F450397

General Info

Members Datasets Scaffolds Average Seq Length
470 279 470 164

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10000492|Ga0099795_100004926
Length 193
Sequence MNEPTVTTETTESARKPVQPTLSLKFLSHGTLESKDLDFTRKFYEEFLGLEVVRASKVSIWCRLGGAHIYVVVQVPEGKKAEMPFLNHNGIDVETEDDVDECHRLAVRDAAIWKLHKISKPMVQHGTYSFYFWDADDNSWEILANPPGGYSWMFERGDQEGVGHMSRKFDRPTSTLRKAPKGSPQGPEGSSQG

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.91
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10012382 3300002244 Bacteria 1421
2 rootH1_10286775 3300003323 Unclassified 2058
3 Ga0058861_11689562 3300004800 Bacteria 666
4 Ga0058860_11407751 3300004801 Bacteria 1044
5 Ga0065704_10116414 3300005289 Bacteria 1854
6 Ga0065707_10391137 3300005295 Bacteria 864
7 Ga0065707_10402014 3300005295 Unclassified 851
8 Ga0070683_100423834 3300005329 Bacteria 1269
9 Ga0070690_100000860 3300005330 Bacteria 15413
10 Ga0068869_100000089 3300005334 Bacteria 41752
11 Ga0070680_100000992 3300005336 Bacteria 20153
12 Ga0070680_100248831 3300005336 Bacteria 1503
13 Ga0070680_100660621 3300005336 Unclassified 899
14 Ga0070682_100054665 3300005337 Bacteria 2506
15 Ga0070682_101303470 3300005337 Bacteria 617
16 Ga0070689_100000185 3300005340 Bacteria 37751
17 Ga0070691_10001436 3300005341 Bacteria 10189
18 Ga0070691_10146490 3300005341 Bacteria 1207
19 Ga0070687_100000160 3300005343 Bacteria 23224
20 Ga0070692_10016739 3300005345 Bacteria 3493
21 Ga0070692_10137846 3300005345 Unclassified 1378
22 Ga0070673_101647428 3300005364 Unclassified 607
23 Ga0070667_100030517 3300005367 Bacteria 4496
24 Ga0070714_100680882 3300005435 Unclassified 991
25 Ga0070713_100264102 3300005436 Bacteria 1574
26 Ga0070713_100980859 3300005436 Bacteria 815
27 Ga0070710_10629355 3300005437 Bacteria 750
28 Ga0070711_100201169 3300005439 Unclassified 1537
29 Ga0070705_100003800 3300005440 Bacteria 7388
30 Ga0070705_100596044 3300005440 Bacteria 854
31 Ga0070705_100843032 3300005440 Unclassified 733
32 Ga0070700_100001045 3300005441 Bacteria 13706
33 Ga0070700_101433018 3300005441 Bacteria 585
34 Ga0070694_100000089 3300005444 Bacteria 43372
35 Ga0070694_100007910 3300005444 Bacteria 6492
36 Ga0070694_100095979 3300005444 Bacteria 2089
37 Ga0070694_100111927 3300005444 Bacteria 1946
38 Ga0070708_100169923 3300005445 Bacteria 2035
39 Ga0070681_10248990 3300005458 Bacteria 1690
40 Ga0070681_10329186 3300005458 Bacteria 1437
41 Ga0070681_10451546 3300005458 Bacteria 1197
42 Ga0070681_10755360 3300005458 Bacteria 889
43 Ga0068867_100001296 3300005459 Bacteria 17265
44 Ga0070706_100097800 3300005467 Bacteria 2726
45 Ga0070707_100266177 3300005468 Bacteria 1667
46 Ga0070699_100049683 3300005518 Bacteria 3630
47 Ga0070699_100261741 3300005518 Bacteria 1547
48 Ga0070699_100889517 3300005518 Bacteria 816
49 Ga0070679_100002498 3300005530 Bacteria 16660
50 Ga0070697_100228373 3300005536 Bacteria 1587
51 Ga0070697_101258611 3300005536 Bacteria 660
52 Ga0068853_100161141 3300005539 Bacteria 2024
53 Ga0070686_100001902 3300005544 Bacteria 11616
54 Ga0070695_100000187 3300005545 Bacteria 29864
55 Ga0070695_100012911 3300005545 Bacteria 5014
56 Ga0070695_100079648 3300005545 Bacteria 2163
57 Ga0070695_100713209 3300005545 Bacteria 797
58 Ga0070695_101681524 3300005545 Unclassified 531
59 Ga0070696_100000077 3300005546 Bacteria 48139
60 Ga0070696_101234400 3300005546 Bacteria 632
61 Ga0070693_100000125 3300005547 Bacteria 34456
62 Ga0070665_100187655 3300005548 Bacteria 2068
63 Ga0070704_100000051 3300005549 Bacteria 37969
64 Ga0070704_100009724 3300005549 Bacteria 5829
65 Ga0070704_100487774 3300005549 Bacteria 1067
66 Ga0070704_100618784 3300005549 Bacteria 953
67 Ga0070704_100984472 3300005549 Bacteria 762
68 Ga0068855_100000741 3300005563 Bacteria 40118
69 Ga0068855_100900104 3300005563 Bacteria 935
70 Ga0068854_100028793 3300005578 Bacteria 3841
71 Ga0068856_100020707 3300005614 Bacteria 6389
72 Ga0070702_100000279 3300005615 Bacteria 17421
73 Ga0068852_100054134 3300005616 Bacteria 3458
74 Ga0068852_101906932 3300005616 Bacteria 616
75 Ga0068859_100095835 3300005617 Bacteria 3020
76 Ga0068859_100297517 3300005617 Unclassified 1707
77 Ga0068864_100246444 3300005618 Bacteria 1657
78 Ga0068864_100603474 3300005618 Bacteria 1065
79 Ga0068866_10001003 3300005718 Bacteria 12396
80 Ga0068861_100002682 3300005719 Bacteria 11658
81 Ga0068861_100019170 3300005719 Bacteria 4886
82 Ga0068861_101016078 3300005719 Bacteria 792
83 Ga0068870_10122733 3300005840 Bacteria 1498
84 Ga0068863_100167053 3300005841 Bacteria 2110
85 Ga0068863_100181739 3300005841 Bacteria 2019
86 Ga0068858_100008811 3300005842 Bacteria 9673
87 Ga0068858_100368641 3300005842 Bacteria 1377
88 Ga0068860_100000810 3300005843 Bacteria 34973
89 Ga0068862_100000622 3300005844 Bacteria 36814
90 Ga0068862_100108172 3300005844 Bacteria 2438
91 Ga0068862_100828921 3300005844 Bacteria 905
92 Ga0081539_10002070 3300005985 Bacteria 30041
93 Ga0070717_11724436 3300006028 Bacteria 567
94 Ga0070715_10121759 3300006163 Bacteria 1245
95 Ga0070716_100443209 3300006173 Unclassified 945
96 Ga0070716_100499518 3300006173 Bacteria 897
97 Ga0070712_100942905 3300006175 Unclassified 745
98 Ga0075367_10688557 3300006178 Bacteria 650
99 Ga0097621_100001434 3300006237 Bacteria 16354
100 Ga0097621_100001482 3300006237 Bacteria 16097
101 Ga0068871_100000440 3300006358 Bacteria 28666
102 Ga0068871_100028092 3300006358 Bacteria 4407
103 Ga0068871_100764360 3300006358 Bacteria 889
104 Ga0075428_100000835 3300006844 Bacteria 32292
105 Ga0075428_100003747 3300006844 Bacteria 16662
106 Ga0075428_100007029 3300006844 Bacteria 12481
107 Ga0075428_100013667 3300006844 Bacteria 9038
108 Ga0075428_100968590 3300006844 Bacteria 901
109 Ga0075430_100006002 3300006846 Bacteria 10253
110 Ga0075430_100135270 3300006846 Bacteria 2054
111 Ga0075430_100172072 3300006846 Bacteria 1802
112 Ga0075430_100507609 3300006846 Bacteria 995
113 Ga0075431_100053056 3300006847 Bacteria 4180
114 Ga0075431_100105693 3300006847 Bacteria 2904
115 Ga0075433_10005345 3300006852 Bacteria 10080
116 Ga0075433_10162035 3300006852 Bacteria 1991
117 Ga0075433_10597828 3300006852 Bacteria 969
118 Ga0075433_11109821 3300006852 Bacteria 688
119 Ga0075434_100000621 3300006871 Bacteria 27353
120 Ga0075434_100444670 3300006871 Bacteria 1317
121 Ga0075434_100498371 3300006871 Bacteria 1239
122 Ga0075434_101203824 3300006871 Bacteria 769
123 Ga0075429_100000096 3300006880 Bacteria 47975
124 Ga0075429_100002189 3300006880 Bacteria 16335
125 Ga0075429_100184364 3300006880 Bacteria 1829
126 Ga0068865_100000149 3300006881 Bacteria 37769
127 Ga0075436_100000816 3300006914 Bacteria 20743
128 Ga0075436_100004243 3300006914 Bacteria 9838
129 Ga0075436_100017171 3300006914 Bacteria 4953
