F450477

General Info

Members Datasets Scaffolds Average Seq Length
470 179 940 180

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0054289|Ga0495650_0054289_27_626
Length 199
Sequence LALFFAVPACRSGLKPGNSMKKILTTFIFSSLTVLVFAQTLKPVDEGSKVKFVIKNFGINTGGTFTGLDGTINFDPSNPTTASFDINVDAKTIDTDVESRDNHLRKAEYFNVEKFPALNFKSSKITKTNSSDFLYMFGNITIKGVTKEIKFPFKATQKDDGYLFEGNFKLNRRDFGVGGNSLSLSDELTVNLSVFAKKS

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0054289 3300046471 Bacteria 1636
2 JGI24735J21928_10106646 3300002067 Bacteria 805
3 JGI24751J29686_10001484 3300002459 Bacteria 4887
4 Ga0065712_10006174 3300005290 Bacteria 3145
5 Ga0065715_10468074 3300005293 Bacteria 788
6 Ga0070658_10014938 3300005327 Bacteria 6218
7 Ga0070658_10035406 3300005327 Bacteria 4021
8 Ga0070658_10242927 3300005327 Bacteria 1526
9 Ga0070658_10263734 3300005327 Bacteria 1463
10 Ga0070658_10666836 3300005327 Bacteria 902
11 Ga0070676_10089757 3300005328 Bacteria 1880
12 Ga0070676_10091763 3300005328 Bacteria 1862
13 Ga0070683_100175638 3300005329 Bacteria 2033
14 Ga0070683_101113958 3300005329 Bacteria 758
15 Ga0070670_100054955 3300005331 Bacteria 3418
16 Ga0070670_100266575 3300005331 Bacteria 1494
17 Ga0070677_10029448 3300005333 Bacteria 2082
18 Ga0070677_10223167 3300005333 Bacteria 922
19 Ga0068869_100003189 3300005334 Bacteria 10019
20 Ga0068869_100028632 3300005334 Bacteria 3896
21 Ga0068869_100106746 3300005334 Bacteria 2125
22 Ga0068869_100148933 3300005334 Bacteria 1813
23 Ga0068869_100207353 3300005334 Unclassified 1548
24 Ga0068869_100292147 3300005334 Bacteria 1313
25 Ga0070666_10000494 3300005335 Bacteria 23741
26 Ga0070666_10018002 3300005335 Bacteria 4534
27 Ga0070680_100029490 3300005336 Bacteria 4407
28 Ga0070680_100107735 3300005336 Bacteria 2318
29 Ga0070682_100010328 3300005337 Bacteria 5298
30 Ga0070682_100023486 3300005337 Bacteria 3660
31 Ga0068868_100053243 3300005338 Bacteria 3188
32 Ga0070660_100036738 3300005339 Bacteria 3712
33 Ga0070660_100046199 3300005339 Bacteria 3337
34 Ga0070660_100046555 3300005339 Bacteria 3325
35 Ga0070660_100084642 3300005339 Bacteria 2493
36 Ga0070660_100241032 3300005339 Bacteria 1473
37 Ga0070689_100013502 3300005340 Bacteria 5913
38 Ga0070689_100060607 3300005340 Bacteria 2943
39 Ga0070689_100363490 3300005340 Bacteria 1216
40 Ga0070689_100455620 3300005340 Bacteria 1089
41 Ga0070687_100608901 3300005343 Bacteria 751
42 Ga0070661_100217290 3300005344 Bacteria 1465
43 Ga0070692_10199412 3300005345 Bacteria 1171
44 Ga0070668_100013664 3300005347 Bacteria 6062
45 Ga0070668_100043208 3300005347 Bacteria 3456
46 Ga0070668_100052593 3300005347 Bacteria 3139
47 Ga0070668_100182891 3300005347 Bacteria 1713
48 Ga0070669_100949848 3300005353 Bacteria 736
49 Ga0070671_100097112 3300005355 Bacteria 2471
50 Ga0070671_100340158 3300005355 Bacteria 1280
51 Ga0070671_101512910 3300005355 Bacteria 594
52 Ga0070674_100008256 3300005356 Bacteria 6189
53 Ga0070674_100203916 3300005356 Bacteria 1529
54 Ga0070673_100014508 3300005364 Bacteria 5492
55 Ga0070673_100064919 3300005364 Unclassified 2910
56 Ga0070673_100124476 3300005364 Bacteria 2155
57 Ga0070673_100459137 3300005364 Bacteria 1147
58 Ga0070688_100047324 3300005365 Bacteria 2667
59 Ga0070688_100106085 3300005365 Bacteria 1861
60 Ga0070688_100753141 3300005365 Bacteria 758
61 Ga0070659_100071881 3300005366 Bacteria 2752
62 Ga0070659_100204944 3300005366 Bacteria 1624
63 Ga0070667_100012244 3300005367 Bacteria 7096
64 Ga0070667_100022473 3300005367 Bacteria 5231
65 Ga0070667_100525096 3300005367 Bacteria 1087
66 Ga0070667_101382556 3300005367 Unclassified 660
67 Ga0070667_101480782 3300005367 Bacteria 637
68 Ga0070701_10253558 3300005438 Bacteria 1063
69 Ga0070700_100452919 3300005441 Bacteria 977
70 Ga0070678_100056344 3300005456 Unclassified 2874
71 Ga0070678_100087050 3300005456 Bacteria 2385
72 Ga0070678_101005328 3300005456 Bacteria 767
73 Ga0070681_10078835 3300005458 Bacteria 3251
74 Ga0070681_10090375 3300005458 Bacteria 3013
75 Ga0070681_10351971 3300005458 Bacteria 1383
76 Ga0070681_10759712 3300005458 Bacteria 886
77 Ga0068867_100036699 3300005459 Bacteria 3560
78 Ga0068867_100063280 3300005459 Bacteria 2749
79 Ga0068867_100406701 3300005459 Bacteria 1149
80 Ga0068867_100421347 3300005459 Bacteria 1131
81 Ga0068867_100961263 3300005459 Bacteria 772
82 Ga0070685_10042825 3300005466 Bacteria 2585
83 Ga0070685_10063042 3300005466 Bacteria 2175
