F450367

General Info

Members Datasets Scaffolds Average Seq Length
470 252 940 214

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100111464|Ga0070688_1001114642
Length 242
Sequence MTNSTANVHAASAAIGRKIAVCSTSFIVNPMEAVEINTGANPLASVIWLHGLGADGHDFEPIVSELELDQPVRFVFPHAPVRPVTINQGMRMRAWYDILQFGPGPEDEAGVRASQKLLETLIAAERARGAGSIVLAGFSQGGAIVLQTALRHGERLAGVLALSTYLPLHRTLEAEGSAANRDVPIFMAHGQYDDIIPLQRAEQSRQLLERLGYKVQWQTYPMPHSVCPEEIADISAFLRKIL

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
172 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.21
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100111464 3300005365 Bacteria 1820
2 JGI25406J46586_10002970 3300003203 Bacteria 8004
3 Ga0065707_10213354 3300005295 Bacteria 1256
4 Ga0065707_10318266 3300005295 Bacteria 968
5 Ga0065707_10368314 3300005295 Bacteria 894
6 Ga0070676_10268468 3300005328 Bacteria 1145
7 Ga0070683_100081270 3300005329 Bacteria 3034
8 Ga0070690_100000235 3300005330 Bacteria 28411
9 Ga0068869_100000023 3300005334 Bacteria 64701
10 Ga0068869_100065227 3300005334 Bacteria 2680
11 Ga0068869_100565538 3300005334 Bacteria 957
12 Ga0070680_100003526 3300005336 Bacteria 11681
13 Ga0070680_100116537 3300005336 Bacteria 2227
14 Ga0070682_100004674 3300005337 Bacteria 7606
15 Ga0068868_100000293 3300005338 Bacteria 33613
16 Ga0068868_100855896 3300005338 Bacteria 824
17 Ga0070689_100000974 3300005340 Bacteria 17888
18 Ga0070689_100044238 3300005340 Bacteria 3425
19 Ga0070691_10002924 3300005341 Bacteria 7661
20 Ga0070691_10282635 3300005341 Bacteria 901
21 Ga0070687_100000142 3300005343 Bacteria 24995
22 Ga0070692_10007542 3300005345 Bacteria 4797
23 Ga0070692_10279541 3300005345 Bacteria 1011
24 Ga0070668_100045119 3300005347 Bacteria 3382
25 Ga0070669_100126138 3300005353 Bacteria 1959
26 Ga0070671_100450645 3300005355 Bacteria 1104
27 Ga0070673_100217246 3300005364 Bacteria 1653
28 Ga0070714_100087225 3300005435 Bacteria 2729
29 Ga0070701_10000090 3300005438 Bacteria 25259
30 Ga0070701_10227287 3300005438 Bacteria 1116
31 Ga0070711_100101617 3300005439 Bacteria 2093
32 Ga0070705_100000668 3300005440 Bacteria 19620
33 Ga0070705_100006315 3300005440 Bacteria 5805
34 Ga0070705_100274884 3300005440 Bacteria 1195
35 Ga0070700_100001456 3300005441 Bacteria 11776
36 Ga0070694_100000160 3300005444 Bacteria 34651
37 Ga0070694_100003602 3300005444 Bacteria 9255
38 Ga0070694_100005990 3300005444 Bacteria 7375
39 Ga0070694_100184555 3300005444 Bacteria 1545
40 Ga0070694_100542602 3300005444 Bacteria 930
41 Ga0070708_100000931 3300005445 Bacteria 22149
42 Ga0070708_100074420 3300005445 Bacteria 3063
43 Ga0070708_100233536 3300005445 Bacteria 1726
44 Ga0070678_100055885 3300005456 Bacteria 2884
45 Ga0070662_100651720 3300005457 Bacteria 888
46 Ga0070681_10011037 3300005458 Bacteria 8931
47 Ga0070681_10190266 3300005458 Bacteria 1972
48 Ga0068867_100001762 3300005459 Bacteria 15048
49 Ga0070706_100443553 3300005467 Bacteria 1208
50 Ga0070707_100001983 3300005468 Bacteria 19596
51 Ga0070679_100346400 3300005530 Bacteria 1434
52 Ga0070684_100038684 3300005535 Bacteria 4099
53 Ga0070697_100447625 3300005536 Bacteria 1125
54 Ga0068853_100241698 3300005539 Bacteria 1655
55 Ga0070686_100000090 3300005544 Bacteria 63246
56 Ga0070686_100001329 3300005544 Bacteria 13982
57 Ga0070695_100000130 3300005545 Bacteria 34256
58 Ga0070695_100039797 3300005545 Bacteria 2973
59 Ga0070695_100124443 3300005545 Bacteria 1769
60 Ga0070695_100285819 3300005545 Bacteria 1214
61 Ga0070696_100000397 3300005546 Bacteria 26933
62 Ga0070696_100101382 3300005546 Bacteria 2063
63 Ga0070696_100618554 3300005546 Bacteria 875
64 Ga0070693_100000496 3300005547 Bacteria 17573
65 Ga0070693_100117293 3300005547 Bacteria 1646
66 Ga0070693_100519996 3300005547 Bacteria 847
67 Ga0070704_100000637 3300005549 Bacteria 16929
68 Ga0070704_100101158 3300005549 Bacteria 2172
69 Ga0070704_100182937 3300005549 Bacteria 1678
70 Ga0070704_100236983 3300005549 Bacteria 1492
71 Ga0068855_100006339 3300005563 Bacteria 14415
72 Ga0068854_100001716 3300005578 Bacteria 13354
73 Ga0068856_100017993 3300005614 Bacteria 6851
74 Ga0068856_100450326 3300005614 Bacteria 1308
75 Ga0070702_100000356 3300005615 Bacteria 15961
76 Ga0070702_100132659 3300005615 Bacteria 1575
77 Ga0070702_100405112 3300005615 Bacteria 977
78 Ga0068852_100114034 3300005616 Bacteria 2462
79 Ga0068859_100001418 3300005617 Bacteria 24320
80 Ga0068859_100052924 3300005617 Bacteria 4083
81 Ga0068859_100147848 3300005617 Bacteria 2425
82 Ga0068859_100157584 3300005617 Bacteria 2348
83 Ga0068864_100031456 3300005618 Bacteria 4503
84 Ga0068864_100391567 3300005618 Bacteria 1319
85 Ga0068866_10000337 3300005718 Bacteria 22136
86 Ga0068861_100000043 3300005719 Bacteria 57807
87 Ga0068870_10050697 3300005840 Bacteria 2194
88 Ga0068863_100457455 3300005841 Bacteria 1253
89 Ga0068863_100561705 3300005841 Bacteria 1127
90 Ga0068863_100890536 3300005841 Bacteria 890