130 Ga0075436_100017505 3300006914 Bacteria 4908
131 Ga0075436_100073560 3300006914 Bacteria 2366
132 Ga0075436_100111971 3300006914 Bacteria 1905
133 Ga0075436_100113533 3300006914 Bacteria 1892
134 Ga0075436_100431587 3300006914 Bacteria 958
135 Ga0075436_100787020 3300006914 Bacteria 708
136 Ga0097620_100095824 3300006931 Bacteria 3020
137 Ga0097620_100297517 3300006931 Unclassified 1707
138 Ga0075435_100000485 3300007076 Bacteria 24143
139 Ga0075435_100479973 3300007076 Bacteria 1074
140 Ga0075435_100703310 3300007076 Bacteria 878
141 Ga0099794_10022318 3300007265 Bacteria 2885
142 Ga0099794_10186835 3300007265 Bacteria 1059
143 Ga0099795_10000492 3300007788 Bacteria 7402
144 Ga0099795_10003252 3300007788 Bacteria 3996
145 Ga0099795_10023076 3300007788 Bacteria 2061
146 Ga0099795_10058906 3300007788 Bacteria 1419
147 Ga0099795_10105280 3300007788 Bacteria 1112
148 Ga0105240_10014876 3300009093 Bacteria 10603
149 Ga0111539_10002236 3300009094 Bacteria 25841
150 Ga0111539_10011170 3300009094 Bacteria 11293
151 Ga0111539_10059879 3300009094 Bacteria 4514
152 Ga0111539_10269961 3300009094 Bacteria 1980
153 Ga0111539_10305262 3300009094 Bacteria 1852
154 Ga0111539_10900023 3300009094 Bacteria 1029
155 Ga0105245_10001124 3300009098 Bacteria 24188
156 Ga0114129_10001405 3300009147 Bacteria 32472
157 Ga0114129_10247277 3300009147 Bacteria 2395
158 Ga0114129_10546229 3300009147 Bacteria 1507
159 Ga0114129_11631338 3300009147 Bacteria 789
160 Ga0114129_11880953 3300009147 Bacteria 726
161 Ga0105243_10000577 3300009148 Bacteria 36910
162 Ga0105241_10108585 3300009174 Bacteria 2218
163 Ga0105248_10071215 3300009177 Bacteria 3905
164 Ga0105248_10667145 3300009177 Bacteria 1173
165 Ga0105237_10385448 3300009545 Unclassified 1406
166 Ga0105237_10465161 3300009545 Bacteria 1271
167 Ga0105238_10035004 3300009551 Bacteria 5108
168 Ga0105238_10268044 3300009551 Bacteria 1688
169 Ga0105238_10831119 3300009551 Bacteria 940
170 Ga0105249_10004287 3300009553 Bacteria 12329
171 Ga0105249_10024471 3300009553 Bacteria 5427
172 Ga0105249_10239532 3300009553 Bacteria 1793
173 Ga0099796_10000631 3300010159 Bacteria 6118
174 Ga0099796_10005641 3300010159 Bacteria 3135
175 Ga0099796_10035371 3300010159 Bacteria 1656
176 Ga0105239_10033302 3300010375 Bacteria 5659
177 Ga0105246_10461604 3300011119 Bacteria 1070
178 Ga0157373_10331235 3300013100 Unclassified 1084
179 Ga0157370_10139492 3300013104 Bacteria 2259
180 Ga0157369_10103733 3300013105 Unclassified 3029
181 Ga0157374_10127898 3300013296 Unclassified 2457
182 Ga0157374_10214402 3300013296 Bacteria 1888
183 Ga0157378_10000498 3300013297 Bacteria 37271
184 Ga0163162_10001032 3300013306 Bacteria 25916
185 Ga0163162_10056768 3300013306 Bacteria 3943
186 Ga0163162_10488994 3300013306 Bacteria 1362
187 Ga0157372_10099411 3300013307 Unclassified 3319
188 Ga0157375_10079271 3300013308 Bacteria 3319
189 Ga0182008_10009089 3300014497 Bacteria 5380
190 Ga0157377_10476294 3300014745 Bacteria 867
191 Ga0157379_10358515 3300014968 Bacteria 1336
192 Ga0157379_11337174 3300014968 Bacteria 693
193 Ga0157376_10000657 3300014969 Bacteria 22340
194 Ga0157376_10002186 3300014969 Bacteria 13177
195 Ga0157376_12057874 3300014969 Unclassified 609
196 Ga0182007_10129245 3300015262 Unclassified 849
197 Ga0197907_11475660 3300020069 Bacteria 841
198 Ga0206356_11549264 3300020070 Bacteria 623
199 Ga0206349_1696049 3300020075 Bacteria 701
200 Ga0206352_11087509 3300020078 Unclassified 874
201 Ga0206350_11266269 3300020080 Unclassified 908
202 Ga0206354_10456289 3300020081 Bacteria 663
203 Ga0213871_10076735 3300021441 Bacteria 952
204 Ga0224712_10065807 3300022467 Bacteria 1458
205 Ga0207688_10023634 3300025901 Bacteria 3368
206 Ga0207643_10137256 3300025908 Bacteria 1459
207 Ga0207684_10132626 3300025910 Bacteria 2138
208 Ga0207684_10500025 3300025910 Bacteria 1042
209 Ga0207654_10056253 3300025911 Bacteria 2281
210 Ga0207654_10170926 3300025911 Unclassified 1411
211 Ga0207707_10523060 3300025912 Unclassified 1010
212 Ga0207707_11118434 3300025912 Bacteria 641
213 Ga0207695_10160598 3300025913 Bacteria 2179
214 Ga0207671_10357531 3300025914 Unclassified 1158
215 Ga0207671_11041832 3300025914 Unclassified 644
216 Ga0207663_10449434 3300025916 Bacteria 994
217 Ga0207660_10520851 3300025917 Bacteria 966
218 Ga0207662_10000099 3300025918 Bacteria 40931
219 Ga0207662_10632405 3300025918 Bacteria 746
220 Ga0207652_10033727 3300025921 Bacteria 4312
221 Ga0207694_10137578 3300025924 Bacteria 1963
222 Ga0207694_10239883 3300025924 Bacteria 1481
223 Ga0207687_10001780 3300025927 Bacteria 14818
224 Ga0207664_10166679 3300025929 Bacteria 1883
225 Ga0207690_10326318 3300025932 Bacteria 1208
226 Ga0207686_10000295 3300025934 Bacteria 36702
227 Ga0207709_10001189 3300025935 Bacteria 18792
228 Ga0207670_10002969 3300025936 Bacteria 8956
229 Ga0207670_10003177 3300025936 Bacteria 8697
230 Ga0207704_10000643 3300025938 Bacteria 15451
231 Ga0207665_10067279 3300025939 Bacteria 2439
232 Ga0207665_10237435 3300025939 Bacteria 1342
233 Ga0207665_10709462 3300025939 Bacteria 791
234 Ga0207711_10380024 3300025941 Bacteria 1310
235 Ga0207689_10000432 3300025942 Bacteria 39235
236 Ga0207689_10262437 3300025942 Bacteria 1429
237 Ga0207667_10002062 3300025949 Bacteria 25186
238 Ga0207712_10002597 3300025961 Bacteria 11596
239 Ga0207640_10023637 3300025981 Bacteria 3696
240 Ga0207658_10038171 3300025986 Bacteria 3458
241 Ga0207677_10000957 3300026023 Bacteria 16029
242 Ga0207677_10158589 3300026023 Bacteria 1755
243 Ga0207703_10000781 3300026035 Bacteria 31328
244 Ga0207639_10500614 3300026041 Bacteria 1110
245 Ga0207639_10944915 3300026041 Bacteria 806
246 Ga0207708_10000412 3300026075 Bacteria 33576
247 Ga0207708_10663207 3300026075 Bacteria 889
248 Ga0207708_11561057 3300026075 Bacteria 580
249 Ga0207702_10033654 3300026078 Bacteria 4282
250 Ga0207702_10168267 3300026078 Bacteria 2007
251 Ga0207702_10859047 3300026078 Unclassified 898
252 Ga0207641_10903091 3300026088 Bacteria 877
253 Ga0207648_10000603 3300026089 Bacteria 40455
254 Ga0207676_10258767 3300026095 Bacteria 1570
255 Ga0207675_100000509 3300026118 Bacteria 37679
256 Ga0207675_100050940 3300026118 Bacteria 3864
257 Ga0207698_10455130 3300026142 Bacteria 1236
258 Ga0207698_11574211 3300026142 Bacteria 673
259 Ga0209179_1012988 3300027512 Bacteria 1505
260 Ga0209179_1087269 3300027512 Bacteria 690
261 Ga0209588_1019337 3300027671 Bacteria 2125
262 Ga0209588_1052629 3300027671 Bacteria 1317
263 Ga0207428_10001166 3300027907 Bacteria 28282
264 Ga0207428_10002355 3300027907 Bacteria 18877
265 Ga0207428_10357706 3300027907 Bacteria 1073
266 Ga0268266_10002056 3300028379 Bacteria 22316
267 Ga0268265_10077538 3300028380 Bacteria 2610
268 Ga0268265_10132994 3300028380 Bacteria 2070