84 Ga0070706_100611810 3300005467 Bacteria 1012
85 Ga0070707_100365201 3300005468 Bacteria 1402
86 Ga0070698_100002098 3300005471 Bacteria 22130
87 Ga0070698_100013615 3300005471 Bacteria 8611
88 Ga0070698_100025763 3300005471 Bacteria 6127
89 Ga0070698_100221774 3300005471 Bacteria 1824
90 Ga0070679_100000723 3300005530 Bacteria 28502
91 Ga0070679_100001843 3300005530 Bacteria 19045
92 Ga0070679_100011352 3300005530 Bacteria 8489
93 Ga0070679_100112459 3300005530 Bacteria 2709
94 Ga0070679_100192850 3300005530 Bacteria 2006
95 Ga0070684_100181359 3300005535 Bacteria 1915
96 Ga0070684_100540113 3300005535 Bacteria 1081
97 Ga0068853_100032600 3300005539 Bacteria 4414
98 Ga0068853_100040732 3300005539 Bacteria 3965
99 Ga0068853_100133538 3300005539 Bacteria 2223
100 Ga0068853_100604079 3300005539 Bacteria 1042
101 Ga0070672_100032139 3300005543 Bacteria 3958
102 Ga0070672_100085790 3300005543 Bacteria 2531
103 Ga0070672_100089633 3300005543 Bacteria 2478
104 Ga0068855_100004190 3300005563 Bacteria 17595
105 Ga0068855_100053098 3300005563 Bacteria 4769
106 Ga0068855_100165088 3300005563 Bacteria 2511
107 Ga0068855_100252555 3300005563 Bacteria 1966
108 Ga0068855_100431322 3300005563 Bacteria 1441
109 Ga0068857_100028509 3300005577 Bacteria 4927
110 Ga0068857_100269077 3300005577 Bacteria 1566
111 Ga0068857_101750985 3300005577 Bacteria 608
112 Ga0068854_100102963 3300005578 Bacteria 2143
113 Ga0068854_100284622 3300005578 Bacteria 1332
114 Ga0068856_100021551 3300005614 Bacteria 6263
115 Ga0068856_100832015 3300005614 Bacteria 942
116 Ga0068856_101105941 3300005614 Bacteria 810
117 Ga0068852_100000563 3300005616 Bacteria 24454
118 Ga0068852_100014576 3300005616 Bacteria 6058
119 Ga0068852_100055690 3300005616 Bacteria 3414
120 Ga0068852_100096610 3300005616 Unclassified 2656
121 Ga0068852_100363557 3300005616 Bacteria 1416
122 Ga0068859_100000186 3300005617 Bacteria 60206
123 Ga0068859_100085891 3300005617 Bacteria 3192
124 Ga0068859_100121989 3300005617 Bacteria 2673
125 Ga0068859_100457657 3300005617 Bacteria 1372
126 Ga0068859_100921887 3300005617 Bacteria 958
127 Ga0068864_100016143 3300005618 Bacteria 6214
128 Ga0068864_100459123 3300005618 Bacteria 1219
129 Ga0068864_100585508 3300005618 Bacteria 1081
130 Ga0068864_100917030 3300005618 Bacteria 866
131 Ga0068866_10090070 3300005718 Bacteria 1668
132 Ga0068866_10308197 3300005718 Bacteria 991
133 Ga0068866_10738786 3300005718 Bacteria 679
134 Ga0068861_100015284 3300005719 Bacteria 5406
135 Ga0068861_100027622 3300005719 Bacteria 4136
136 Ga0068861_100028073 3300005719 Bacteria 4105
137 Ga0068861_100039890 3300005719 Bacteria 3508
138 Ga0068861_100130243 3300005719 Bacteria 2041
139 Ga0068861_101222344 3300005719 Bacteria 727
140 Ga0068851_10499191 3300005834 Bacteria 729
141 Ga0068870_10010630 3300005840 Bacteria 4236
142 Ga0068870_10067538 3300005840 Bacteria 1940
143 Ga0068863_100005438 3300005841 Bacteria 12547
144 Ga0068863_100054149 3300005841 Bacteria 3802
145 Ga0068863_100377328 3300005841 Bacteria 1384
146 Ga0068863_101595763 3300005841 Bacteria 662
147 Ga0068858_100034101 3300005842 Bacteria 4721
148 Ga0068858_100302223 3300005842 Bacteria 1527
149 Ga0068860_100008158 3300005843 Bacteria 10426
150 Ga0068860_100061503 3300005843 Bacteria 3568
151 Ga0068860_100165180 3300005843 Bacteria 2137
152 Ga0068860_100257136 3300005843 Bacteria 1702
153 Ga0068862_100072373 3300005844 Bacteria 2977
154 Ga0068862_100694136 3300005844 Bacteria 985
155 Ga0070715_10097347 3300006163 Bacteria 1366
156 Ga0097621_100016613 3300006237 Bacteria 5568
157 Ga0097621_100055364 3300006237 Bacteria 3239
158 Ga0097621_100459101 3300006237 Bacteria 1148
159 Ga0068871_100026639 3300006358 Bacteria 4513
160 Ga0068871_100033135 3300006358 Bacteria 4088
161 Ga0068871_100045545 3300006358 Bacteria 3531
162 Ga0068871_100295487 3300006358 Bacteria 1420
163 Ga0075428_100002349 3300006844 Bacteria 20539
164 Ga0075428_100059525 3300006844 Bacteria 4183
165 Ga0075428_100204297 3300006844 Bacteria 2135
166 Ga0075430_100013143 3300006846 Bacteria 7053
167 Ga0075430_100587083 3300006846 Bacteria 919
168 Ga0075431_100035126 3300006847 Bacteria 5162
169 Ga0075429_100004013 3300006880 Bacteria 12599
170 Ga0075429_100180427 3300006880 Bacteria 1850
171 Ga0068865_100021051 3300006881 Bacteria 4238
172 Ga0097620_100000186 3300006931 Bacteria 60206
173 Ga0097620_100085883 3300006931 Bacteria 3192
174 Ga0097620_100121995 3300006931 Bacteria 2673
