F450481

General Info

Members Datasets Scaffolds Average Seq Length
470 205 940 299

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000001|Ga0495668_0000001_446500_447390
Length 296
Sequence MTTAKADMLDQIKSGQGFIAALDQSGGSTPKALKGYGIGEDAFSNDEEMFGLIHDMRSRIVTAPCFNGEKVIGAILFERTMDGEADGKPVPALLWERGVVPFLKVDKGLEDEADGVQLMKPNPGLDDLCARAVAKGVFGTKMRSVVNLANAAGVKAIVEQQFAEAKRIAAHGLVPIIEPEVNIKSAERDGADRLLLQEITTALGSWDGAPVMLKLSLPAEAGLFQSLVDHPKVLRVVALSGGFARPEACVELAKNPGIIASFSRALLEDLRHQMSDDEFNASLGGAIKEIHAASVA

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
205 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 3.62
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0000001 3300046616 Bacteria 1013420
2 JGI24736J21556_1000050 3300001904 Bacteria 19452
3 JGI24736J21556_1002839 3300001904 Bacteria 3038
4 JGI24752J21851_1000063 3300001976 Bacteria 13680
5 JGI24740J21852_10007380 3300001979 Bacteria 4473
6 JGI24740J21852_10031029 3300001979 Bacteria 1729
7 JGI24737J22298_10001804 3300001990 Bacteria 7671
8 JGI24750J21931_1000405 3300002070 Bacteria 7195
9 JGI24748J21848_1000113 3300002074 Bacteria 16860
10 JGI24738J21930_10001588 3300002075 Bacteria 6258
11 JGI24749J21850_1000119 3300002076 Bacteria 13219
12 JGI24034J26672_10000034 3300002239 Bacteria 85929
13 JGI24742J22300_10000852 3300002244 Bacteria 4660
14 JGI24751J29686_10000280 3300002459 Bacteria 19840
15 JGI24751J29686_10002456 3300002459 Bacteria 3735
16 Ga0055536_1008468 3300003781 Bacteria 4412
17 Ga0065707_10085948 3300005295 Bacteria 5773
18 Ga0065707_10086498 3300005295 Bacteria 5431
19 Ga0070658_10034595 3300005327 Bacteria 4065
20 Ga0070658_10182099 3300005327 Bacteria 1768
21 Ga0070658_10281999 3300005327 Bacteria 1414
22 Ga0070676_10023913 3300005328 Bacteria 3437
23 Ga0070676_10052576 3300005328 Bacteria 2396
24 Ga0070683_100055813 3300005329 Bacteria 3666
25 Ga0070683_100058349 3300005329 Bacteria 3586
26 Ga0070690_100000068 3300005330 Bacteria 51626
27 Ga0070670_100000024 3300005331 Bacteria 189811
28 Ga0070670_100013695 3300005331 Bacteria 6950
29 Ga0070670_100023422 3300005331 Bacteria 5315
30 Ga0070670_100080450 3300005331 Bacteria 2800
31 Ga0070670_100154360 3300005331 Bacteria 1988
32 Ga0070670_100178438 3300005331 Bacteria 1843
33 Ga0068869_100093149 3300005334 Bacteria 2269
34 Ga0070666_10000002 3300005335 Bacteria 478684
35 Ga0070666_10002231 3300005335 Bacteria 11721
36 Ga0070666_10002277 3300005335 Bacteria 11602
37 Ga0070666_10015714 3300005335 Bacteria 4832
38 Ga0070666_10029943 3300005335 Bacteria 3582
39 Ga0070666_10039248 3300005335 Bacteria 3155
40 Ga0070680_100404648 3300005336 Bacteria 1163
41 Ga0070682_100078148 3300005337 Bacteria 2134
42 Ga0068868_100032573 3300005338 Bacteria 4011
43 Ga0068868_100059294 3300005338 Bacteria 3027
44 Ga0070660_100002041 3300005339 Bacteria 13932
45 Ga0070660_100135444 3300005339 Bacteria 1973
46 Ga0070660_100218596 3300005339 Bacteria 1548
47 Ga0070689_100002548 3300005340 Bacteria 11944
48 Ga0070661_100052323 3300005344 Bacteria 2989
49 Ga0070661_100060829 3300005344 Bacteria 2771
50 Ga0070661_100131753 3300005344 Bacteria 1878
51 Ga0070661_100176995 3300005344 Bacteria 1622
52 Ga0070692_10072251 3300005345 Bacteria 1840
53 Ga0070668_100065058 3300005347 Bacteria 2828
54 Ga0070669_100000047 3300005353 Bacteria 118892
55 Ga0070669_100000055 3300005353 Bacteria 111488
56 Ga0070669_100101229 3300005353 Bacteria 2174
57 Ga0070675_100132632 3300005354 Bacteria 2124