91 Ga0068858_100002717 3300005842 Bacteria 17826
92 Ga0068858_100053514 3300005842 Bacteria 3734
93 Ga0068858_100268143 3300005842 Bacteria 1624
94 Ga0068860_100007750 3300005843 Bacteria 10727
95 Ga0068862_100000320 3300005844 Bacteria 52171
96 Ga0081539_10000002 3300005985 Bacteria 601032
97 Ga0081539_10000233 3300005985 Bacteria 130647
98 Ga0081539_10188501 3300005985 Bacteria 962
99 Ga0070715_10167486 3300006163 Bacteria 1091
100 Ga0070716_100599774 3300006173 Bacteria 828
101 Ga0070716_100716674 3300006173 Bacteria 766
102 Ga0070712_100001483 3300006175 Bacteria 14324
103 Ga0075366_10151752 3300006195 Bacteria 1403
104 Ga0097621_100000206 3300006237 Bacteria 38579
105 Ga0097621_100010749 3300006237 Bacteria 6712
106 Ga0068871_100000040 3300006358 Bacteria 69044
107 Ga0068871_100001140 3300006358 Bacteria 17815
108 Ga0075428_100000107 3300006844 Bacteria 70381
109 Ga0075428_100032726 3300006844 Bacteria 5743
110 Ga0075428_100125785 3300006844 Bacteria 2789
111 Ga0075428_100134909 3300006844 Bacteria 2684
112 Ga0075428_100290903 3300006844 Bacteria 1757
113 Ga0075428_100446273 3300006844 Bacteria 1386
114 Ga0075430_100022309 3300006846 Bacteria 5385
115 Ga0075430_100025309 3300006846 Bacteria 5049
116 Ga0075430_100091379 3300006846 Bacteria 2545
117 Ga0075430_100206335 3300006846 Bacteria 1631
118 Ga0075431_100001705 3300006847 Bacteria 20651
119 Ga0075431_100023023 3300006847 Bacteria 6368
120 Ga0075431_100024526 3300006847 Bacteria 6181
121 Ga0075431_100031796 3300006847 Bacteria 5436
122 Ga0075431_100198463 3300006847 Bacteria 2054
123 Ga0075433_10021071 3300006852 Bacteria 5461
124 Ga0075433_10070664 3300006852 Bacteria 3068
125 Ga0075434_100000151 3300006871 Bacteria 42872
126 Ga0075434_100010320 3300006871 Bacteria 8757
127 Ga0075434_100011846 3300006871 Bacteria 8242
128 Ga0075434_100014648 3300006871 Bacteria 7501
129 Ga0075434_100049194 3300006871 Bacteria 4185
130 Ga0075434_100067498 3300006871 Bacteria 3562
131 Ga0075434_100107182 3300006871 Bacteria 2804
132 Ga0075434_100373890 3300006871 Bacteria 1446
133 Ga0075429_100004376 3300006880 Bacteria 12122
134 Ga0075429_100010559 3300006880 Bacteria 7986
135 Ga0075429_100051884 3300006880 Bacteria 3568
136 Ga0075429_100086134 3300006880 Bacteria 2739
137 Ga0068865_100000245 3300006881 Bacteria 30264
138 Ga0075436_100000174 3300006914 Bacteria 40099
139 Ga0075436_100001172 3300006914 Bacteria 17766
140 Ga0075436_100001251 3300006914 Bacteria 17268
141 Ga0075436_100015073 3300006914 Bacteria 5298
142 Ga0075436_100026844 3300006914 Bacteria 3965
143 Ga0075436_100208015 3300006914 Bacteria 1387
144 Ga0097620_100001418 3300006931 Bacteria 24320
145 Ga0097620_100052924 3300006931 Bacteria 4083
146 Ga0097620_100147856 3300006931 Bacteria 2425
147 Ga0097620_100157582 3300006931 Bacteria 2348
148 Ga0075435_100000699 3300007076 Bacteria 20808
149 Ga0075435_100017649 3300007076 Bacteria 5407
150 Ga0075435_100033692 3300007076 Bacteria 4052
151 Ga0075435_100111135 3300007076 Bacteria 2279
152 Ga0075435_100282600 3300007076 Bacteria 1417
153 Ga0099794_10023129 3300007265 Bacteria 2839
154 Ga0111539_10006727 3300009094 Bacteria 14790
155 Ga0111539_10050841 3300009094 Bacteria 4938
156 Ga0105245_10000224 3300009098 Bacteria 53847
157 Ga0114129_10000040 3300009147 Bacteria 107971
158 Ga0114129_10000861 3300009147 Bacteria 39442
159 Ga0114129_10006464 3300009147 Bacteria 16621
160 Ga0114129_10123467 3300009147 Bacteria 3561
161 Ga0114129_10146901 3300009147 Bacteria 3229
162 Ga0114129_10150390 3300009147 Bacteria 3186
163 Ga0114129_10505061 3300009147 Bacteria 1579
164 Ga0114129_10619645 3300009147 Bacteria 1400
165 Ga0114129_10671797 3300009147 Bacteria 1335
166 Ga0114129_11099409 3300009147 Bacteria 995
167 Ga0105243_10000035 3300009148 Bacteria 177598
168 Ga0105242_10000300 3300009176 Bacteria 39346
169 Ga0105242_10007510 3300009176 Bacteria 8387
170 Ga0105242_10224977 3300009176 Bacteria 1679
171 Ga0105248_10181911 3300009177 Bacteria 2369
172 Ga0105248_10620803 3300009177 Bacteria 1220
173 Ga0105249_10052250 3300009553 Bacteria 3731
174 Ga0105249_10073216 3300009553 Bacteria 3169
175 Ga0105239_10105509 3300010375 Bacteria 3121
176 Ga0157378_10002478 3300013297 Bacteria 16430
177 Ga0157378_10238565 3300013297 Bacteria 1736
178 Ga0157378_10472886 3300013297 Bacteria 1247
179 Ga0163162_10053252 3300013306 Bacteria 4067
180 Ga0157372_10373369 3300013307 Bacteria 1662
181 Ga0157375_10561546 3300013308 Bacteria 1302
182 Ga0157380_10020779 3300014326 Bacteria 4913
183 Ga0157377_10647861 3300014745 Bacteria 760
184 Ga0157376_10020252 3300014969 Bacteria 5142
185 Ga0207692_10092691 3300025898 Bacteria 1642
186 Ga0207642_10002929 3300025899 Bacteria 5340
187 Ga0207688_10097463 3300025901 Bacteria 1694
188 Ga0207688_10214536 3300025901 Bacteria 1157
189 Ga0207647_10074766 3300025904 Bacteria 2040
190 Ga0207685_10088816 3300025905 Bacteria 1296