175 Ga0097620_100457702 3300006931 Bacteria 1372
176 Ga0097620_100921998 3300006931 Bacteria 958
177 Ga0111539_10065795 3300009094 Bacteria 4282
178 Ga0111539_10110494 3300009094 Bacteria 3226
179 Ga0105245_10170786 3300009098 Bacteria 2071
180 Ga0105247_10006330 3300009101 Bacteria 7333
181 Ga0105247_10949954 3300009101 Bacteria 668
182 Ga0114129_10776668 3300009147 Bacteria 1224
183 Ga0114129_10969534 3300009147 Bacteria 1073
184 Ga0105243_10035125 3300009148 Unclassified 3885
185 Ga0105243_10225738 3300009148 Bacteria 1658
186 Ga0105241_10007177 3300009174 Bacteria 8201
187 Ga0105241_10012438 3300009174 Bacteria 6238
188 Ga0105241_10097198 3300009174 Bacteria 2334
189 Ga0105241_10740754 3300009174 Bacteria 900
190 Ga0105242_10019145 3300009176 Bacteria 5363
191 Ga0105242_10028031 3300009176 Bacteria 4480
192 Ga0105242_10028919 3300009176 Bacteria 4416
193 Ga0105242_10037252 3300009176 Bacteria 3906
194 Ga0105242_10117490 3300009176 Bacteria 2277
195 Ga0105242_10232299 3300009176 Bacteria 1653
196 Ga0105242_11575066 3300009176 Bacteria 690
197 Ga0105248_10373833 3300009177 Bacteria 1605
198 Ga0105237_10014667 3300009545 Bacteria 8185
199 Ga0105237_10066269 3300009545 Bacteria 3606
200 Ga0105249_10001561 3300009553 Bacteria 20115
201 Ga0105249_10004353 3300009553 Bacteria 12247
202 Ga0105249_10004716 3300009553 Bacteria 11769
203 Ga0105249_10010856 3300009553 Bacteria 8004
204 Ga0105249_10130646 3300009553 Bacteria 2397
205 Ga0105249_10239125 3300009553 Bacteria 1794
206 Ga0105249_10798537 3300009553 Bacteria 1008
207 Ga0105239_10064401 3300010375 Bacteria 4024
208 Ga0105239_10159966 3300010375 Bacteria 2515
209 Ga0105239_10757435 3300010375 Bacteria 1111
210 Ga0105246_10008960 3300011119 Bacteria 6160
211 Ga0105246_10150182 3300011119 Bacteria 1763
212 Ga0105246_10232602 3300011119 Bacteria 1452
213 Ga0157373_10005431 3300013100 Bacteria 9573
214 Ga0157373_10019799 3300013100 Bacteria 4895
215 Ga0157373_10021980 3300013100 Bacteria 4629
216 Ga0157373_10121183 3300013100 Bacteria 1838
217 Ga0157373_10160310 3300013100 Bacteria 1583
218 Ga0157371_10000932 3300013102 Bacteria 32766
219 Ga0157371_10003608 3300013102 Bacteria 13948
220 Ga0157371_10003924 3300013102 Bacteria 13232
221 Ga0157371_10022360 3300013102 Bacteria 4635
222 Ga0157371_10031297 3300013102 Bacteria 3832
223 Ga0157371_10098152 3300013102 Bacteria 2077
224 Ga0157371_10264417 3300013102 Bacteria 1241
225 Ga0157371_10266512 3300013102 Bacteria 1236
226 Ga0157371_10366576 3300013102 Bacteria 1050
227 Ga0157371_10456722 3300013102 Bacteria 940
228 Ga0157370_10003393 3300013104 Bacteria 18718
229 Ga0157370_10095369 3300013104 Bacteria 2791
230 Ga0157370_10151079 3300013104 Bacteria 2161
231 Ga0157370_10226329 3300013104 Bacteria 1731
232 Ga0157369_10084258 3300013105 Bacteria 3398
233 Ga0157369_10159172 3300013105 Bacteria 2384
234 Ga0157369_10201026 3300013105 Bacteria 2092
235 Ga0157369_10963234 3300013105 Bacteria 874
236 Ga0157374_10147256 3300013296 Bacteria 2288
237 Ga0157374_10173000 3300013296 Bacteria 2107
238 Ga0157374_10318678 3300013296 Bacteria 1540
239 Ga0157374_10582744 3300013296 Bacteria 1128
240 Ga0157378_10097306 3300013297 Bacteria 2682
241 Ga0157378_10526616 3300013297 Bacteria 1184
242 Ga0163162_10000503 3300013306 Bacteria 36430
243 Ga0163162_10568149 3300013306 Bacteria 1261
244 Ga0163162_10868458 3300013306 Bacteria 1017
245 Ga0163162_11654577 3300013306 Bacteria 731
246 Ga0157372_10101571 3300013307 Bacteria 3283
247 Ga0157372_10111875 3300013307 Unclassified 3128
248 Ga0157372_10311885 3300013307 Bacteria 1831
249 Ga0157372_10387796 3300013307 Bacteria 1628
250 Ga0157372_10413568 3300013307 Bacteria 1572
251 Ga0157372_10529288 3300013307 Bacteria 1374
252 Ga0157372_10743068 3300013307 Bacteria 1141
253 Ga0157372_11552885 3300013307 Bacteria 762
254 Ga0157372_11623859 3300013307 Bacteria 744
255 Ga0157372_11653009 3300013307 Bacteria 737
256 Ga0157375_10011842 3300013308 Bacteria 7714
257 Ga0157375_10052671 3300013308 Bacteria 4002
258 Ga0157375_10083868 3300013308 Bacteria 3233
259 Ga0157375_10105077 3300013308 Bacteria 2913
260 Ga0157375_10452767 3300013308 Bacteria 1449
261 Ga0157375_10772426 3300013308 Bacteria 1111
262 Ga0157375_12917358 3300013308 Bacteria 571
263 Ga0163163_10111904 3300014325 Unclassified 2759
264 Ga0163163_10190080 3300014325 Bacteria 2102
265 Ga0163163_10885245 3300014325 Bacteria 956