269 Ga0268264_10003270 3300028381 Bacteria 14013
270 Ga0268264_12068407 3300028381 Bacteria 578
271 Ga0307515_10107076 3300028794 Bacteria 3309
272 Ga0307515_10161617 3300028794 Bacteria 2281
273 Ga0265338_10009227 3300028800 Bacteria 11807
274 Ga0307511_10000037 3300030521 Bacteria 103008
275 Ga0307513_10076951 3300031456 Bacteria 3458
276 Ga0307509_10000034 3300031507 Bacteria 193380
277 Ga0307516_10000405 3300031730 Bacteria 56495
278 Ga0307411_10556133 3300032005 Unclassified 980
279 Ga0307510_10000017 3300033180 Bacteria 195521
280 Ga0373948_0015591 3300034817 Bacteria 1397
281 Ga0373926_0109358 3300035083 Bacteria 1037
282 Ga0373929_0079750 3300035085 Bacteria 796
283 Ga0373929_0136479 3300035085 Bacteria 647
284 Ga0373934_0000261 3300035086 Bacteria 18894
285 Ga0373934_0079909 3300035086 Bacteria 1313
286 Ga0373940_0002562 3300035088 Bacteria 3556
287 Ga0373944_0007164 3300035089 Bacteria 2982
288 Ga0373944_0064818 3300035089 Bacteria 1179
289 Ga0373949_0038401 3300035090 Bacteria 1168
290 Ga0373951_0009204 3300035091 Bacteria 2225
291 Ga0373952_0002352 3300035092 Bacteria 3405
292 Ga0373923_0025167 3300035111 Bacteria 2356
293 Ga0373932_0020217 3300035112 Bacteria 1743
294 Ga0373936_0003251 3300035113 Bacteria 6090
295 Ga0373936_0019128 3300035113 Bacteria 2652
296 Ga0373936_0030740 3300035113 Unclassified 2118
297 Ga0373941_0322876 3300035115 Bacteria 621
298 Ga0373945_0000602 3300035116 Bacteria 10312
299 Ga0373953_0030998 3300035117 Bacteria 2077
300 Ga0373954_0000624 3300035118 Bacteria 13491
301 Ga0373954_0019279 3300035118 Bacteria 3076
302 Ga0373954_0146851 3300035118 Bacteria 1151
303 Ga0373956_0000228 3300035119 Bacteria 22321
304 Ga0373956_0078337 3300035119 Bacteria 1513
305 Ga0373960_0005881 3300035121 Bacteria 2855
306 Ga0373943_0001169 3300035170 Bacteria 11703
307 Ga0373943_0264772 3300035170 Bacteria 968
308 Ga0373946_0013960 3300035171 Bacteria 3025
309 Ga0373946_0038216 3300035171 Bacteria 1954
310 Ga0373955_0001679 3300035172 Bacteria 9462
311 Ga0373955_0050066 3300035172 Bacteria 2270
312 Ga0373955_0085015 3300035172 Bacteria 1795
313 Ga0373955_0113230 3300035172 Bacteria 1570
314 Ga0373942_0005539 3300035207 Bacteria 2925
315 Ga0373942_0099341 3300035207 Bacteria 887
316 Ga0373961_0002916 3300035241 Bacteria 4333
317 Ga0373962_0027604 3300035242 Bacteria 1536
318 Ga0373924_0002936 3300035410 Bacteria 5787
319 Ga0373931_0000606 3300035691 Bacteria 14835
320 Ga0373931_0022809 3300035691 Bacteria 3153
321 Ga0373935_0021934 3300035692 Bacteria 3910
322 Ga0373935_0123912 3300035692 Unclassified 1729
323 Ga0373935_0844691 3300035692 Unclassified 677
324 Ga0373927_0004471 3300035695 Bacteria 9781
325 Ga0373933_0000949 3300035724 Bacteria 17679
326 Ga0373933_0045246 3300035724 Bacteria 2609
327 Ga0373947_0055464 3300035725 Bacteria 2393
328 Ga0373937_0001064 3300036401 Bacteria 23171
329 Ga0373937_0049498 3300036401 Bacteria 3848
330 Ga0373937_0063925 3300036401 Bacteria 3384
331 Ga0373925_0890525 3300037068 Bacteria 733
332 Ga0395898_0680885 3300037466 Bacteria 971
333 Ga0395901_0948743 3300038443 Bacteria 839
334 Ga0436365_1408220 3300039437 Bacteria 1664
335 Ga0436360_0931085 3300039438 Bacteria 722
336 Ga0436360_1374889 3300039438 Unclassified 936
337 Ga0436361_0867018 3300039447 Unclassified 1448
338 Ga0436363_1079999 3300039450 Bacteria 876
339 Ga0436363_1643033 3300039450 Bacteria 886
340 Ga0436362_0281401 3300039453 Bacteria 3315
341 Ga0439460_0025926 3300042461 Unclassified 1637
342 Ga0450893_0038782 3300042532 Bacteria 868
343 Ga0451577_0052167 3300042876 Bacteria 3652
344 Ga0466960_0885399 3300044901 Bacteria 544
345 Ga0451576_0086333 3300045051 Bacteria 3263
346 Ga0451576_0489558 3300045051 Bacteria 1292
347 Ga0451576_1046601 3300045051 Bacteria 855
348 Ga0466967_0292296 3300045976 Unclassified 1566
349 Ga0495592_0058878 3300046454 Bacteria 2831
350 Ga0495603_0100275 3300046455 Bacteria 1691
351 Ga0495629_0075499 3300046459 Bacteria 2354
352 Ga0495638_0021365 3300046460 Bacteria 4268
353 Ga0495651_0000326 3300046462 Bacteria 36974
354 Ga0495651_0129674 3300046462 Bacteria 1842
355 Ga0495651_0504817 3300046462 Unclassified 774
356 Ga0495653_0130993 3300046463 Bacteria 1775
357 Ga0495653_0296428 3300046463 Bacteria 1056
358 Ga0495580_0007277 3300046472 Bacteria 8900
359 Ga0495580_0259446 3300046472 Bacteria 1188
360 Ga0495639_0045601 3300046475 Bacteria 1983
361 Ga0495664_0064700 3300046477 Bacteria 2180
362 Ga0495618_0162432 3300046514 Bacteria 1423
363 Ga0495628_0006239 3300046516 Bacteria 10418
364 Ga0495630_0002086 3300046517 Bacteria 13901
365 Ga0495630_0718623 3300046517 Bacteria 764
366 Ga0495666_0019471 3300046526 Bacteria 3368
367 Ga0495652_0053645 3300046529 Bacteria 3435
368 Ga0495586_0003378 3300046535 Bacteria 8561
369 Ga0495586_0011335 3300046535 Bacteria 4740
370 Ga0495587_0010269 3300046536 Bacteria 5968
371 Ga0495598_0198640 3300046537 Bacteria 723
372 Ga0495622_0057478 3300046557 Bacteria 1803
373 Ga0495667_0032102 3300046559 Bacteria 3521
374 Ga0495656_0241925 3300046615 Bacteria 909
375 Ga0495634_0006738 3300046642 Bacteria 8701
376 Ga0495611_0106525 3300046648 Unclassified 1304
377 Ga0495625_0255178 3300046660 Bacteria 1137
378 Ga0495635_0034834 3300046663 Bacteria 3492
379 Ga0495659_0069319 3300046664 Bacteria 1319
380 Ga0495659_0326400 3300046664 Bacteria 652
381 Ga0495588_0068442 3300046674 Bacteria 1844
382 Ga0495657_0050015 3300046675 Bacteria 2812
383 Ga0495599_0062236 3300046678 Bacteria 2331
384 Ga0495599_0645910 3300046678 Unclassified 613
385 Ga0495646_0072598 3300046680 Bacteria 2024
386 Ga0495647_0000224 3300046681 Bacteria 15334
387 Ga0495647_0000729 3300046681 Bacteria 9723
388 Ga0495658_0002293 3300046683 Bacteria 9651
389 Ga0495600_0025721 3300046809 Bacteria 3793
390 Ga0495604_0097170 3300047317 Bacteria 2172
391 Ga0495604_0103843 3300047317 Bacteria 2084
392 Ga0495636_0122593 3300047318 Bacteria 1151
393 Ga0495674_0004157 3300047319 Bacteria 13973
394 Ga0495676_0028037 3300047321 Bacteria 4819
395 Ga0495680_0015504 3300047322 Bacteria 6573
396 Ga0495680_0096424 3300047322 Bacteria 2209
397 Ga0495680_0935402 3300047322 Bacteria 558
398 Ga0495675_0069741 3300047444 Bacteria 2219
399 Ga0495675_0116712 3300047444 Bacteria 1664
400 Ga0495684_0021786 3300047471 Bacteria 4933
401 Ga0496101_0798624 3300048904 Unclassified 744
402 Ga0496102_0239909 3300048905 Bacteria 1709
403 Ga0496104_0116910 3300048907 Unclassified 2559
404 Ga0496105_0393121 3300048908 Bacteria 1102
405 Ga0496106_0092034 3300048909 Bacteria 2342
406 Ga0496106_0371787 3300048909 Bacteria 1149
407 Ga0496110_0828606 3300048913 Unclassified 830
408 Ga0496115_0012120 3300048918 Bacteria 6483
409 Ga0496115_0089230 3300048918 Bacteria 2518
