 Ga0501081_0802874
840 Ga0501083_0000166
841 Ga0501083_0004596
842 Ga0501083_0064811
843 Ga0501083_0153204
844 Ga0501083_0482402
845 Ga0501035_0002760
846 Ga0501035_0002881
847 Ga0501035_0029236
848 Ga0501035_0035044
849 Ga0501035_0047341
850 Ga0501035_0090023
851 Ga0501035_0094532
852 Ga0501035_0131336
853 Ga0501035_0143170
854 Ga0501035_0158494
855 Ga0501035_0323025
856 Ga0501035_0389273
857 Ga0501035_0470943
858 Ga0501035_0484110
859 Ga0501044_0000361
860 Ga0501044_0001876
861 Ga0501044_0007471
862 Ga0501044_0019676
863 Ga0501044_0019784
864 Ga0501044_0026230
865 Ga0501044_0029105
866 Ga0501044_0084347
867 Ga0501044_0084992
868 Ga0501044_0094796
869 Ga0501044_0114721
870 Ga0501044_0147518
871 Ga0501044_0176204
872 Ga0501044_0198663
873 Ga0501044_0359380
874 Ga0501044_0412060
875 Ga0501044_0438038
876 Ga0501044_0465347
877 Ga0501044_0601687
878 Ga0501045_0139532
879 Ga0501045_0393440
880 nmdc:mga00v17_5379_c1
881 nmdc:mga0k408_34434_c1
882 nmdc:mga05p37_17534_c1
883 nmdc:mga0qj67_3575_c1
884 nmdc:mga06r32_7846_c1
885 nmdc:mga08y16_103419_c1
886 nmdc:mga08y16_1205_c1
887 nmdc:mga08y16_397846_c1
888 nmdc:mga0n895_446_c1
889 nmdc:mga0rr50_90756_c1
890 nmdc:mga0a205_112948_c1
891 nmdc:mga0a205_155772_c1
892 nmdc:mga0sz30_14718_c1
893 Ga0500643_040991
894 Ga0500644_0026475
895 Ga0500581_201033
896 Ga0500566_0118301
897 Ga0500641_0010244
898 Ga0500641_0138394
899 Ga0500650_0001550
900 Ga0500554_070940
901 Ga0500556_0000002
902 Ga0500562_070132
903 Ga0500595_000002
904 Ga0500595_040174
905 Ga0500608_106575
906 Ga0500618_009130
907 Ga0500618_009820
908 Ga0500642_0000034
909 Ga0500652_017488
910 Ga0500658_0126920
911 Ga0500559_0000275
912 Ga0500564_149200
913 Ga0500568_0000190
914 Ga0500586_000336
915 Ga0500604_0092487
916 Ga0500616_0001298
917 Ga0500616_0019894
918 Ga0500622_0015876
919 Ga0500622_0205646
920 Ga0500634_0107926
921 Ga0500645_068333
922 Ga0501084_0007902
923 Ga0501084_0359486
924 Ga0501082_0011345
925 Ga0501082_0103779
926 Ga0501082_0161722
927 Ga0501082_0346355
928 Ga0501082_0375442
929 Ga0501082_0652938
930 Ga0530510_0097036
931 2643757068
932 2828306980
933 2899278771
934 2919075831
935 2919452922
936 8001850745
937 8002063056
938 8057135534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09343

DUF2460

Conserved hypothetical protein 2217 (DUF2460)

49

255

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xgr-assembly1.cif.gz_A ysd1 major tail protein 0.7869 127 181
6h3i-assembly1.cif.gz_A structural snapshots of the type 9 protein translocon 0.7489 123 188
7rfo-assembly1.cif.gz_B semet tailspike protein 4 (tsp4) phage cba120, residues 1-335, obtained in the presence of liso4 0.6921 99 181
3wfz-assembly1.cif.gz_B crystal structure of galacto-n-biose/lacto-n-biose i phosphorylase c236y mutant 0.5789 93 179
2zuw-assembly2.cif.gz_C crystal structure of galacto-n-biose/lacto-n-biose i phosphorylase in complex with glcnac and sulfate 0.5769 93 179
ID Description Score Start End Superfamily
4igbD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6492 130 181 2.60.40.740
3ebgA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.6304 130 183 2.60.40.1730
2zusC02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.567 94 185 2.60.40.10
af_Q61578_79_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5626 110 127 3.50.50.60
af_Q22575_35_128_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5531 135 162 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A538SRG8-F1-model_v4 Gliding motility protein SprA N-terminal domain-containing protein 0.9614 129 180
AF-A0A1F7SJU0-F1-model_v4 BIG2 domain-containing protein 0.9513 99 181
AF-A0A7S6M362-F1-model_v4 Uncharacterized protein 0.9358 128 181
AF-K2DCX6-F1-model_v4 Uncharacterized protein 0.9346 103 181
AF-A0A068NV71-F1-model_v4 Uncharacterized protein 0.9297 129 181

Map