266 Ga0157380_10039474 3300014326 Bacteria 3672
267 Ga0157380_10209766 3300014326 Unclassified 1735
268 Ga0157380_10220838 3300014326 Bacteria 1695
269 Ga0157380_10465703 3300014326 Bacteria 1218
270 Ga0157380_10779692 3300014326 Unclassified 971
271 Ga0157380_11917133 3300014326 Unclassified 653
272 Ga0157377_10039057 3300014745 Bacteria 2624
273 Ga0157379_10173513 3300014968 Bacteria 1946
274 Ga0157376_10005260 3300014969 Bacteria 9038
275 Ga0157376_10432770 3300014969 Bacteria 1279
276 Ga0157376_10880537 3300014969 Bacteria 912
277 Ga0163161_10010065 3300017792 Bacteria 6545
278 Ga0163161_10293300 3300017792 Bacteria 1279
279 Ga0163161_10695627 3300017792 Bacteria 846
280 Ga0207666_1008425 3300025271 Bacteria 1377
281 Ga0207656_10304111 3300025321 Bacteria 790
282 Ga0207682_10119705 3300025893 Bacteria 1167
283 Ga0207642_10010665 3300025899 Bacteria 3250
284 Ga0207688_10191660 3300025901 Bacteria 1223
285 Ga0207680_10000236 3300025903 Bacteria 26619
286 Ga0207680_10725787 3300025903 Bacteria 712
287 Ga0207647_10515727 3300025904 Bacteria 665
288 Ga0207685_10085154 3300025905 Bacteria 1318
289 Ga0207645_10008320 3300025907 Bacteria 7246
290 Ga0207645_10364922 3300025907 Bacteria 968
291 Ga0207643_10004789 3300025908 Bacteria 7250
292 Ga0207643_10023686 3300025908 Bacteria 3387
293 Ga0207705_10003539 3300025909 Bacteria 11893
294 Ga0207705_10046351 3300025909 Unclassified 3124
295 Ga0207705_10068973 3300025909 Bacteria 2560
296 Ga0207705_10078713 3300025909 Bacteria 2400
297 Ga0207705_10666286 3300025909 Bacteria 809
298 Ga0207654_10024318 3300025911 Bacteria 3255
299 Ga0207654_10035846 3300025911 Bacteria 2767
300 Ga0207707_10176178 3300025912 Bacteria 1868
301 Ga0207707_10180504 3300025912 Bacteria 1843
302 Ga0207707_10234179 3300025912 Bacteria 1598
303 Ga0207707_10281061 3300025912 Bacteria 1442
304 Ga0207707_10554714 3300025912 Bacteria 976
305 Ga0207695_10042677 3300025913 Bacteria 4840
306 Ga0207671_10006106 3300025914 Bacteria 10843
307 Ga0207663_10451170 3300025916 Bacteria 992
308 Ga0207660_10084884 3300025917 Bacteria 2334
309 Ga0207660_10252788 3300025917 Bacteria 1391
310 Ga0207660_10273574 3300025917 Bacteria 1338
311 Ga0207657_10061191 3300025919 Bacteria 3229
312 Ga0207657_10065191 3300025919 Bacteria 3106
313 Ga0207657_10078741 3300025919 Bacteria 2774
314 Ga0207657_10087157 3300025919 Bacteria 2612
315 Ga0207657_10169888 3300025919 Bacteria 1767
316 Ga0207649_10138311 3300025920 Bacteria 1663
317 Ga0207652_10000546 3300025921 Bacteria 38083
318 Ga0207652_10001189 3300025921 Bacteria 23425
319 Ga0207652_10017232 3300025921 Bacteria 5910
320 Ga0207652_11302505 3300025921 Bacteria 629
321 Ga0207646_10970328 3300025922 Bacteria 752
322 Ga0207681_10028136 3300025923 Bacteria 3640
323 Ga0207681_10609524 3300025923 Bacteria 903
324 Ga0207650_10052379 3300025925 Bacteria 3023
325 Ga0207650_10513051 3300025925 Bacteria 1003
326 Ga0207659_10230097 3300025926 Bacteria 1495
327 Ga0207687_10422193 3300025927 Bacteria 1101
328 Ga0207644_10014788 3300025931 Bacteria 5230
329 Ga0207644_11319514 3300025931 Bacteria 606
330 Ga0207690_10005226 3300025932 Bacteria 7657
331 Ga0207706_10178721 3300025933 Bacteria 1864
332 Ga0207686_10001727 3300025934 Bacteria 12163
333 Ga0207686_10103959 3300025934 Unclassified 1901
334 Ga0207686_10314854 3300025934 Bacteria 1167
335 Ga0207670_10038548 3300025936 Bacteria 3122
336 Ga0207670_10045588 3300025936 Bacteria 2907
337 Ga0207670_10714098 3300025936 Bacteria 831
338 Ga0207669_10273030 3300025937 Bacteria 1271
339 Ga0207669_10857368 3300025937 Bacteria 756
340 Ga0207704_10067150 3300025938 Bacteria 2255
341 Ga0207704_10077226 3300025938 Bacteria 2137
342 Ga0207704_10362674 3300025938 Bacteria 1132
343 Ga0207691_10007169 3300025940 Bacteria 10754
344 Ga0207691_10125897 3300025940 Bacteria 2267
345 Ga0207689_10000687 3300025942 Bacteria 32323
346 Ga0207689_10010494 3300025942 Bacteria 7978
347 Ga0207689_10022434 3300025942 Bacteria 5309
348 Ga0207689_10064671 3300025942 Bacteria 3009
349 Ga0207689_10075453 3300025942 Bacteria 2771
350 Ga0207689_10078905 3300025942 Bacteria 2706
351 Ga0207661_11009531 3300025944 Bacteria 766
352 Ga0207679_10931375 3300025945 Bacteria 795
353 Ga0207667_10058892 3300025949 Bacteria 4026
354 Ga0207667_10075413 3300025949 Bacteria 3502
355 Ga0207667_10330965 3300025949 Bacteria 1555
356 Ga0207651_10075508 3300025960 Bacteria 2405
357 Ga0207651_10459038 3300025960 Unclassified 1094