191 Ga0207645_10230330 3300025907 Bacteria 1223
192 Ga0207643_10017965 3300025908 Bacteria 3873
193 Ga0207684_10006406 3300025910 Bacteria 10729
194 Ga0207684_10302190 3300025910 Bacteria 1380
195 Ga0207707_10009379 3300025912 Bacteria 8489
196 Ga0207660_10010313 3300025917 Bacteria 6060
197 Ga0207660_10024914 3300025917 Bacteria 4055
198 Ga0207662_10000091 3300025918 Bacteria 42710
199 Ga0207662_10052864 3300025918 Bacteria 2418
200 Ga0207662_10076448 3300025918 Bacteria 2035
201 Ga0207646_10002733 3300025922 Bacteria 20627
202 Ga0207681_10708543 3300025923 Bacteria 837
203 Ga0207687_10005537 3300025927 Bacteria 8350
204 Ga0207644_10321745 3300025931 Bacteria 1251
205 Ga0207686_10000914 3300025934 Bacteria 17687
206 Ga0207686_10145047 3300025934 Bacteria 1646
207 Ga0207709_10001149 3300025935 Bacteria 19293
208 Ga0207670_10005058 3300025936 Bacteria 7191
209 Ga0207670_10023063 3300025936 Bacteria 3867
210 Ga0207704_10001399 3300025938 Bacteria 10777
211 Ga0207665_10079492 3300025939 Bacteria 2254
212 Ga0207711_10536946 3300025941 Bacteria 1091
213 Ga0207689_10000024 3300025942 Bacteria 107574
214 Ga0207689_10079038 3300025942 Bacteria 2703
215 Ga0207689_10172453 3300025942 Bacteria 1783
216 Ga0207661_10060163 3300025944 Bacteria 3064
217 Ga0207667_10040129 3300025949 Bacteria 4984
218 Ga0207712_10020378 3300025961 Bacteria 4342
219 Ga0207712_10051934 3300025961 Bacteria 2869
220 Ga0207640_10001826 3300025981 Bacteria 11420
221 Ga0207677_10000435 3300026023 Bacteria 28214
222 Ga0207703_10001473 3300026035 Bacteria 21462
223 Ga0207703_10160103 3300026035 Bacteria 1971
224 Ga0207708_10001349 3300026075 Bacteria 18419
225 Ga0207702_10163189 3300026078 Bacteria 2036
226 Ga0207641_10471793 3300026088 Bacteria 1215
227 Ga0207648_10000316 3300026089 Bacteria 52941
228 Ga0207648_10115966 3300026089 Bacteria 2354
229 Ga0207676_10032335 3300026095 Bacteria 3942
230 Ga0207675_100000017 3300026118 Bacteria 124338
231 Ga0207675_100228123 3300026118 Bacteria 1796
232 Ga0207698_10159705 3300026142 Bacteria 1969
233 Ga0209969_1012277 3300027360 Bacteria 1234
234 Ga0209967_1025529 3300027364 Bacteria 875
235 Ga0210000_1011114 3300027462 Bacteria 1332
236 Ga0209966_1001893 3300027695 Bacteria 3533
237 Ga0209966_1019739 3300027695 Bacteria 1300
238 Ga0209974_10019044 3300027876 Bacteria 2277
239 Ga0207428_10000179 3300027907 Bacteria 88854
240 Ga0268265_10003537 3300028380 Bacteria 11176
241 Ga0268264_10001250 3300028381 Bacteria 24232
242 Ga0265328_10023165 3300031239 Bacteria 2358
243 Ga0265328_10034221 3300031239 Unclassified 1881
244 Ga0265331_10003614 3300031250 Bacteria 9888
245 Ga0265331_10135102 3300031250 Unclassified 1123
246 Ga0265327_10000077 3300031251 Bacteria 211850
247 Ga0265327_10007071 3300031251 Bacteria 8781
248 Ga0265327_10007475 3300031251 Bacteria 8427
249 Ga0265327_10130583 3300031251 Bacteria 1182
250 Ga0307408_100309181 3300031548 Bacteria 1327
251 Ga0307408_100854731 3300031548 Bacteria 830
252 Ga0265314_10074001 3300031711 Bacteria 2270
253 Ga0307406_10790320 3300031901 Bacteria 800
254 Ga0307416_100004510 3300032002 Bacteria 8407
255 Ga0307411_10011819 3300032005 Bacteria 4733
256 Ga0307411_10511259 3300032005 Bacteria 1017
257 Ga0373930_0022750 3300034816 Bacteria 1242
258 Ga0373930_0040658 3300034816 Bacteria 989
259 Ga0373950_0041602 3300034818 Bacteria 881
260 Ga0373926_0008569 3300035083 Bacteria 3404
261 Ga0373928_0012413 3300035084 Bacteria 1699
262 Ga0373934_0017846 3300035086 Bacteria 2711
263 Ga0373940_0000256 3300035088 Bacteria 7663
264 Ga0373944_0030856 3300035089 Bacteria 1609
265 Ga0373944_0055288 3300035089 Bacteria 1260
266 Ga0373949_0001814 3300035090 Bacteria 5834
267 Ga0373952_0010070 3300035092 Bacteria 1822
268 Ga0373923_0019427 3300035111 Bacteria 2631
269 Ga0373932_0125798 3300035112 Bacteria 859
270 Ga0373939_0005502 3300035114 Bacteria 3020
271 Ga0373939_0016479 3300035114 Bacteria 1949
272 Ga0373941_0069862 3300035115 Bacteria 1163
273 Ga0373941_0082379 3300035115 Bacteria 1089
274 Ga0373945_0004584 3300035116 Bacteria 4394
275 Ga0373954_0000020 3300035118 Bacteria 60211
276 Ga0373956_0142639 3300035119 Bacteria 1125
277 Ga0373957_0008626 3300035120 Bacteria 3311
278 Ga0373960_0016912 3300035121 Bacteria 1882
279 Ga0373960_0020325 3300035121 Bacteria 1754
280 Ga0373960_0028882 3300035121 Bacteria 1533
281 Ga0373943_0019737 3300035170 Bacteria 3102
282 Ga0373943_0101024 3300035170 Bacteria 1508
283 Ga0373946_0006941 3300035171 Bacteria 4124
284 Ga0373946_0116016 3300035171 Bacteria 1217
285 Ga0373955_0021460 3300035172 Bacteria 3260
286 Ga0373955_0083920 3300035172 Bacteria 1805
287 Ga0373961_0003408 3300035241 Bacteria 3939
288 Ga0373962_0003650 3300035242 Bacteria 3701
289 Ga0373962_0005164 3300035242 Bacteria 3156
290 Ga0373924_0018275 3300035410 Bacteria 2698
291 Ga0373931_0001934 3300035691 Bacteria 9078
292 Ga0373931_0009533 3300035691 Bacteria 4642
293 Ga0373931_0038483 3300035691 Bacteria 2502