410 Ga0496116_0044113 3300048919 Bacteria 3032
411 Ga0496117_0000110 3300048920 Bacteria 184627
412 Ga0496118_0000170 3300048921 Bacteria 117661
413 Ga0496119_0044898 3300048922 Bacteria 2776
414 Ga0496121_0261833 3300048924 Bacteria 1193
415 Ga0496124_0077445 3300048927 Bacteria 2742
416 Ga0496125_0008193 3300048928 Bacteria 10996
417 Ga0501031_0084450 3300049568 Unclassified 2070
418 Ga0501036_0057802 3300049572 Unclassified 3286
419 Ga0501036_0609690 3300049572 Bacteria 905
420 Ga0501042_0844985 3300049578 Bacteria 666
421 Ga0501047_0065521 3300049581 Bacteria 3502
422 Ga0501048_0455389 3300049582 Bacteria 916
423 Ga0501069_0163831 3300049585 Bacteria 1281
424 Ga0501069_0198621 3300049585 Bacteria 1162
425 Ga0501073_0781721 3300049589 Bacteria 658
426 Ga0501073_0896624 3300049589 Unclassified 611
427 Ga0501076_0146247 3300049592 Unclassified 1922
428 Ga0501080_0442644 3300049742 Bacteria 1166
429 Ga0501044_0056279 3300049823 Bacteria 4038
430 Ga0501045_1002235 3300049824 Unclassified 612
431 nmdc:mga06z11_222064_c1 3300050494 Bacteria 1104
432 nmdc:mga05p37_331_c1 3300050507 Bacteria 50709
433 nmdc:mga05p37_950894_c1 3300050507 Bacteria 919
434 nmdc:mga09592_11958_c1 3300050508 Bacteria 7061
435 nmdc:mga09592_27331_c1 3300050508 Bacteria 4734
436 nmdc:mga09592_618_c1 3300050508 Bacteria 27081
437 nmdc:mga09592_73244_c1 3300050508 Bacteria 2910
438 nmdc:mga0qj67_367938_c1 3300050509 Bacteria 1161
439 nmdc:mga0qj67_37210_c1 3300050509 Bacteria 3811
440 nmdc:mga0qj67_449487_c1 3300050509 Bacteria 1038
441 nmdc:mga0qj67_89219_c1 3300050509 Bacteria 2476
442 nmdc:mga06r32_128167_c1 3300050510 Bacteria 2508
443 nmdc:mga06r32_84325_c1 3300050510 Bacteria 3097
444 nmdc:mga08y16_10906_c1 3300050511 Bacteria 9545
445 nmdc:mga08y16_127415_c1 3300050511 Bacteria 2648
446 nmdc:mga08y16_319300_c1 3300050511 Bacteria 1599
447 nmdc:mga08y16_4836_c1 3300050511 Bacteria 14056
448 nmdc:mga08y16_631_c1 3300050511 Bacteria 33026
449 nmdc:mga0n895_125746_c1 3300050512 Bacteria 2588
450 nmdc:mga0n895_1564037_c1 3300050512 Bacteria 624
451 nmdc:mga0n895_221776_c1 3300050512 Bacteria 1919
452 nmdc:mga0n895_298808_c1 3300050512 Bacteria 1632
453 nmdc:mga0n895_330859_c1 3300050512 Bacteria 1544
454 nmdc:mga0n895_614565_c1 3300050512 Unclassified 1088
455 nmdc:mga0rr50_206279_c1 3300050513 Unclassified 1282
456 nmdc:mga0rr50_792432_c1 3300050513 Bacteria 809
457 nmdc:mga08x19_140127_c1 3300050514 Unclassified 1633
458 nmdc:mga08x19_2046_c1 3300050514 Bacteria 12365
459 nmdc:mga08x19_40153_c1 3300050514 Bacteria 2977
460 nmdc:mga08x19_50991_c1 3300050514 Bacteria 2657
461 nmdc:mga08x19_568464_c1 3300050514 Bacteria 803
462 nmdc:mga08x19_6631_c1 3300050514 Bacteria 6865
463 nmdc:mga08x19_79825_c1 3300050514 Bacteria 2146
464 nmdc:mga0a205_215429_c1 3300050515 Bacteria 1807
465 nmdc:mga0a205_23471_c1 3300050515 Bacteria 5852
466 nmdc:mga0a205_577109_c1 3300050515 Bacteria 978
467 nmdc:mga0a205_584666_c1 3300050515 Bacteria 970
468 Ga0495612_0062404 3300053078 Bacteria 1545
469 Ga0495595_0040214 3300053084 Bacteria 2136
470 Ga0495619_0080401 3300053085 Bacteria 2193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035085 Ga0373929_0136479 Ga0373929_0136479_146_628 146
2 3300048924 Ga0496121_0261833 Ga0496121_0261833_691_1164 146
3 3300049568 Ga0501031_0084450 Ga0501031_0084450_1068_1556 150
4 3300049824 Ga0501045_1002235 Ga0501045_1002235_35_523 150
5 3300005444 Ga0070694_100007910 Ga0070694_1000079103 151
6 3300005545 Ga0070695_100012911 Ga0070695_1000129115 151
7 3300021441 Ga0213871_10076735 Ga0213871_100767352 151
8 3300038443 Ga0395901_0948743 Ga0395901_0948743_33_497 151
9 3300039438 Ga0436360_0931085 Ga0436360_0931085_85_621 151
10 3300039438 Ga0436360_1374889 Ga0436360_1374889_162_692 151
11 3300042876 Ga0451577_0052167 Ga0451577_0052167_3069_3590 151
12 3300049581 Ga0501047_0065521 Ga0501047_0065521_56_580 151
13 3300049589 Ga0501073_0781721 Ga0501073_0781721_10_534 151
14 3300049742 Ga0501080_0442644 Ga0501080_0442644_571_1095 151
15 3300049823 Ga0501044_0056279 Ga0501044_0056279_3096_3620 151
16 3300005436 Ga0070713_100264102 Ga0070713_1002641022 152
17 3300005440 Ga0070705_100843032 Ga0070705_1008430321 152
18 3300005444 Ga0070694_100095979 Ga0070694_1000959792 152
19 3300005536 Ga0070697_101258611 Ga0070697_1012586111 152
20 3300005545 Ga0070695_100079648 Ga0070695_1000796483 152
21 3300006028 Ga0070717_11724436 Ga0070717_117244361 152
22 3300006852 Ga0075433_10162035 Ga0075433_101620352 152
23 3300006871 Ga0075434_100444670 Ga0075434_1004446702 152
24 3300006914 Ga0075436_100017171 Ga0075436_1000171715 152
25 3300006914 Ga0075436_100073560 Ga0075436_1000735603 152
26 3300007076 Ga0075435_100703310 Ga0075435_1007033101 152
27 3300009147 Ga0114129_10546229 Ga0114129_105462292 152
28 3300046664 Ga0495659_0069319 Ga0495659_0069319_74_547 152
29 3300047318 Ga0495636_0122593 Ga0495636_0122593_492_965 152
30 3300050512 nmdc:mga0n895_330859_c1 nmdc:mga0n895_330859_c1_636_1109 152
31 3300050513 nmdc:mga0rr50_792432_c1 nmdc:mga0rr50_792432_c1_28_501 152
32 3300050514 nmdc:mga08x19_50991_c1 nmdc:mga08x19_50991_c1_1342_1815 152
33 3300050514 nmdc:mga08x19_79825_c1 nmdc:mga08x19_79825_c1_41_514 152
34 3300050515 nmdc:mga0a205_215429_c1 nmdc:mga0a205_215429_c1_76_549 152
35 3300006871 Ga0075434_101203824 Ga0075434_1012038242 154
36 3300010159 Ga0099796_10005641 Ga0099796_100056414 154
37 3300031507 Ga0307509_10000034 Ga0307509_1000003453 154
38 3300035113 Ga0373936_0030740 Ga0373936_0030740_873_1373 154
39 3300035207 Ga0373942_0099341 Ga0373942_0099341_72_557 154
40 3300039450 Ga0436363_1079999 Ga0436363_1079999_66_551 154
41 3300046648 Ga0495611_0106525 Ga0495611_0106525_56_556 154
42 3300005435 Ga0070714_100680882 Ga0070714_1006808822 155
43 3300005437 Ga0070710_10629355 Ga0070710_106293552 155
44 3300005440 Ga0070705_100596044 Ga0070705_1005960442 155
45 3300006173 Ga0070716_100443209 Ga0070716_1004432092 155
46 3300006914 Ga0075436_100017505 Ga0075436_1000175054 155
47 3300025929 Ga0207664_10166679 Ga0207664_101666793 155
48 3300025939 Ga0207665_10237435 Ga0207665_102374352 155
49 3300050514 nmdc:mga08x19_140127_c1 nmdc:mga08x19_140127_c1_334_801 155
50 3300003323 rootH1_10286775 rootH1_102867752 156
51 3300004800 Ga0058861_11689562 Ga0058861_116895622 156
52 3300005329 Ga0070683_100423834 Ga0070683_1004238341 156
53 3300005336 Ga0070680_100248831 Ga0070680_1002488312 156
54 3300005336 Ga0070680_100660621 Ga0070680_1006606212 156
55 3300005337 Ga0070682_101303470 Ga0070682_1013034701 156
56 3300005341 Ga0070691_10146490 Ga0070691_101464901 156
57 3300005345 Ga0070692_10137846 Ga0070692_101378462 156
58 3300005367 Ga0070667_100030517 Ga0070667_1000305175 156
59 3300005436 Ga0070713_100980859 Ga0070713_1009808591 156