358 Ga0207651_11155913 3300025960 Bacteria 694
359 Ga0207712_10001621 3300025961 Bacteria 15164
360 Ga0207712_10005567 3300025961 Bacteria 7949
361 Ga0207712_10009906 3300025961 Bacteria 6040
362 Ga0207712_10068905 3300025961 Bacteria 2537
363 Ga0207712_10505723 3300025961 Bacteria 1033
364 Ga0207668_10022072 3300025972 Bacteria 4069
365 Ga0207668_10205143 3300025972 Bacteria 1572
366 Ga0207640_10141488 3300025981 Bacteria 1754
367 Ga0207640_10328213 3300025981 Bacteria 1221
368 Ga0207658_10024336 3300025986 Bacteria 4236
369 Ga0207658_10104504 3300025986 Bacteria 2226
370 Ga0207658_10284315 3300025986 Bacteria 1419
371 Ga0207658_10366983 3300025986 Bacteria 1258
372 Ga0207658_10389658 3300025986 Bacteria 1222
373 Ga0207658_11280481 3300025986 Unclassified 670
374 Ga0207677_10158634 3300026023 Unclassified 1755
375 Ga0207677_10812979 3300026023 Bacteria 837
376 Ga0207703_10062624 3300026035 Bacteria 3047
377 Ga0207703_10544913 3300026035 Bacteria 1093
378 Ga0207639_10080415 3300026041 Bacteria 2578
379 Ga0207639_10082021 3300026041 Bacteria 2556
380 Ga0207639_10110375 3300026041 Bacteria 2240
381 Ga0207639_10303168 3300026041 Bacteria 1413
382 Ga0207708_10983627 3300026075 Bacteria 733
383 Ga0207702_10132760 3300026078 Bacteria 2242
384 Ga0207641_10000194 3300026088 Bacteria 82153
385 Ga0207641_10023102 3300026088 Bacteria 5123
386 Ga0207641_10848095 3300026088 Bacteria 905
387 Ga0207641_11725184 3300026088 Bacteria 628
388 Ga0207648_10003655 3300026089 Bacteria 16101
389 Ga0207648_10130338 3300026089 Bacteria 2213
390 Ga0207648_10454524 3300026089 Bacteria 1167
391 Ga0207648_10712306 3300026089 Bacteria 931
392 Ga0207648_10766777 3300026089 Bacteria 897
393 Ga0207676_10009188 3300026095 Bacteria 7038
394 Ga0207676_10278590 3300026095 Bacteria 1517
395 Ga0207676_10355157 3300026095 Bacteria 1357
396 Ga0207674_10024037 3300026116 Bacteria 6517
397 Ga0207674_10048047 3300026116 Bacteria 4371
398 Ga0207674_10232372 3300026116 Bacteria 1792
399 Ga0207674_10412915 3300026116 Bacteria 1304
400 Ga0207674_10727608 3300026116 Bacteria 958
401 Ga0207675_100008546 3300026118 Bacteria 9630
402 Ga0207675_100014275 3300026118 Bacteria 7403
403 Ga0207675_100020892 3300026118 Bacteria 6104
404 Ga0207675_100110239 3300026118 Bacteria 2597
405 Ga0207675_100719031 3300026118 Bacteria 1008
406 Ga0207675_101118766 3300026118 Bacteria 807
407 Ga0207675_101194221 3300026118 Bacteria 781
408 Ga0207683_10001842 3300026121 Bacteria 18744
409 Ga0207683_10010191 3300026121 Bacteria 8015
410 Ga0207683_10137141 3300026121 Bacteria 2203
411 Ga0207683_10224692 3300026121 Bacteria 1711
412 Ga0207683_10230677 3300026121 Bacteria 1688
413 Ga0207698_10036983 3300026142 Bacteria 3590
414 Ga0207698_10069798 3300026142 Unclassified 2781
415 Ga0207698_10086896 3300026142 Bacteria 2545
416 Ga0207698_10126464 3300026142 Bacteria 2175
417 Ga0207698_10580077 3300026142 Bacteria 1103
418 Ga0207428_10145231 3300027907 Bacteria 1808
419 Ga0268265_10091305 3300028380 Bacteria 2435
420 Ga0268265_10099902 3300028380 Unclassified 2340
421 Ga0268265_10301884 3300028380 Bacteria 1442
422 Ga0268264_10006791 3300028381 Bacteria 9615
423 Ga0268264_10027588 3300028381 Bacteria 4642
424 Ga0268264_10037701 3300028381 Bacteria 3986
425 Ga0268264_10273963 3300028381 Bacteria 1578
426 Ga0268264_10696496 3300028381 Bacteria 1009
427 Ga0307509_10336868 3300031507 Bacteria 1238
428 Ga0395899_0001590 3300037312 Bacteria 19085
429 Ga0395899_0109957 3300037312 Bacteria 1982
430 Ga0395899_0274702 3300037312 Bacteria 1148
431 Ga0395900_0004139 3300037418 Bacteria 15441
432 Ga0395900_0005994 3300037418 Bacteria 12692
433 Ga0395900_0847646 3300037418 Bacteria 839
434 Ga0395898_0001279 3300037466 Bacteria 37056
435 Ga0395898_0432205 3300037466 Bacteria 1254
436 Ga0395898_1134014 3300037466 Bacteria 714
437 Ga0395905_0453179 3300037471 Bacteria 1181
438 Ga0395901_0004694 3300038443 Bacteria 13783
439 Ga0395901_0007368 3300038443 Bacteria 11099
440 Ga0395901_0082713 3300038443 Bacteria 3354
441 Ga0451839_0634014 3300041496 Bacteria 829
442 Ga0451853_2221581 3300041512 Bacteria 850
443 Ga0439441_072500 3300042001 Bacteria 740
444 Ga0466969_0189093 3300044656 Unclassified 941
445 Ga0466971_0006994 3300044719 Bacteria 4910
446 Ga0466957_0399041 3300044842 Unclassified 940
447 Ga0466959_0023246 3300045049 Bacteria 4587
448 Ga0466959_0400243 3300045049 Bacteria 933
449 Ga0451576_1095910 3300045051 Bacteria 833