294 Ga0373935_0012884 3300035692 Bacteria 5037
295 Ga0373935_0028624 3300035692 Bacteria 3443
296 Ga0373935_0029511 3300035692 Bacteria 3394
297 Ga0373935_0332716 3300035692 Bacteria 1080
298 Ga0373927_0023751 3300035695 Bacteria 4013
299 Ga0373927_0034885 3300035695 Bacteria 3272
300 Ga0373933_0004387 3300035724 Bacteria 7746
301 Ga0373933_0048094 3300035724 Bacteria 2539
302 Ga0373933_0137819 3300035724 Bacteria 1538
303 Ga0373947_0279501 3300035725 Bacteria 1109
304 Ga0373937_0000179 3300036401 Bacteria 62280
305 Ga0373937_0017930 3300036401 Bacteria 6315
306 Ga0373925_0017712 3300037068 Bacteria 5168
307 Ga0373925_0045237 3300037068 Bacteria 3269
308 Ga0436363_0214576 3300039450 Bacteria 13572
309 Ga0439441_001626 3300042001 Bacteria 2999
310 Ga0439441_031688 3300042001 Bacteria 1028
311 Ga0439443_000502 3300042003 Bacteria 3516
312 Ga0451577_0472283 3300042876 Bacteria 1139
313 Ga0466965_0070525 3300044683 Bacteria 1757
314 Ga0453684_0353511 3300044712 Bacteria 1656
315 Ga0451576_0000822 3300045051 Bacteria 60600
316 Ga0451576_0110274 3300045051 Bacteria 2864
317 Ga0451576_0281590 3300045051 Bacteria 1738
318 Ga0495603_0011613 3300046455 Bacteria 5329
319 Ga0495580_0001659 3300046472 Bacteria 19563
320 Ga0495580_0010391 3300046472 Bacteria 7255
321 Ga0495582_0014893 3300046473 Bacteria 4273
322 Ga0495639_0037774 3300046475 Bacteria 2166
323 Ga0495664_0066319 3300046477 Bacteria 2153
324 Ga0495594_0018455 3300046499 Bacteria 3694
325 Ga0495628_0269888 3300046516 Bacteria 1266
326 Ga0495630_0485287 3300046517 Bacteria 947
327 Ga0495666_0055192 3300046526 Bacteria 1904
328 Ga0495642_0029694 3300046528 Bacteria 2184
329 Ga0495586_0044579 3300046535 Bacteria 2389
330 Ga0495587_0206784 3300046536 Bacteria 1109
331 Ga0495598_0031344 3300046537 Bacteria 1495
332 Ga0495621_0005502 3300046539 Bacteria 3644
333 Ga0495621_0115833 3300046539 Bacteria 1032
334 Ga0495621_0131165 3300046539 Bacteria 975
335 Ga0495622_0130803 3300046557 Bacteria 1143
336 Ga0495667_0052479 3300046559 Bacteria 2686
337 Ga0495656_0020881 3300046615 Bacteria 2544
338 Ga0495611_0144187 3300046648 Bacteria 1112
339 Ga0495588_0006502 3300046674 Bacteria 5269
340 Ga0495623_0310688 3300046679 Bacteria 868
341 Ga0495647_0000149 3300046681 Bacteria 17854
342 Ga0495658_0004682 3300046683 Bacteria 6729
343 Ga0495669_0136278 3300046684 Bacteria 1157
344 Ga0495581_0035777 3300047315 Bacteria 2873
345 Ga0495674_0284582 3300047319 Bacteria 1354
346 Ga0495676_0045133 3300047321 Bacteria 3590
347 Ga0495680_0080532 3300047322 Bacteria 2461
348 Ga0495684_0415877 3300047471 Bacteria 941
349 Ga0495602_0223477 3300048088 Bacteria 1420
350 Ga0496113_0680190 3300048916 Bacteria 822
351 Ga0501292_015995 3300049515 Bacteria 1177
352 Ga0501292_039063 3300049515 Bacteria 816
353 Ga0501031_0033868 3300049568 Bacteria 3334
354 Ga0501031_0185243 3300049568 Bacteria 1360
355 Ga0501033_0044357 3300049570 Bacteria 3310
356 Ga0501036_0039661 3300049572 Bacteria 3985
357 Ga0501036_0340213 3300049572 Bacteria 1253
358 Ga0501037_0002212 3300049573 Bacteria 14046
359 Ga0501037_0049715 3300049573 Bacteria 3070
360 Ga0501038_0002844 3300049574 Bacteria 16106
361 Ga0501038_0321415 3300049574 Bacteria 1211
362 Ga0501039_0172171 3300049575 Bacteria 1702
363 Ga0501040_0000759 3300049576 Bacteria 20016
364 Ga0501040_0000980 3300049576 Bacteria 18069
365 Ga0501040_0028681 3300049576 Bacteria 3753
366 Ga0501041_0000109 3300049577 Bacteria 34463
367 Ga0501041_0013895 3300049577 Bacteria 4774
368 Ga0501041_0041698 3300049577 Bacteria 2788
369 Ga0501041_0154885 3300049577 Unclassified 1432
370 Ga0501042_0001562 3300049578 Bacteria 13545
371 Ga0501042_0008480 3300049578 Bacteria 6787
372 Ga0501042_0196627 3300049578 Bacteria 1454
373 Ga0501043_0044627 3300049579 Bacteria 3486
374 Ga0501046_0000953 3300049580 Bacteria 28407
375 Ga0501046_0001303 3300049580 Bacteria 24159
376 Ga0501047_0029491 3300049581 Bacteria 5289
377 Ga0501048_0000190 3300049582 Bacteria 39467
378 Ga0501048_0000998 3300049582 Bacteria 21096
379 Ga0501048_0048533 3300049582 Bacteria 3028
380 Ga0501048_0096975 3300049582 Bacteria 2080
381 Ga0501068_0005962 3300049584 Bacteria 6688
382 Ga0501068_0102210 3300049584 Bacteria 1777
383 Ga0501069_0080001 3300049585 Bacteria 1840
384 Ga0501070_0040106 3300049586 Bacteria 3905
385 Ga0501071_0032363 3300049587 Bacteria 3713
386 Ga0501072_0022921 3300049588 Bacteria 4847
387 Ga0501072_0052388 3300049588 Bacteria 3213
388 Ga0501072_0207788 3300049588 Bacteria 1560
389 Ga0501072_0249211 3300049588 Bacteria 1414
390 Ga0501072_0358315 3300049588 Bacteria 1158
391 Ga0501073_0030491 3300049589 Bacteria 3851
392 Ga0501074_0000599 3300049590 Bacteria 22381
393 Ga0501074_0012006 3300049590 Bacteria 6296
394 Ga0501075_0000840 3300049591 Bacteria 19361
395 Ga0501075_0085938 3300049591 Bacteria 2383
396 Ga0501075_0097217 3300049591 Bacteria 2234
397 Ga0501076_0002467 3300049592 Bacteria 12709