60 3300005439 Ga0070711_100201169 Ga0070711_1002011692 156
61 3300005458 Ga0070681_10248990 Ga0070681_102489902 156
62 3300005458 Ga0070681_10451546 Ga0070681_104515462 156
63 3300005467 Ga0070706_100097800 Ga0070706_1000978002 156
64 3300005518 Ga0070699_100049683 Ga0070699_1000496832 156
65 3300005518 Ga0070699_100261741 Ga0070699_1002617411 156
66 3300005518 Ga0070699_100889517 Ga0070699_1008895171 156
67 3300005539 Ga0068853_100161141 Ga0068853_1001611412 156
68 3300005545 Ga0070695_101681524 Ga0070695_1016815241 156
69 3300005546 Ga0070696_101234400 Ga0070696_1012344001 156
70 3300005548 Ga0070665_100187655 Ga0070665_1001876553 156
71 3300005549 Ga0070704_100487774 Ga0070704_1004877742 156
72 3300005549 Ga0070704_100618784 Ga0070704_1006187842 156
73 3300005563 Ga0068855_100900104 Ga0068855_1009001041 156
74 3300005616 Ga0068852_101906932 Ga0068852_1019069321 156
75 3300005618 Ga0068864_100603474 Ga0068864_1006034742 156
76 3300005719 Ga0068861_100019170 Ga0068861_1000191703 156
77 3300005719 Ga0068861_101016078 Ga0068861_1010160781 156
78 3300005844 Ga0068862_100108172 Ga0068862_1001081722 156
79 3300005985 Ga0081539_10002070 Ga0081539_1000207021 156
80 3300006173 Ga0070716_100499518 Ga0070716_1004995182 156
81 3300006175 Ga0070712_100942905 Ga0070712_1009429052 156
82 3300006178 Ga0075367_10688557 Ga0075367_106885571 156
83 3300006237 Ga0097621_100001482 Ga0097621_1000014827 156
84 3300006358 Ga0068871_100028092 Ga0068871_1000280924 156
85 3300006844 Ga0075428_100007029 Ga0075428_10000702914 156
86 3300006844 Ga0075428_100013667 Ga0075428_1000136673 156
87 3300006846 Ga0075430_100006002 Ga0075430_1000060029 156
88 3300006846 Ga0075430_100135270 Ga0075430_1001352703 156
89 3300006847 Ga0075431_100053056 Ga0075431_1000530561 156
90 3300006847 Ga0075431_100105693 Ga0075431_1001056933 156
91 3300006880 Ga0075429_100184364 Ga0075429_1001843644 156
92 3300006914 Ga0075436_100111971 Ga0075436_1001119712 156
93 3300006914 Ga0075436_100787020 Ga0075436_1007870202 156
94 3300007076 Ga0075435_100479973 Ga0075435_1004799732 156
95 3300007788 Ga0099795_10000492 Ga0099795_100004926 156
96 3300007788 Ga0099795_10023076 Ga0099795_100230762 156
97 3300007788 Ga0099795_10058906 Ga0099795_100589063 156
98 3300009093 Ga0105240_10014876 Ga0105240_1001487610 156
99 3300009094 Ga0111539_10011170 Ga0111539_100111709 156
100 3300009094 Ga0111539_10305262 Ga0111539_103052622 156
101 3300009094 Ga0111539_10900023 Ga0111539_109000231 156
102 3300009147 Ga0114129_11631338 Ga0114129_116313381 156
103 3300009147 Ga0114129_11880953 Ga0114129_118809532 156
104 3300009177 Ga0105248_10667145 Ga0105248_106671452 156
105 3300009545 Ga0105237_10385448 Ga0105237_103854482 156
106 3300009545 Ga0105237_10465161 Ga0105237_104651612 156
107 3300009551 Ga0105238_10035004 Ga0105238_100350045 156
108 3300009551 Ga0105238_10268044 Ga0105238_102680442 156
109 3300009551 Ga0105238_10831119 Ga0105238_108311191 156
110 3300009553 Ga0105249_10004287 Ga0105249_100042876 156
111 3300009553 Ga0105249_10239532 Ga0105249_102395321 156
112 3300010159 Ga0099796_10000631 Ga0099796_100006313 156
113 3300010159 Ga0099796_10035371 Ga0099796_100353712 156
114 3300013100 Ga0157373_10331235 Ga0157373_103312351 156
115 3300013104 Ga0157370_10139492 Ga0157370_101394924 156
116 3300013105 Ga0157369_10103733 Ga0157369_101037334 156
117 3300013296 Ga0157374_10127898 Ga0157374_101278982 156
118 3300013296 Ga0157374_10214402 Ga0157374_102144023 156
119 3300013306 Ga0163162_10001032 Ga0163162_1000103212 156
120 3300013306 Ga0163162_10488994 Ga0163162_104889942 156
121 3300013307 Ga0157372_10099411 Ga0157372_100994112 156
122 3300013308 Ga0157375_10079271 Ga0157375_100792713 156
123 3300014497 Ga0182008_10009089 Ga0182008_100090899 156
124 3300014969 Ga0157376_10000657 Ga0157376_1000065715 156
125 3300014969 Ga0157376_12057874 Ga0157376_120578741 156
126 3300015262 Ga0182007_10129245 Ga0182007_101292452 156
127 3300020069 Ga0197907_11475660 Ga0197907_114756601 156
128 3300020070 Ga0206356_11549264 Ga0206356_115492641 156
129 3300020075 Ga0206349_1696049 Ga0206349_16960491 156
130 3300020078 Ga0206352_11087509 Ga0206352_110875091 156
131 3300020080 Ga0206350_11266269 Ga0206350_112662691 156
132 3300020081 Ga0206354_10456289 Ga0206354_104562891 156
133 3300022467 Ga0224712_10065807 Ga0224712_100658072 156
134 3300025910 Ga0207684_10132626 Ga0207684_101326263 156
135 3300025910 Ga0207684_10500025 Ga0207684_105000252 156
136 3300025911 Ga0207654_10170926 Ga0207654_101709262 156
137 3300025912 Ga0207707_11118434 Ga0207707_111184341 156
138 3300025913 Ga0207695_10160598 Ga0207695_101605983 156
139 3300025914 Ga0207671_10357531 Ga0207671_103575312 156
140 3300025914 Ga0207671_11041832 Ga0207671_110418321 156
141 3300025916 Ga0207663_10449434 Ga0207663_104494342 156
142 3300025917 Ga0207660_10520851 Ga0207660_105208511 156
143 3300025924 Ga0207694_10137578 Ga0207694_101375783 156
144 3300025924 Ga0207694_10239883 Ga0207694_102398832 156
145 3300025932 Ga0207690_10326318 Ga0207690_103263183 156
146 3300025939 Ga0207665_10067279 Ga0207665_100672792 156
147 3300025986 Ga0207658_10038171 Ga0207658_100381713 156
148 3300026041 Ga0207639_10944915 Ga0207639_109449152 156
149 3300026078 Ga0207702_10859047 Ga0207702_108590471 156
150 3300026118 Ga0207675_100050940 Ga0207675_1000509403 156
151 3300026142 Ga0207698_11574211 Ga0207698_115742111 156
152 3300027512 Ga0209179_1012988 Ga0209179_10129882 156
153 3300027512 Ga0209179_1087269 Ga0209179_10872691 156
154 3300028379 Ga0268266_10002056 Ga0268266_1000205615 156
155 3300028380 Ga0268265_10077538 Ga0268265_100775383 156
156 3300028794 Ga0307515_10107076 Ga0307515_101070763 156
157 3300028794 Ga0307515_10161617 Ga0307515_101616172 156
158 3300028800 Ga0265338_10009227 Ga0265338_100092276 156
159 3300030521 Ga0307511_10000037 Ga0307511_100000379 156
160 3300031456 Ga0307513_10076951 Ga0307513_100769514 156
161 3300031730 Ga0307516_10000405 Ga0307516_1000040535 156
162 3300032005 Ga0307411_10556133 Ga0307411_105561332 156
163 3300033180 Ga0307510_10000017 Ga0307510_10000017116 156
164 3300035118 Ga0373954_0146851 Ga0373954_0146851_263_781 156
165 3300035172 Ga0373955_0113230 Ga0373955_0113230_152_670 156
166 3300035692 Ga0373935_0844691 Ga0373935_0844691_140_658 156
167 3300036401 Ga0373937_0049498 Ga0373937_0049498_378_896 156
168 3300037466 Ga0395898_0680885 Ga0395898_0680885_377_901 156
169 3300039437 Ga0436365_1408220 Ga0436365_1408220_76_588 156
170 3300039447 Ga0436361_0867018 Ga0436361_0867018_302_832 156
171 3300039450 Ga0436363_1643033 Ga0436363_1643033_344_814 156
172 3300039453 Ga0436362_0281401 Ga0436362_0281401_1286_1798 156
173 3300042461 Ga0439460_0025926 Ga0439460_0025926_224_757 156