450 Ga0495594_0070596 3300046499 Bacteria 1942
451 Ga0495621_0042690 3300046539 Bacteria 1597
452 Ga0495658_0166106 3300046683 Bacteria 1364
453 Ga0501031_0139675 3300049568 Bacteria 1583
454 Ga0501036_0104660 3300049572 Bacteria 2393
455 Ga0501037_0046793 3300049573 Bacteria 3172
456 Ga0501038_0016450 3300049574 Bacteria 6704
457 Ga0501038_0069401 3300049574 Bacteria 2994
458 Ga0501039_0080907 3300049575 Bacteria 2528
459 Ga0501070_0052241 3300049586 Bacteria 3392
460 Ga0501072_0048925 3300049588 Bacteria 3328
461 Ga0501035_0071677 3300049822 Bacteria 3067
462 Ga0501035_0072140 3300049822 Bacteria 3057
463 Ga0501044_0180619 3300049823 Bacteria 2077
464 nmdc:mga09592_141298_c1 3300050508 Bacteria 2076
465 nmdc:mga09592_84060_c1 3300050508 Unclassified 2714
466 nmdc:mga0qj67_342495_c1 3300050509 Bacteria 1209
467 nmdc:mga0qj67_508059_c1 3300050509 Unclassified 969
468 nmdc:mga06r32_1003295_c1 3300050510 Unclassified 787
469 nmdc:mga06r32_93200_c1 3300050510 Bacteria 2946
470 nmdc:mga08y16_311490_c1 3300050511 Bacteria 1621
471 Ga0495650_0054289
472 JGI24735J21928_10106646
473 JGI24751J29686_10001484
474 Ga0065712_10006174
475 Ga0065715_10468074
476 Ga0070658_10014938
477 Ga0070658_10035406
478 Ga0070658_10242927
479 Ga0070658_10263734
480 Ga0070658_10666836
481 Ga0070676_10089757
482 Ga0070676_10091763
483 Ga0070683_100175638
484 Ga0070683_101113958
485 Ga0070670_100054955
486 Ga0070670_100266575
487 Ga0070677_10029448
488 Ga0070677_10223167
489 Ga0068869_100003189
490 Ga0068869_100028632
491 Ga0068869_100106746
492 Ga0068869_100148933
493 Ga0068869_100207353
494 Ga0068869_100292147
495 Ga0070666_10000494
496 Ga0070666_10018002
497 Ga0070680_100029490
498 Ga0070680_100107735
499 Ga0070682_100010328
500 Ga0070682_100023486
501 Ga0068868_100053243
502 Ga0070660_100036738
503 Ga0070660_100046199
504 Ga0070660_100046555
505 Ga0070660_100084642
506 Ga0070660_100241032
507 Ga0070689_100013502
508 Ga0070689_100060607
509 Ga0070689_100363490
510 Ga0070689_100455620
511 Ga0070687_100608901
512 Ga0070661_100217290
513 Ga0070692_10199412
514 Ga0070668_100013664
515 Ga0070668_100043208
516 Ga0070668_100052593
517 Ga0070668_100182891
518 Ga0070669_100949848
519 Ga0070671_100097112
520 Ga0070671_100340158
521 Ga0070671_101512910
522 Ga0070674_100008256
523 Ga0070674_100203916
524 Ga0070673_100014508
525 Ga0070673_100064919
526 Ga0070673_100124476
527 Ga0070673_100459137
528 Ga0070688_100047324
529 Ga0070688_100106085
530 Ga0070688_100753141
531 Ga0070659_100071881
532 Ga0070659_100204944
533 Ga0070667_100012244
534 Ga0070667_100022473
535 Ga0070667_100525096
536 Ga0070667_101382556
537 Ga0070667_101480782
538 Ga0070701_10253558
539 Ga0070700_100452919
540 Ga0070678_100056344
541 Ga0070678_100087050
542 Ga0070678_101005328
543 Ga0070681_10078835
544 Ga0070681_10090375
545 Ga0070681_10351971
546 Ga0070681_10759712
547 Ga0068867_100036699
548 Ga0068867_100063280
549 Ga0068867_100406701
550 Ga0068867_100421347
551 Ga0068867_100961263
552 Ga0070685_10042825
553 Ga0070685_10063042
554 Ga0070706_100611810
555 Ga0070707_100365201
556 Ga0070698_100002098
557 Ga0070698_100013615
558 Ga0070698_100025763
559 Ga0070698_100221774
560 Ga0070679_100000723
561 Ga0070679_100001843
562 Ga0070679_100011352
563 Ga0070679_100112459
564 Ga0070679_100192850
565 Ga0070684_100181359
566 Ga0070684_100540113
567 Ga0068853_100032600
568 Ga0068853_100040732
569 Ga0068853_100133538
570 Ga0068853_100604079
571 Ga0070672_100032139
572 Ga0070672_100085790
573 Ga0070672_100089633
574 Ga0068855_100004190
575 Ga0068855_100053098
576 Ga0068855_100165088
577 Ga0068855_100252555
578 Ga0068855_100431322
579 Ga0068857_100028509
580 Ga0068857_100269077
581 Ga0068857_101750985
582 Ga0068854_100102963
583 Ga0068854_100284622
584 Ga0068856_100021551
585 Ga0068856_100832015
586 Ga0068856_101105941
587 Ga0068852_100000563
588 Ga0068852_100014576
589 Ga0068852_100055690
590 Ga0068852_100096610
591 Ga0068852_100363557
592 Ga0068859_100000186
593 Ga0068859_100085891
594 Ga0068859_100121989
595 Ga0068859_100457657
596 Ga0068859_100921887
597 Ga0068864_100016143
598 Ga0068864_100459123
599 Ga0068864_100585508
600 Ga0068864_100917030
601 Ga0068866_10090070
602 Ga0068866_10308197
603 Ga0068866_10738786
604 Ga0068861_100015284
605 Ga0068861_100027622
606 Ga0068861_100028073
607 Ga0068861_100039890
608 Ga0068861_100130243
609 Ga0068861_101222344
610 Ga0068851_10499191
611 Ga0068870_10010630