398 Ga0501076_0011375 3300049592 Bacteria 6624
399 Ga0501076_0022943 3300049592 Bacteria 4803
400 Ga0501076_0737630 3300049592 Bacteria 813
401 Ga0501077_0000262 3300049593 Bacteria 30957
402 Ga0501077_0715539 3300049593 Bacteria 643
403 Ga0501079_0000684 3300049741 Bacteria 22742
404 Ga0501079_0564560 3300049741 Bacteria 895
405 Ga0501079_0566687 3300049741 Bacteria 893
406 Ga0501080_0262408 3300049742 Bacteria 1573
407 Ga0501081_0000356 3300049743 Bacteria 24749
408 Ga0501081_0008096 3300049743 Bacteria 6821
409 Ga0501081_0077833 3300049743 Bacteria 2318
410 Ga0501081_0204063 3300049743 Bacteria 1434
411 Ga0501083_0238328 3300049744 Bacteria 1184
412 Ga0501035_0033821 3300049822 Bacteria 4647
413 Ga0501044_0422141 3300049823 Bacteria 1244
414 Ga0501045_0000749 3300049824 Bacteria 20755
415 Ga0501045_0641941 3300049824 Bacteria 785
416 Ga0501204_024962 3300049850 Bacteria 802
417 nmdc:mga0k408_69853_c1 3300050493 Bacteria 2050
418 nmdc:mga05p37_102442_c1 3300050507 Bacteria 3525
419 nmdc:mga05p37_1075_c1 3300050507 Bacteria 31295
420 nmdc:mga05p37_449484_c1 3300050507 Bacteria 1492
421 nmdc:mga05p37_558339_c1 3300050507 Bacteria 1302
422 nmdc:mga05p37_593_c1 3300050507 Bacteria 39868
423 nmdc:mga05p37_60725_c1 3300050507 Bacteria 4654
424 nmdc:mga05p37_676505_c1 3300050507 Bacteria 1151
425 nmdc:mga05p37_802_c1 3300050507 Bacteria 35044
426 nmdc:mga09592_1668_c1 3300050508 Bacteria 17899
427 nmdc:mga09592_320_c1 3300050508 Bacteria 35151
428 nmdc:mga09592_730539_c1 3300050508 Bacteria 841
429 nmdc:mga0qj67_116583_c1 3300050509 Bacteria 2158
430 nmdc:mga0qj67_35658_c1 3300050509 Bacteria 3890
431 nmdc:mga0qj67_8897_c1 3300050509 Bacteria 7450
432 nmdc:mga06r32_237317_c1 3300050510 Bacteria 1811
433 nmdc:mga06r32_277599_c1 3300050510 Bacteria 1663
434 nmdc:mga06r32_4774_c1 3300050510 Bacteria 12193
435 nmdc:mga06r32_51199_c1 3300050510 Bacteria 3951
436 nmdc:mga06r32_55177_c1 3300050510 Bacteria 3811
437 nmdc:mga08y16_1159_c1 3300050511 Bacteria 25985
438 nmdc:mga0n895_1129250_c1 3300050512 Bacteria 760
439 nmdc:mga0n895_2079_c1 3300050512 Bacteria 15416
440 nmdc:mga0n895_235554_c1 3300050512 Bacteria 1858
441 nmdc:mga0n895_364806_c1 3300050512 Bacteria 1462
442 nmdc:mga0n895_3966_c1 3300050512 Bacteria 12030
443 nmdc:mga0n895_638450_c1 3300050512 Bacteria 1064
444 nmdc:mga0n895_68967_c1 3300050512 Bacteria 3503
445 nmdc:mga0n895_7245_c1 3300050512 Bacteria 9502
446 nmdc:mga0n895_9449_c1 3300050512 Bacteria 8531
447 nmdc:mga0n895_94547_c1 3300050512 Bacteria 2993
448 nmdc:mga0rr50_1180_c1 3300050513 Bacteria 14200
449 nmdc:mga0rr50_234578_c1 3300050513 Bacteria 1519
450 nmdc:mga0rr50_292128_c1 3300050513 Bacteria 1362
451 nmdc:mga0rr50_372680_c1 3300050513 Bacteria 1203
452 nmdc:mga0rr50_38854_c1 3300050513 Bacteria 3448
453 nmdc:mga0rr50_4941_c1 3300050513 Bacteria 7895
454 nmdc:mga08x19_2526_c1 3300050514 Bacteria 11121
455 nmdc:mga08x19_5016_c1 3300050514 Bacteria 7828
456 nmdc:mga08x19_514443_c1 3300050514 Bacteria 846
457 nmdc:mga08x19_83199_c1 3300050514 Bacteria 2104
458 nmdc:mga08x19_952_c1 3300050514 Bacteria 18176
459 nmdc:mga0a205_1403_c1 3300050515 Bacteria 20406
460 nmdc:mga0a205_18905_c1 3300050515 Bacteria 6491
461 nmdc:mga0a205_5728_c1 3300050515 Bacteria 11195
462 nmdc:mga0a205_60213_c1 3300050515 Bacteria 3667
463 Ga0495612_0173239 3300053078 Bacteria 946
464 Ga0501084_0000355 3300054114 Bacteria 34952
465 Ga0501082_0001347 3300060353 Bacteria 21578
466 Ga0501082_0004982 3300060353 Bacteria 11595
467 Ga0501082_0187981 3300060353 Bacteria 1797
468 Ga0530510_0000864 3300061734 Bacteria 19984
469 Ga0530510_0001016 3300061734 Bacteria 18589
470 Ga0530510_0017496 3300061734 Bacteria 5081
471 Ga0070688_100111464
472 JGI25406J46586_10002970
473 Ga0065707_10213354
474 Ga0065707_10318266
475 Ga0065707_10368314
476 Ga0070676_10268468
477 Ga0070683_100081270
478 Ga0070690_100000235
479 Ga0068869_100000023
480 Ga0068869_100065227
481 Ga0068869_100565538
482 Ga0070680_100003526
483 Ga0070680_100116537
484 Ga0070682_100004674
485 Ga0068868_100000293
486 Ga0068868_100855896
487 Ga0070689_100000974
488 Ga0070689_100044238
489 Ga0070691_10002924
490 Ga0070691_10282635
491 Ga0070687_100000142
492 Ga0070692_10007542
493 Ga0070692_10279541
494 Ga0070668_100045119
495 Ga0070669_100126138
496 Ga0070671_100450645
497 Ga0070673_100217246
498 Ga0070714_100087225
499 Ga0070701_10000090
500 Ga0070701_10227287
501 Ga0070711_100101617
502 Ga0070705_100000668
503 Ga0070705_100006315
504 Ga0070705_100274884
505 Ga0070700_100001456
506 Ga0070694_100000160
507 Ga0070694_100003602
508 Ga0070694_100005990
509 Ga0070694_100184555
510 Ga0070694_100542602
511 Ga0070708_100000931
512 Ga0070708_100074420
513 Ga0070708_100233536
514 Ga0070678_100055885
515 Ga0070662_100651720
516 Ga0070681_10011037
517 Ga0070681_10190266
518 Ga0068867_100001762
519 Ga0070706_100443553
520 Ga0070707_100001983
521 Ga0070679_100346400