174 3300042532 Ga0450893_0038782 Ga0450893_0038782_282_815 156
175 3300045976 Ga0466967_0292296 Ga0466967_0292296_161_685 156
176 3300046460 Ga0495638_0021365 Ga0495638_0021365_2598_3149 156
177 3300046660 Ga0495625_0255178 Ga0495625_0255178_366_917 156
178 3300048904 Ga0496101_0798624 Ga0496101_0798624_14_520 156
179 3300048905 Ga0496102_0239909 Ga0496102_0239909_952_1479 156
180 3300048907 Ga0496104_0116910 Ga0496104_0116910_817_1323 156
181 3300048908 Ga0496105_0393121 Ga0496105_0393121_107_613 156
182 3300048909 Ga0496106_0371787 Ga0496106_0371787_199_705 156
183 3300048913 Ga0496110_0828606 Ga0496110_0828606_95_622 156
184 3300048918 Ga0496115_0012120 Ga0496115_0012120_1127_1633 156
185 3300048918 Ga0496115_0089230 Ga0496115_0089230_1431_1955 156
186 3300048919 Ga0496116_0044113 Ga0496116_0044113_692_1219 156
187 3300048920 Ga0496117_0000110 Ga0496117_0000110_23550_24077 156
188 3300048921 Ga0496118_0000170 Ga0496118_0000170_18154_18681 156
189 3300048922 Ga0496119_0044898 Ga0496119_0044898_1592_2119 156
190 3300048927 Ga0496124_0077445 Ga0496124_0077445_2026_2553 156
191 3300048928 Ga0496125_0008193 Ga0496125_0008193_1730_2257 156
192 3300049572 Ga0501036_0057802 Ga0501036_0057802_1879_2412 156
193 3300049572 Ga0501036_0609690 Ga0501036_0609690_319_870 156
194 3300049578 Ga0501042_0844985 Ga0501042_0844985_103_636 156
195 3300049582 Ga0501048_0455389 Ga0501048_0455389_330_863 156
196 3300049585 Ga0501069_0163831 Ga0501069_0163831_353_826 156
197 3300049589 Ga0501073_0896624 Ga0501073_0896624_69_581 156
198 3300049592 Ga0501076_0146247 Ga0501076_0146247_1289_1822 156
199 3300050494 nmdc:mga06z11_222064_c1 nmdc:mga06z11_222064_c1_456_980 156
200 3300050507 nmdc:mga05p37_950894_c1 nmdc:mga05p37_950894_c1_60_530 156
201 3300050508 nmdc:mga09592_27331_c1 nmdc:mga09592_27331_c1_4118_4651 156
202 3300050508 nmdc:mga09592_73244_c1 nmdc:mga09592_73244_c1_22_561 156
203 3300050509 nmdc:mga0qj67_37210_c1 nmdc:mga0qj67_37210_c1_1491_2030 156
204 3300050509 nmdc:mga0qj67_89219_c1 nmdc:mga0qj67_89219_c1_790_1323 156
205 3300050510 nmdc:mga06r32_128167_c1 nmdc:mga06r32_128167_c1_1698_2231 156
206 3300050510 nmdc:mga06r32_84325_c1 nmdc:mga06r32_84325_c1_709_1248 156
207 3300050511 nmdc:mga08y16_10906_c1 nmdc:mga08y16_10906_c1_6622_7161 156
208 3300050511 nmdc:mga08y16_127415_c1 nmdc:mga08y16_127415_c1_995_1528 156
209 3300050512 nmdc:mga0n895_1564037_c1 nmdc:mga0n895_1564037_c1_78_551 156
210 3300050512 nmdc:mga0n895_221776_c1 nmdc:mga0n895_221776_c1_221_712 156
211 3300050514 nmdc:mga08x19_40153_c1 nmdc:mga08x19_40153_c1_724_1200 156
212 3300050514 nmdc:mga08x19_568464_c1 nmdc:mga08x19_568464_c1_309_782 156
213 3300050514 nmdc:mga08x19_6631_c1 nmdc:mga08x19_6631_c1_3963_4433 156
214 3300050515 nmdc:mga0a205_577109_c1 nmdc:mga0a205_577109_c1_467_943 156
215 3300006844 Ga0075428_100003747 Ga0075428_10000374710 157
216 3300006880 Ga0075429_100002189 Ga0075429_10000218911 157
217 3300009094 Ga0111539_10002236 Ga0111539_1000223624 157
218 3300009147 Ga0114129_10247277 Ga0114129_102472772 157
219 3300027907 Ga0207428_10002355 Ga0207428_1000235512 157
220 3300035118 Ga0373954_0019279 Ga0373954_0019279_1838_2314 157
221 3300046674 Ga0495588_0068442 Ga0495588_0068442_1266_1739 157
222 3300046678 Ga0495599_0645910 Ga0495599_0645910_127_603 157
223 3300050508 nmdc:mga09592_11958_c1 nmdc:mga09592_11958_c1_1800_2294 157
224 3300050511 nmdc:mga08y16_631_c1 nmdc:mga08y16_631_c1_11598_12092 157
225 3300002244 JGI24742J22300_10012382 JGI24742J22300_100123822 158
226 3300004801 Ga0058860_11407751 Ga0058860_114077511 158
227 3300005289 Ga0065704_10116414 Ga0065704_101164144 158
228 3300005295 Ga0065707_10391137 Ga0065707_103911372 158
229 3300005295 Ga0065707_10402014 Ga0065707_104020142 158
230 3300005330 Ga0070690_100000860 Ga0070690_10000086014 158
231 3300005334 Ga0068869_100000089 Ga0068869_10000008916 158
232 3300005336 Ga0070680_100000992 Ga0070680_10000099217 158
233 3300005337 Ga0070682_100054665 Ga0070682_1000546653 158
234 3300005340 Ga0070689_100000185 Ga0070689_10000018521 158
235 3300005341 Ga0070691_10001436 Ga0070691_100014369 158
236 3300005343 Ga0070687_100000160 Ga0070687_10000016014 158
237 3300005345 Ga0070692_10016739 Ga0070692_100167392 158
238 3300005364 Ga0070673_101647428 Ga0070673_1016474281 158
239 3300005440 Ga0070705_100003800 Ga0070705_1000038006 158
240 3300005441 Ga0070700_100001045 Ga0070700_10000104510 158
241 3300005441 Ga0070700_101433018 Ga0070700_1014330181 158
242 3300005444 Ga0070694_100000089 Ga0070694_10000008924 158
243 3300005444 Ga0070694_100111927 Ga0070694_1001119272 158
244 3300005445 Ga0070708_100169923 Ga0070708_1001699232 158
245 3300005458 Ga0070681_10329186 Ga0070681_103291862 158
246 3300005458 Ga0070681_10755360 Ga0070681_107553602 158
247 3300005459 Ga0068867_100001296 Ga0068867_10000129615 158
248 3300005468 Ga0070707_100266177 Ga0070707_1002661772 158
249 3300005530 Ga0070679_100002498 Ga0070679_1000024987 158
250 3300005536 Ga0070697_100228373 Ga0070697_1002283732 158
251 3300005544 Ga0070686_100001902 Ga0070686_10000190210 158
252 3300005545 Ga0070695_100000187 Ga0070695_10000018725 158
253 3300005545 Ga0070695_100713209 Ga0070695_1007132091 158
254 3300005546 Ga0070696_100000077 Ga0070696_10000007715 158
255 3300005547 Ga0070693_100000125 Ga0070693_10000012524 158
256 3300005549 Ga0070704_100000051 Ga0070704_10000005114 158
257 3300005549 Ga0070704_100009724 Ga0070704_1000097246 158
258 3300005549 Ga0070704_100984472 Ga0070704_1009844722 158
259 3300005563 Ga0068855_100000741 Ga0068855_10000074127 158
260 3300005578 Ga0068854_100028793 Ga0068854_1000287932 158
261 3300005614 Ga0068856_100020707 Ga0068856_1000207075 158
262 3300005615 Ga0070702_100000279 Ga0070702_1000002794 158
263 3300005616 Ga0068852_100054134 Ga0068852_1000541342 158
264 3300005617 Ga0068859_100095835 Ga0068859_1000958352 158
265 3300005617 Ga0068859_100297517 Ga0068859_1002975174 158
266 3300005618 Ga0068864_100246444 Ga0068864_1002464441 158
267 3300005718 Ga0068866_10001003 Ga0068866_1000100310 158
268 3300005719 Ga0068861_100002682 Ga0068861_1000026824 158
269 3300005840 Ga0068870_10122733 Ga0068870_101227332 158
270 3300005841 Ga0068863_100167053 Ga0068863_1001670532 158
271 3300005841 Ga0068863_100181739 Ga0068863_1001817393 158
272 3300005842 Ga0068858_100008811 Ga0068858_1000088117 158
273 3300005842 Ga0068858_100368641 Ga0068858_1003686412 158
274 3300005843 Ga0068860_100000810 Ga0068860_10000081012 158
275 3300005844 Ga0068862_100000622 Ga0068862_10000062210 158
276 3300005844 Ga0068862_100828921 Ga0068862_1008289212 158
277 3300006163 Ga0070715_10121759 Ga0070715_101217593 158
278 3300006237 Ga0097621_100001434 Ga0097621_10000143416 158
279 3300006358 Ga0068871_100000440 Ga0068871_1000004409 158