612 Ga0068870_10067538
613 Ga0068863_100005438
614 Ga0068863_100054149
615 Ga0068863_100377328
616 Ga0068863_101595763
617 Ga0068858_100034101
618 Ga0068858_100302223
619 Ga0068860_100008158
620 Ga0068860_100061503
621 Ga0068860_100165180
622 Ga0068860_100257136
623 Ga0068862_100072373
624 Ga0068862_100694136
625 Ga0070715_10097347
626 Ga0097621_100016613
627 Ga0097621_100055364
628 Ga0097621_100459101
629 Ga0068871_100026639
630 Ga0068871_100033135
631 Ga0068871_100045545
632 Ga0068871_100295487
633 Ga0075428_100002349
634 Ga0075428_100059525
635 Ga0075428_100204297
636 Ga0075430_100013143
637 Ga0075430_100587083
638 Ga0075431_100035126
639 Ga0075429_100004013
640 Ga0075429_100180427
641 Ga0068865_100021051
642 Ga0097620_100000186
643 Ga0097620_100085883
644 Ga0097620_100121995
645 Ga0097620_100457702
646 Ga0097620_100921998
647 Ga0111539_10065795
648 Ga0111539_10110494
649 Ga0105245_10170786
650 Ga0105247_10006330
651 Ga0105247_10949954
652 Ga0114129_10776668
653 Ga0114129_10969534
654 Ga0105243_10035125
655 Ga0105243_10225738
656 Ga0105241_10007177
657 Ga0105241_10012438
658 Ga0105241_10097198
659 Ga0105241_10740754
660 Ga0105242_10019145
661 Ga0105242_10028031
662 Ga0105242_10028919
663 Ga0105242_10037252
664 Ga0105242_10117490
665 Ga0105242_10232299
666 Ga0105242_11575066
667 Ga0105248_10373833
668 Ga0105237_10014667
669 Ga0105237_10066269
670 Ga0105249_10001561
671 Ga0105249_10004353
672 Ga0105249_10004716
673 Ga0105249_10010856
674 Ga0105249_10130646
675 Ga0105249_10239125
676 Ga0105249_10798537
677 Ga0105239_10064401
678 Ga0105239_10159966
679 Ga0105239_10757435
680 Ga0105246_10008960
681 Ga0105246_10150182
682 Ga0105246_10232602
683 Ga0157373_10005431
684 Ga0157373_10019799
685 Ga0157373_10021980
686 Ga0157373_10121183
687 Ga0157373_10160310
688 Ga0157371_10000932
689 Ga0157371_10003608
690 Ga0157371_10003924
691 Ga0157371_10022360
692 Ga0157371_10031297
693 Ga0157371_10098152
694 Ga0157371_10264417
695 Ga0157371_10266512
696 Ga0157371_10366576
697 Ga0157371_10456722
698 Ga0157370_10003393
699 Ga0157370_10095369
700 Ga0157370_10151079
701 Ga0157370_10226329
702 Ga0157369_10084258
703 Ga0157369_10159172
704 Ga0157369_10201026
705 Ga0157369_10963234
706 Ga0157374_10147256
707 Ga0157374_10173000
708 Ga0157374_10318678
709 Ga0157374_10582744
710 Ga0157378_10097306
711 Ga0157378_10526616
712 Ga0163162_10000503
713 Ga0163162_10568149
714 Ga0163162_10868458
715 Ga0163162_11654577
716 Ga0157372_10101571
717 Ga0157372_10111875
718 Ga0157372_10311885
719 Ga0157372_10387796
720 Ga0157372_10413568
721 Ga0157372_10529288
722 Ga0157372_10743068
723 Ga0157372_11552885
724 Ga0157372_11623859
725 Ga0157372_11653009
726 Ga0157375_10011842
727 Ga0157375_10052671
728 Ga0157375_10083868
729 Ga0157375_10105077
730 Ga0157375_10452767
731 Ga0157375_10772426
732 Ga0157375_12917358
733 Ga0163163_10111904
734 Ga0163163_10190080
735 Ga0163163_10885245
736 Ga0157380_10039474
737 Ga0157380_10209766
738 Ga0157380_10220838
739 Ga0157380_10465703
740 Ga0157380_10779692
741 Ga0157380_11917133
742 Ga0157377_10039057
743 Ga0157379_10173513
744 Ga0157376_10005260
745 Ga0157376_10432770
746 Ga0157376_10880537
747 Ga0163161_10010065
748 Ga0163161_10293300
749 Ga0163161_10695627
750 Ga0207666_1008425
751 Ga0207656_10304111
752 Ga0207682_10119705
753 Ga0207642_10010665
754 Ga0207688_10191660
755 Ga0207680_10000236
756 Ga0207680_10725787
757 Ga0207647_10515727
758 Ga0207685_10085154
759 Ga0207645_10008320
760 Ga0207645_10364922
761 Ga0207643_10004789
762 Ga0207643_10023686
763 Ga0207705_10003539
764 Ga0207705_10046351
765 Ga0207705_10068973
766 Ga0207705_10078713
767 Ga0207705_10666286
768 Ga0207654_10024318
769 Ga0207654_10035846
770 Ga0207707_10176178
771 Ga0207707_10180504
772 Ga0207707_10234179
773 Ga0207707_10281061
774 Ga0207707_10554714
775 Ga0207695_10042677
776 Ga0207671_10006106
777 Ga0207663_10451170
778 Ga0207660_10084884
779 Ga0207660_10252788
780 Ga0207660_10273574
781 Ga0207657_10061191
782 Ga0207657_10065191
783 Ga0207657_10078741
784 Ga0207657_10087157
785 Ga0207657_10169888
786 Ga0207649_10138311
787 Ga0207652_10000546
788 Ga0207652_10001189
789 Ga0207652_10017232
790 Ga0207652_11302505
791 Ga0207646_10970328
792 Ga0207681_10028136
793 Ga0207681_10609524
794 Ga0207650_10052379
795 Ga0207650_10513051
796 Ga0207659_10230097
797 Ga0207687_10422193
798 Ga0207644_10014788
799 Ga0207644_11319514
800 Ga0207690_10005226
801 Ga0207706_10178721
802 Ga0207686_10001727