522 Ga0070684_100038684
523 Ga0070697_100447625
524 Ga0068853_100241698
525 Ga0070686_100000090
526 Ga0070686_100001329
527 Ga0070695_100000130
528 Ga0070695_100039797
529 Ga0070695_100124443
530 Ga0070695_100285819
531 Ga0070696_100000397
532 Ga0070696_100101382
533 Ga0070696_100618554
534 Ga0070693_100000496
535 Ga0070693_100117293
536 Ga0070693_100519996
537 Ga0070704_100000637
538 Ga0070704_100101158
539 Ga0070704_100182937
540 Ga0070704_100236983
541 Ga0068855_100006339
542 Ga0068854_100001716
543 Ga0068856_100017993
544 Ga0068856_100450326
545 Ga0070702_100000356
546 Ga0070702_100132659
547 Ga0070702_100405112
548 Ga0068852_100114034
549 Ga0068859_100001418
550 Ga0068859_100052924
551 Ga0068859_100147848
552 Ga0068859_100157584
553 Ga0068864_100031456
554 Ga0068864_100391567
555 Ga0068866_10000337
556 Ga0068861_100000043
557 Ga0068870_10050697
558 Ga0068863_100457455
559 Ga0068863_100561705
560 Ga0068863_100890536
561 Ga0068858_100002717
562 Ga0068858_100053514
563 Ga0068858_100268143
564 Ga0068860_100007750
565 Ga0068862_100000320
566 Ga0081539_10000002
567 Ga0081539_10000233
568 Ga0081539_10188501
569 Ga0070715_10167486
570 Ga0070716_100599774
571 Ga0070716_100716674
572 Ga0070712_100001483
573 Ga0075366_10151752
574 Ga0097621_100000206
575 Ga0097621_100010749
576 Ga0068871_100000040
577 Ga0068871_100001140
578 Ga0075428_100000107
579 Ga0075428_100032726
580 Ga0075428_100125785
581 Ga0075428_100134909
582 Ga0075428_100290903
583 Ga0075428_100446273
584 Ga0075430_100022309
585 Ga0075430_100025309
586 Ga0075430_100091379
587 Ga0075430_100206335
588 Ga0075431_100001705
589 Ga0075431_100023023
590 Ga0075431_100024526
591 Ga0075431_100031796
592 Ga0075431_100198463
593 Ga0075433_10021071
594 Ga0075433_10070664
595 Ga0075434_100000151
596 Ga0075434_100010320
597 Ga0075434_100011846
598 Ga0075434_100014648
599 Ga0075434_100049194
600 Ga0075434_100067498
601 Ga0075434_100107182
602 Ga0075434_100373890
603 Ga0075429_100004376
604 Ga0075429_100010559
605 Ga0075429_100051884
606 Ga0075429_100086134
607 Ga0068865_100000245
608 Ga0075436_100000174
609 Ga0075436_100001172
610 Ga0075436_100001251
611 Ga0075436_100015073
612 Ga0075436_100026844
613 Ga0075436_100208015
614 Ga0097620_100001418
615 Ga0097620_100052924
616 Ga0097620_100147856
617 Ga0097620_100157582
618 Ga0075435_100000699
619 Ga0075435_100017649
620 Ga0075435_100033692
621 Ga0075435_100111135
622 Ga0075435_100282600
623 Ga0099794_10023129
624 Ga0111539_10006727
625 Ga0111539_10050841
626 Ga0105245_10000224
627 Ga0114129_10000040
628 Ga0114129_10000861
629 Ga0114129_10006464
630 Ga0114129_10123467
631 Ga0114129_10146901
632 Ga0114129_10150390
633 Ga0114129_10505061
634 Ga0114129_10619645
635 Ga0114129_10671797
636 Ga0114129_11099409
637 Ga0105243_10000035
638 Ga0105242_10000300
639 Ga0105242_10007510
640 Ga0105242_10224977
641 Ga0105248_10181911
642 Ga0105248_10620803
643 Ga0105249_10052250
644 Ga0105249_10073216
645 Ga0105239_10105509
646 Ga0157378_10002478
647 Ga0157378_10238565
648 Ga0157378_10472886
649 Ga0163162_10053252
650 Ga0157372_10373369
651 Ga0157375_10561546
652 Ga0157380_10020779
653 Ga0157377_10647861
654 Ga0157376_10020252
655 Ga0207692_10092691
656 Ga0207642_10002929
657 Ga0207688_10097463
658 Ga0207688_10214536
659 Ga0207647_10074766
660 Ga0207685_10088816
661 Ga0207645_10230330
662 Ga0207643_10017965
663 Ga0207684_10006406
664 Ga0207684_10302190
665 Ga0207707_10009379
666 Ga0207660_10010313
667 Ga0207660_10024914
668 Ga0207662_10000091
669 Ga0207662_10052864
670 Ga0207662_10076448
671 Ga0207646_10002733
672 Ga0207681_10708543
673 Ga0207687_10005537
674 Ga0207644_10321745
675 Ga0207686_10000914
676 Ga0207686_10145047
677 Ga0207709_10001149
678 Ga0207670_10005058
679 Ga0207670_10023063
680 Ga0207704_10001399
681 Ga0207665_10079492
682 Ga0207711_10536946
683 Ga0207689_10000024
684 Ga0207689_10079038
685 Ga0207689_10172453
686 Ga0207661_10060163
687 Ga0207667_10040129
688 Ga0207712_10020378
689 Ga0207712_10051934
690 Ga0207640_10001826
691 Ga0207677_10000435
692 Ga0207703_10001473
693 Ga0207703_10160103
694 Ga0207708_10001349
695 Ga0207702_10163189
696 Ga0207641_10471793
697 Ga0207648_10000316
698 Ga0207648_10115966
699 Ga0207676_10032335
700 Ga0207675_100000017
701 Ga0207675_100228123
702 Ga0207698_10159705
703 Ga0209969_1012277
704 Ga0209967_1025529
705 Ga0210000_1011114
706 Ga0209966_1001893
707 Ga0209966_1019739
708 Ga0209974_10019044
709 Ga0207428_10000179
710 Ga0268265_10003537
711 Ga0268264_10001250
712 Ga0265328_10023165
713 Ga0265328_10034221
714 Ga0265331_10003614
715 Ga0265331_10135102
716 Ga0265327_10000077
717 Ga0265327_10007071
718 Ga0265327_10007475
719 Ga0265327_10130583
720 Ga0307408_100309181
721 Ga0307408_100854731
722 Ga0265314_10074001
723 Ga0307406_10790320
724 Ga0307416_100004510
725 Ga0307411_10011819
726 Ga0307411_10511259
727 Ga0373930_0022750
728 Ga0373930_0040658
729 Ga0373950_0041602
730 Ga0373926_0008569