280 3300006358 Ga0068871_100764360 Ga0068871_1007643602 158
281 3300006844 Ga0075428_100000835 Ga0075428_10000083526 158
282 3300006844 Ga0075428_100968590 Ga0075428_1009685901 158
283 3300006846 Ga0075430_100172072 Ga0075430_1001720722 158
284 3300006846 Ga0075430_100507609 Ga0075430_1005076092 158
285 3300006852 Ga0075433_10005345 Ga0075433_1000534510 158
286 3300006852 Ga0075433_10597828 Ga0075433_105978282 158
287 3300006852 Ga0075433_11109821 Ga0075433_111098212 158
288 3300006871 Ga0075434_100000621 Ga0075434_1000006217 158
289 3300006871 Ga0075434_100498371 Ga0075434_1004983711 158
290 3300006880 Ga0075429_100000096 Ga0075429_10000009623 158
291 3300006881 Ga0068865_100000149 Ga0068865_10000014925 158
292 3300006914 Ga0075436_100000816 Ga0075436_10000081617 158
293 3300006914 Ga0075436_100004243 Ga0075436_1000042437 158
294 3300006914 Ga0075436_100113533 Ga0075436_1001135332 158
295 3300006914 Ga0075436_100431587 Ga0075436_1004315872 158
296 3300006931 Ga0097620_100095824 Ga0097620_1000958242 158
297 3300006931 Ga0097620_100297517 Ga0097620_1002975171 158
298 3300007076 Ga0075435_100000485 Ga0075435_1000004851 158
299 3300007265 Ga0099794_10022318 Ga0099794_100223183 158
300 3300007265 Ga0099794_10186835 Ga0099794_101868352 158
301 3300007788 Ga0099795_10003252 Ga0099795_100032523 158
302 3300007788 Ga0099795_10105280 Ga0099795_101052802 158
303 3300009094 Ga0111539_10059879 Ga0111539_100598796 158
304 3300009094 Ga0111539_10269961 Ga0111539_102699612 158
305 3300009098 Ga0105245_10001124 Ga0105245_1000112415 158
306 3300009147 Ga0114129_10001405 Ga0114129_1000140519 158
307 3300009148 Ga0105243_10000577 Ga0105243_1000057713 158
308 3300009174 Ga0105241_10108585 Ga0105241_101085851 158
309 3300009177 Ga0105248_10071215 Ga0105248_100712154 158
310 3300009553 Ga0105249_10024471 Ga0105249_100244715 158
311 3300010375 Ga0105239_10033302 Ga0105239_100333026 158
312 3300011119 Ga0105246_10461604 Ga0105246_104616042 158
313 3300013297 Ga0157378_10000498 Ga0157378_1000049824 158
314 3300013306 Ga0163162_10056768 Ga0163162_100567684 158
315 3300014745 Ga0157377_10476294 Ga0157377_104762942 158
316 3300014968 Ga0157379_10358515 Ga0157379_103585152 158
317 3300014968 Ga0157379_11337174 Ga0157379_113371742 158
318 3300014969 Ga0157376_10002186 Ga0157376_100021868 158
319 3300025901 Ga0207688_10023634 Ga0207688_100236345 158
320 3300025908 Ga0207643_10137256 Ga0207643_101372562 158
321 3300025911 Ga0207654_10056253 Ga0207654_100562534 158
322 3300025912 Ga0207707_10523060 Ga0207707_105230602 158
323 3300025918 Ga0207662_10000099 Ga0207662_1000009915 158
324 3300025918 Ga0207662_10632405 Ga0207662_106324051 158
325 3300025921 Ga0207652_10033727 Ga0207652_100337272 158
326 3300025927 Ga0207687_10001780 Ga0207687_1000178015 158
327 3300025934 Ga0207686_10000295 Ga0207686_1000029513 158
328 3300025935 Ga0207709_10001189 Ga0207709_1000118912 158
329 3300025936 Ga0207670_10002969 Ga0207670_100029696 158
330 3300025936 Ga0207670_10003177 Ga0207670_100031776 158
331 3300025938 Ga0207704_10000643 Ga0207704_1000064313 158
332 3300025939 Ga0207665_10709462 Ga0207665_107094622 158
333 3300025941 Ga0207711_10380024 Ga0207711_103800242 158
334 3300025942 Ga0207689_10000432 Ga0207689_1000043212 158
335 3300025942 Ga0207689_10262437 Ga0207689_102624372 158
336 3300025949 Ga0207667_10002062 Ga0207667_1000206216 158
337 3300025961 Ga0207712_10002597 Ga0207712_1000259710 158
338 3300025981 Ga0207640_10023637 Ga0207640_100236372 158
339 3300026023 Ga0207677_10000957 Ga0207677_1000095710 158
340 3300026023 Ga0207677_10158589 Ga0207677_101585892 158
341 3300026035 Ga0207703_10000781 Ga0207703_100007818 158
342 3300026041 Ga0207639_10500614 Ga0207639_105006141 158
343 3300026075 Ga0207708_10000412 Ga0207708_1000041210 158
344 3300026075 Ga0207708_10663207 Ga0207708_106632072 158
345 3300026075 Ga0207708_11561057 Ga0207708_115610571 158
346 3300026078 Ga0207702_10033654 Ga0207702_100336546 158
347 3300026078 Ga0207702_10168267 Ga0207702_101682673 158
348 3300026088 Ga0207641_10903091 Ga0207641_109030912 158
349 3300026089 Ga0207648_10000603 Ga0207648_1000060328 158
350 3300026095 Ga0207676_10258767 Ga0207676_102587671 158
351 3300026118 Ga0207675_100000509 Ga0207675_10000050912 158
352 3300026142 Ga0207698_10455130 Ga0207698_104551302 158
353 3300027671 Ga0209588_1019337 Ga0209588_10193372 158
354 3300027671 Ga0209588_1052629 Ga0209588_10526292 158
355 3300027907 Ga0207428_10001166 Ga0207428_1000116626 158
356 3300027907 Ga0207428_10357706 Ga0207428_103577062 158
357 3300028380 Ga0268265_10132994 Ga0268265_101329943 158
358 3300028381 Ga0268264_10003270 Ga0268264_100032702 158
359 3300028381 Ga0268264_12068407 Ga0268264_120684071 158
360 3300034817 Ga0373948_0015591 Ga0373948_0015591_218_694 158
361 3300035083 Ga0373926_0109358 Ga0373926_0109358_23_511 158
362 3300035085 Ga0373929_0079750 Ga0373929_0079750_269_745 158
363 3300035086 Ga0373934_0000261 Ga0373934_0000261_8667_9158 158
364 3300035086 Ga0373934_0079909 Ga0373934_0079909_106_591 158
365 3300035088 Ga0373940_0002562 Ga0373940_0002562_1064_1540 158
366 3300035089 Ga0373944_0007164 Ga0373944_0007164_439_927 158
367 3300035089 Ga0373944_0064818 Ga0373944_0064818_537_1022 158
368 3300035090 Ga0373949_0038401 Ga0373949_0038401_297_773 158
369 3300035091 Ga0373951_0009204 Ga0373951_0009204_1554_2030 158
370 3300035092 Ga0373952_0002352 Ga0373952_0002352_2165_2641 158
371 3300035111 Ga0373923_0025167 Ga0373923_0025167_1485_1970 158
372 3300035112 Ga0373932_0020217 Ga0373932_0020217_696_1172 158
373 3300035113 Ga0373936_0003251 Ga0373936_0003251_5428_5913 158
374 3300035113 Ga0373936_0019128 Ga0373936_0019128_744_1232 158
375 3300035115 Ga0373941_0322876 Ga0373941_0322876_83_559 158
376 3300035116 Ga0373945_0000602 Ga0373945_0000602_1115_1603 158
377 3300035117 Ga0373953_0030998 Ga0373953_0030998_1447_1932 158
378 3300035118 Ga0373954_0000624 Ga0373954_0000624_12323_12814 158
379 3300035119 Ga0373956_0000228 Ga0373956_0000228_8559_9050 158
380 3300035119 Ga0373956_0078337 Ga0373956_0078337_669_1154 158
381 3300035121 Ga0373960_0005881 Ga0373960_0005881_1180_1656 158
382 3300035170 Ga0373943_0001169 Ga0373943_0001169_10735_11223 158
383 3300035170 Ga0373943_0264772 Ga0373943_0264772_321_797 158
384 3300035171 Ga0373946_0013960 Ga0373946_0013960_2430_2915 158
385 3300035171 Ga0373946_0038216 Ga0373946_0038216_1132_1620 158
386 3300035172 Ga0373955_0001679 Ga0373955_0001679_2249_2740 158
387 3300035172 Ga0373955_0050066 Ga0373955_0050066_609_1094 158
388 3300035172 Ga0373955_0085015 Ga0373955_0085015_660_1151 158
389 3300035207 Ga0373942_0005539 Ga0373942_0005539_294_770 158
390 3300035241 Ga0373961_0002916 Ga0373961_0002916_1630_2106 158
391 3300035242 Ga0373962_0027604 Ga0373962_0027604_956_1432 158