803 Ga0207686_10103959
804 Ga0207686_10314854
805 Ga0207670_10038548
806 Ga0207670_10045588
807 Ga0207670_10714098
808 Ga0207669_10273030
809 Ga0207669_10857368
810 Ga0207704_10067150
811 Ga0207704_10077226
812 Ga0207704_10362674
813 Ga0207691_10007169
814 Ga0207691_10125897
815 Ga0207689_10000687
816 Ga0207689_10010494
817 Ga0207689_10022434
818 Ga0207689_10064671
819 Ga0207689_10075453
820 Ga0207689_10078905
821 Ga0207661_11009531
822 Ga0207679_10931375
823 Ga0207667_10058892
824 Ga0207667_10075413
825 Ga0207667_10330965
826 Ga0207651_10075508
827 Ga0207651_10459038
828 Ga0207651_11155913
829 Ga0207712_10001621
830 Ga0207712_10005567
831 Ga0207712_10009906
832 Ga0207712_10068905
833 Ga0207712_10505723
834 Ga0207668_10022072
835 Ga0207668_10205143
836 Ga0207640_10141488
837 Ga0207640_10328213
838 Ga0207658_10024336
839 Ga0207658_10104504
840 Ga0207658_10284315
841 Ga0207658_10366983
842 Ga0207658_10389658
843 Ga0207658_11280481
844 Ga0207677_10158634
845 Ga0207677_10812979
846 Ga0207703_10062624
847 Ga0207703_10544913
848 Ga0207639_10080415
849 Ga0207639_10082021
850 Ga0207639_10110375
851 Ga0207639_10303168
852 Ga0207708_10983627
853 Ga0207702_10132760
854 Ga0207641_10000194
855 Ga0207641_10023102
856 Ga0207641_10848095
857 Ga0207641_11725184
858 Ga0207648_10003655
859 Ga0207648_10130338
860 Ga0207648_10454524
861 Ga0207648_10712306
862 Ga0207648_10766777
863 Ga0207676_10009188
864 Ga0207676_10278590
865 Ga0207676_10355157
866 Ga0207674_10024037
867 Ga0207674_10048047
868 Ga0207674_10232372
869 Ga0207674_10412915
870 Ga0207674_10727608
871 Ga0207675_100008546
872 Ga0207675_100014275
873 Ga0207675_100020892
874 Ga0207675_100110239
875 Ga0207675_100719031
876 Ga0207675_101118766
877 Ga0207675_101194221
878 Ga0207683_10001842
879 Ga0207683_10010191
880 Ga0207683_10137141
881 Ga0207683_10224692
882 Ga0207683_10230677
883 Ga0207698_10036983
884 Ga0207698_10069798
885 Ga0207698_10086896
886 Ga0207698_10126464
887 Ga0207698_10580077
888 Ga0207428_10145231
889 Ga0268265_10091305
890 Ga0268265_10099902
891 Ga0268265_10301884
892 Ga0268264_10006791
893 Ga0268264_10027588
894 Ga0268264_10037701
895 Ga0268264_10273963
896 Ga0268264_10696496
897 Ga0307509_10336868
898 Ga0395899_0001590
899 Ga0395899_0109957
900 Ga0395899_0274702
901 Ga0395900_0004139
902 Ga0395900_0005994
903 Ga0395900_0847646
904 Ga0395898_0001279
905 Ga0395898_0432205
906 Ga0395898_1134014
907 Ga0395905_0453179
908 Ga0395901_0004694
909 Ga0395901_0007368
910 Ga0395901_0082713
911 Ga0451839_0634014
912 Ga0451853_2221581
913 Ga0439441_072500
914 Ga0466969_0189093
915 Ga0466971_0006994
916 Ga0466957_0399041
917 Ga0466959_0023246
918 Ga0466959_0400243
919 Ga0451576_1095910
920 Ga0495594_0070596
921 Ga0495621_0042690
922 Ga0495658_0166106
923 Ga0501031_0139675
924 Ga0501036_0104660
925 Ga0501037_0046793
926 Ga0501038_0016450
927 Ga0501038_0069401
928 Ga0501039_0080907
929 Ga0501070_0052241
930 Ga0501072_0048925
931 Ga0501035_0071677
932 Ga0501035_0072140
933 Ga0501044_0180619
934 nmdc:mga09592_141298_c1
935 nmdc:mga09592_84060_c1
936 nmdc:mga0qj67_342495_c1
937 nmdc:mga0qj67_508059_c1
938 nmdc:mga06r32_1003295_c1
939 nmdc:mga06r32_93200_c1
940 nmdc:mga08y16_311490_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

40

196

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9221 25 179
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8945 25 179
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8937 21 180
5w2d-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-g34c) for nanotechnology applications 0.872 41 180
5w39-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-n182c) with monobromobimane guest structure 0.8713 41 180
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8827 21 180 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.872 41 180 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8609 30 177 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8482 21 178 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8336 21 180 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A5C9BVI6-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9708 11 180
AF-A0A7L9BJG8-F1-model_v4 YceI family protein 0.964 15 180
AF-A0A257HU49-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9635 10 180
AF-A0A1M7K1K0-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9605 22 180
AF-A0A832F9F2-F1-model_v4 Polyisoprenoid-binding protein 0.9567 10 180

Map