731 Ga0373928_0012413
732 Ga0373934_0017846
733 Ga0373940_0000256
734 Ga0373944_0030856
735 Ga0373944_0055288
736 Ga0373949_0001814
737 Ga0373952_0010070
738 Ga0373923_0019427
739 Ga0373932_0125798
740 Ga0373939_0005502
741 Ga0373939_0016479
742 Ga0373941_0069862
743 Ga0373941_0082379
744 Ga0373945_0004584
745 Ga0373954_0000020
746 Ga0373956_0142639
747 Ga0373957_0008626
748 Ga0373960_0016912
749 Ga0373960_0020325
750 Ga0373960_0028882
751 Ga0373943_0019737
752 Ga0373943_0101024
753 Ga0373946_0006941
754 Ga0373946_0116016
755 Ga0373955_0021460
756 Ga0373955_0083920
757 Ga0373961_0003408
758 Ga0373962_0003650
759 Ga0373962_0005164
760 Ga0373924_0018275
761 Ga0373931_0001934
762 Ga0373931_0009533
763 Ga0373931_0038483
764 Ga0373935_0012884
765 Ga0373935_0028624
766 Ga0373935_0029511
767 Ga0373935_0332716
768 Ga0373927_0023751
769 Ga0373927_0034885
770 Ga0373933_0004387
771 Ga0373933_0048094
772 Ga0373933_0137819
773 Ga0373947_0279501
774 Ga0373937_0000179
775 Ga0373937_0017930
776 Ga0373925_0017712
777 Ga0373925_0045237
778 Ga0436363_0214576
779 Ga0439441_001626
780 Ga0439441_031688
781 Ga0439443_000502
782 Ga0451577_0472283
783 Ga0466965_0070525
784 Ga0453684_0353511
785 Ga0451576_0000822
786 Ga0451576_0110274
787 Ga0451576_0281590
788 Ga0495603_0011613
789 Ga0495580_0001659
790 Ga0495580_0010391
791 Ga0495582_0014893
792 Ga0495639_0037774
793 Ga0495664_0066319
794 Ga0495594_0018455
795 Ga0495628_0269888
796 Ga0495630_0485287
797 Ga0495666_0055192
798 Ga0495642_0029694
799 Ga0495586_0044579
800 Ga0495587_0206784
801 Ga0495598_0031344
802 Ga0495621_0005502
803 Ga0495621_0115833
804 Ga0495621_0131165
805 Ga0495622_0130803
806 Ga0495667_0052479
807 Ga0495656_0020881
808 Ga0495611_0144187
809 Ga0495588_0006502
810 Ga0495623_0310688
811 Ga0495647_0000149
812 Ga0495658_0004682
813 Ga0495669_0136278
814 Ga0495581_0035777
815 Ga0495674_0284582
816 Ga0495676_0045133
817 Ga0495680_0080532
818 Ga0495684_0415877
819 Ga0495602_0223477
820 Ga0496113_0680190
821 Ga0501292_015995
822 Ga0501292_039063
823 Ga0501031_0033868
824 Ga0501031_0185243
825 Ga0501033_0044357
826 Ga0501036_0039661
827 Ga0501036_0340213
828 Ga0501037_0002212
829 Ga0501037_0049715
830 Ga0501038_0002844
831 Ga0501038_0321415
832 Ga0501039_0172171
833 Ga0501040_0000759
834 Ga0501040_0000980
835 Ga0501040_0028681
836 Ga0501041_0000109
837 Ga0501041_0013895
838 Ga0501041_0041698
839 Ga0501041_0154885
840 Ga0501042_0001562
841 Ga0501042_0008480
842 Ga0501042_0196627
843 Ga0501043_0044627
844 Ga0501046_0000953
845 Ga0501046_0001303
846 Ga0501047_0029491
847 Ga0501048_0000190
848 Ga0501048_0000998
849 Ga0501048_0048533
850 Ga0501048_0096975
851 Ga0501068_0005962
852 Ga0501068_0102210
853 Ga0501069_0080001
854 Ga0501070_0040106
855 Ga0501071_0032363
856 Ga0501072_0022921
857 Ga0501072_0052388
858 Ga0501072_0207788
859 Ga0501072_0249211
860 Ga0501072_0358315
861 Ga0501073_0030491
862 Ga0501074_0000599
863 Ga0501074_0012006
864 Ga0501075_0000840
865 Ga0501075_0085938
866 Ga0501075_0097217
867 Ga0501076_0002467
868 Ga0501076_0011375
869 Ga0501076_0022943
870 Ga0501076_0737630
871 Ga0501077_0000262
872 Ga0501077_0715539
873 Ga0501079_0000684
874 Ga0501079_0564560
875 Ga0501079_0566687
876 Ga0501080_0262408
877 Ga0501081_0000356
878 Ga0501081_0008096
879 Ga0501081_0077833
880 Ga0501081_0204063
881 Ga0501083_0238328
882 Ga0501035_0033821
883 Ga0501044_0422141
884 Ga0501045_0000749
885 Ga0501045_0641941
886 Ga0501204_024962
887 nmdc:mga0k408_69853_c1
888 nmdc:mga05p37_102442_c1
889 nmdc:mga05p37_1075_c1
890 nmdc:mga05p37_449484_c1
891 nmdc:mga05p37_558339_c1
892 nmdc:mga05p37_593_c1
893 nmdc:mga05p37_60725_c1
894 nmdc:mga05p37_676505_c1
895 nmdc:mga05p37_802_c1
896 nmdc:mga09592_1668_c1
897 nmdc:mga09592_320_c1
898 nmdc:mga09592_730539_c1
899 nmdc:mga0qj67_116583_c1
900 nmdc:mga0qj67_35658_c1
901 nmdc:mga0qj67_8897_c1
902 nmdc:mga06r32_237317_c1
903 nmdc:mga06r32_277599_c1
904 nmdc:mga06r32_4774_c1
905 nmdc:mga06r32_51199_c1
906 nmdc:mga06r32_55177_c1
907 nmdc:mga08y16_1159_c1
908 nmdc:mga0n895_1129250_c1
909 nmdc:mga0n895_2079_c1
910 nmdc:mga0n895_235554_c1
911 nmdc:mga0n895_364806_c1
912 nmdc:mga0n895_3966_c1
913 nmdc:mga0n895_638450_c1
914 nmdc:mga0n895_68967_c1
915 nmdc:mga0n895_7245_c1
916 nmdc:mga0n895_9449_c1
917 nmdc:mga0n895_94547_c1
918 nmdc:mga0rr50_1180_c1
919 nmdc:mga0rr50_234578_c1
920 nmdc:mga0rr50_292128_c1
921 nmdc:mga0rr50_372680_c1
922 nmdc:mga0rr50_38854_c1
923 nmdc:mga0rr50_4941_c1
924 nmdc:mga08x19_2526_c1
925 nmdc:mga08x19_5016_c1
926 nmdc:mga08x19_514443_c1
927 nmdc:mga08x19_83199_c1
928 nmdc:mga08x19_952_c1
929 nmdc:mga0a205_1403_c1
930 nmdc:mga0a205_18905_c1
931 nmdc:mga0a205_5728_c1
932 nmdc:mga0a205_60213_c1
933 Ga0495612_0173239
934 Ga0501084_0000355
935 Ga0501082_0001347
936 Ga0501082_0004982
937 Ga0501082_0187981
938 Ga0530510_0000864
939 Ga0530510_0001016
940 Ga0530510_0017496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