392 3300035410 Ga0373924_0002936 Ga0373924_0002936_673_1158 158
393 3300035691 Ga0373931_0000606 Ga0373931_0000606_2197_2673 158
394 3300035691 Ga0373931_0022809 Ga0373931_0022809_1076_1552 158
395 3300035692 Ga0373935_0021934 Ga0373935_0021934_1848_2333 158
396 3300035692 Ga0373935_0123912 Ga0373935_0123912_1019_1507 158
397 3300035695 Ga0373927_0004471 Ga0373927_0004471_7430_7918 158
398 3300035724 Ga0373933_0000949 Ga0373933_0000949_12924_13415 158
399 3300035724 Ga0373933_0045246 Ga0373933_0045246_1751_2236 158
400 3300035725 Ga0373947_0055464 Ga0373947_0055464_1161_1649 158
401 3300036401 Ga0373937_0001064 Ga0373937_0001064_12852_13343 158
402 3300036401 Ga0373937_0063925 Ga0373937_0063925_2398_2883 158
403 3300037068 Ga0373925_0890525 Ga0373925_0890525_89_565 158
404 3300044901 Ga0466960_0885399 Ga0466960_0885399_10_489 158
405 3300045051 Ga0451576_0086333 Ga0451576_0086333_1048_1524 158
406 3300045051 Ga0451576_0489558 Ga0451576_0489558_552_1028 158
407 3300045051 Ga0451576_1046601 Ga0451576_1046601_107_604 158
408 3300046454 Ga0495592_0058878 Ga0495592_0058878_834_1319 158
409 3300046455 Ga0495603_0100275 Ga0495603_0100275_916_1401 158
410 3300046459 Ga0495629_0075499 Ga0495629_0075499_681_1166 158
411 3300046462 Ga0495651_0000326 Ga0495651_0000326_12413_12904 158
412 3300046462 Ga0495651_0129674 Ga0495651_0129674_1155_1640 158
413 3300046462 Ga0495651_0504817 Ga0495651_0504817_247_756 158
414 3300046463 Ga0495653_0130993 Ga0495653_0130993_1197_1682 158
415 3300046463 Ga0495653_0296428 Ga0495653_0296428_150_638 158
416 3300046472 Ga0495580_0007277 Ga0495580_0007277_5556_6044 158
417 3300046472 Ga0495580_0259446 Ga0495580_0259446_203_688 158
418 3300046475 Ga0495639_0045601 Ga0495639_0045601_101_586 158
419 3300046477 Ga0495664_0064700 Ga0495664_0064700_436_927 158
420 3300046514 Ga0495618_0162432 Ga0495618_0162432_419_904 158
421 3300046516 Ga0495628_0006239 Ga0495628_0006239_7056_7547 158
422 3300046517 Ga0495630_0002086 Ga0495630_0002086_2320_2805 158
423 3300046517 Ga0495630_0718623 Ga0495630_0718623_89_580 158
424 3300046526 Ga0495666_0019471 Ga0495666_0019471_1624_2109 158
425 3300046529 Ga0495652_0053645 Ga0495652_0053645_150_641 158
426 3300046535 Ga0495586_0003378 Ga0495586_0003378_7876_8364 158
427 3300046535 Ga0495586_0011335 Ga0495586_0011335_3797_4282 158
428 3300046536 Ga0495587_0010269 Ga0495587_0010269_229_714 158
429 3300046537 Ga0495598_0198640 Ga0495598_0198640_226_708 158
430 3300046557 Ga0495622_0057478 Ga0495622_0057478_766_1251 158
431 3300046559 Ga0495667_0032102 Ga0495667_0032102_929_1414 158
432 3300046615 Ga0495656_0241925 Ga0495656_0241925_79_561 158
433 3300046642 Ga0495634_0006738 Ga0495634_0006738_4744_5229 158
434 3300046663 Ga0495635_0034834 Ga0495635_0034834_1400_1885 158
435 3300046664 Ga0495659_0326400 Ga0495659_0326400_65_547 158
436 3300046675 Ga0495657_0050015 Ga0495657_0050015_360_845 158
437 3300046678 Ga0495599_0062236 Ga0495599_0062236_655_1140 158
438 3300046680 Ga0495646_0072598 Ga0495646_0072598_408_893 158
439 3300046681 Ga0495647_0000224 Ga0495647_0000224_924_1412 158
440 3300046681 Ga0495647_0000729 Ga0495647_0000729_8738_9223 158
441 3300046683 Ga0495658_0002293 Ga0495658_0002293_8284_8772 158
442 3300046809 Ga0495600_0025721 Ga0495600_0025721_3202_3687 158
443 3300047317 Ga0495604_0097170 Ga0495604_0097170_107_592 158
444 3300047317 Ga0495604_0103843 Ga0495604_0103843_745_1236 158
445 3300047319 Ga0495674_0004157 Ga0495674_0004157_12274_12759 158
446 3300047321 Ga0495676_0028037 Ga0495676_0028037_3099_3587 158
447 3300047322 Ga0495680_0015504 Ga0495680_0015504_4874_5359 158
448 3300047322 Ga0495680_0096424 Ga0495680_0096424_151_642 158
449 3300047322 Ga0495680_0935402 Ga0495680_0935402_31_519 158
450 3300047444 Ga0495675_0069741 Ga0495675_0069741_410_895 158
451 3300047444 Ga0495675_0116712 Ga0495675_0116712_178_669 158
452 3300047471 Ga0495684_0021786 Ga0495684_0021786_4075_4560 158
453 3300048909 Ga0496106_0092034 Ga0496106_0092034_317_793 158
454 3300049585 Ga0501069_0198621 Ga0501069_0198621_148_642 158
455 3300050507 nmdc:mga05p37_331_c1 nmdc:mga05p37_331_c1_5865_6341 158
456 3300050508 nmdc:mga09592_618_c1 nmdc:mga09592_618_c1_1014_1490 158
457 3300050509 nmdc:mga0qj67_367938_c1 nmdc:mga0qj67_367938_c1_211_726 158
458 3300050509 nmdc:mga0qj67_449487_c1 nmdc:mga0qj67_449487_c1_320_796 158
459 3300050511 nmdc:mga08y16_319300_c1 nmdc:mga08y16_319300_c1_639_1115 158
460 3300050511 nmdc:mga08y16_4836_c1 nmdc:mga08y16_4836_c1_8529_9005 158
461 3300050512 nmdc:mga0n895_125746_c1 nmdc:mga0n895_125746_c1_76_555 158
462 3300050512 nmdc:mga0n895_298808_c1 nmdc:mga0n895_298808_c1_288_764 158
463 3300050512 nmdc:mga0n895_614565_c1 nmdc:mga0n895_614565_c1_421_912 158
464 3300050513 nmdc:mga0rr50_206279_c1 nmdc:mga0rr50_206279_c1_561_1067 158
465 3300050514 nmdc:mga08x19_2046_c1 nmdc:mga08x19_2046_c1_1896_2375 158
466 3300050515 nmdc:mga0a205_23471_c1 nmdc:mga0a205_23471_c1_4294_4773 158
467 3300050515 nmdc:mga0a205_584666_c1 nmdc:mga0a205_584666_c1_389_880 158
468 3300053078 Ga0495612_0062404 Ga0495612_0062404_396_881 158
469 3300053084 Ga0495595_0040214 Ga0495595_0040214_61_546 158
470 3300053085 Ga0495619_0080401 Ga0495619_0080401_1396_1881 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

142

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zd7-assembly1.cif.gz_A crystal structure of the r24e/e352t double mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.8279 35 57
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.8207 11 124
5m67-assembly1.cif.gz_B crystal structure of s-adenosyl-l-homocysteine hydrolase from bradyrhizobium elkanii in complex with adenine and 2'-deoxyadenosine 0.8114 34 57
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.7884 11 124
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7832 16 125
ID Description Score Start End Superfamily
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8101 11 123 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7916 16 125 3.10.180.10
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7903 11 123 3.10.180.10
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.763 72 124 3.30.720.110
3sk2B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7616 14 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V6PJ74-F1-model_v4 VOC domain-containing protein 0.9219 15 124 GO:0004462
GO:0046872
AF-A0A537FW86-F1-model_v4 VOC family protein 0.9189 16 143
AF-A0A6I1QU01-F1-model_v4 VOC domain-containing protein 0.903 12 124
AF-A0A535BAS9-F1-model_v4 VOC family protein 0.9002 12 127
AF-A0A2E7I243-F1-model_v4 VOC domain-containing protein 0.8965 9 148

Feature Viewer

pLDDT pTM Quality
93.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map