31

242

0.94

PF01738

DLH

Dienelactone hydrolase family

104

233

0.8

PF03959

FSH1

Serine hydrolase (FSH1)

42

232

0.77

PF00756

Esterase

Putative esterase

12

221

0.66

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

46

237

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cn7-assembly3.cif.gz_C crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form 0.937 4 218
5syn-assembly3.cif.gz_C cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.9353 1 218
6avw-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 l63a 0.933 15 219
6avx-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 f65l 0.9323 16 219
6avv-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 0.9323 15 219
ID Description Score Start End Superfamily
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9466 2 219 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9382 2 219 3.40.50.1820
af_Q5AGD1_2_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9371 1 219 3.40.50.1820
3cn7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9369 4 218 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9335 4 218 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C7G4M2-F1-model_v4 Carboxylesterase 0.9983 113 219 GO:0016787
AF-A0A6L7WQY2-F1-model_v4 Carboxylesterase 0.9915 113 219 GO:0016787
AF-A0A3C1N676-F1-model_v4 Carboxylesterase 0.9914 86 218 GO:0016787
AF-A0A356QKF8-F1-model_v4 Carboxylesterase 0.9913 118 219 GO:0016787
AF-A0A2N2S5L6-F1-model_v4 Carboxylesterase 0.9909 137 219 GO:0016787

Map