58 Ga0070675_100283251 3300005354 Bacteria 1457
59 Ga0070671_100003765 3300005355 Bacteria 11907
60 Ga0070671_100003919 3300005355 Bacteria 11703
61 Ga0070671_100004086 3300005355 Bacteria 11519
62 Ga0070671_100017964 3300005355 Bacteria 5737
63 Ga0070674_100105278 3300005356 Bacteria 2063
64 Ga0070673_100004341 3300005364 Bacteria 8954
65 Ga0070673_100257421 3300005364 Bacteria 1523
66 Ga0070688_100006989 3300005365 Bacteria 6065
67 Ga0070659_100026260 3300005366 Bacteria 4479
68 Ga0070659_100126604 3300005366 Bacteria 2072
69 Ga0070659_100135556 3300005366 Bacteria 2002
70 Ga0070659_100207399 3300005366 Bacteria 1614
71 Ga0070659_100425964 3300005366 Bacteria 1123
72 Ga0070667_100007536 3300005367 Bacteria 9028
73 Ga0070667_100007975 3300005367 Bacteria 8782
74 Ga0070667_100016730 3300005367 Bacteria 6070
75 Ga0070667_100028334 3300005367 Bacteria 4662
76 Ga0070667_100083646 3300005367 Bacteria 2734
77 Ga0070667_100168452 3300005367 Bacteria 1932
78 Ga0070713_100067864 3300005436 Bacteria 3004
79 Ga0070663_100019395 3300005455 Bacteria 4481
80 Ga0070663_100030722 3300005455 Bacteria 3685
81 Ga0070663_100265214 3300005455 Bacteria 1363
82 Ga0070678_100001675 3300005456 Bacteria 11874
83 Ga0070678_100003048 3300005456 Bacteria 9284
84 Ga0070678_100014022 3300005456 Bacteria 5040
85 Ga0070678_100081151 3300005456 Bacteria 2458
86 Ga0070662_100003498 3300005457 Bacteria 9794
87 Ga0070662_100010408 3300005457 Bacteria 6100
88 Ga0070662_100041431 3300005457 Bacteria 3285
89 Ga0070662_100167333 3300005457 Bacteria 1724
90 Ga0070681_10051860 3300005458 Bacteria 4091
91 Ga0068867_100072554 3300005459 Bacteria 2577
92 Ga0070685_10000337 3300005466 Bacteria 28829
93 Ga0070679_100185740 3300005530 Bacteria 2049
94 Ga0070684_100022302 3300005535 Bacteria 5278
95 Ga0070684_100282837 3300005535 Bacteria 1520
96 Ga0070684_100412808 3300005535 Bacteria 1246
97 Ga0068853_100071557 3300005539 Bacteria 3020
98 Ga0070672_100001974 3300005543 Bacteria 12842
99 Ga0070672_100026483 3300005543 Bacteria 4315
100 Ga0070686_100000003 3300005544 Bacteria 308397
101 Ga0070665_100000036 3300005548 Bacteria 314603
102 Ga0070665_100061780 3300005548 Bacteria 3756
103 Ga0070665_100064762 3300005548 Bacteria 3666
104 Ga0068855_100566300 3300005563 Bacteria 1228
105 Ga0070664_100011244 3300005564 Bacteria 7261
106 Ga0070664_100022722 3300005564 Bacteria 5172
107 Ga0070664_100023812 3300005564 Bacteria 5058
108 Ga0070664_100039375 3300005564 Bacteria 3983
109 Ga0070664_100062865 3300005564 Bacteria 3165
110 Ga0070664_100150247 3300005564 Bacteria 2056
111 Ga0068857_100009975 3300005577 Bacteria 8243
112 Ga0068857_100069795 3300005577 Bacteria 3129
113 Ga0068854_100006274 3300005578 Bacteria 7556
114 Ga0068854_100322726 3300005578 Bacteria 1256
115 Ga0068856_100062685 3300005614 Bacteria 3672
116 Ga0068856_100147399 3300005614 Bacteria 2361
117 Ga0068852_100000973 3300005616 Bacteria 18804
118 Ga0068852_100064100 3300005616 Bacteria 3202
119 Ga0068852_100072583 3300005616 Bacteria 3025
120 Ga0068859_100002070 3300005617 Bacteria 20476
121 Ga0068859_100082026 3300005617 Bacteria 3267
122 Ga0068864_100000036 3300005618 Bacteria 189811
123 Ga0068864_100005293 3300005618 Bacteria 10561
124 Ga0068864_100006618 3300005618 Bacteria 9483
125 Ga0068864_100008310 3300005618 Bacteria 8561
126 Ga0068864_100011993 3300005618 Bacteria 7156
127 Ga0068864_100024410 3300005618 Bacteria 5086
128 Ga0068864_100053440 3300005618 Bacteria 3485
129 Ga0068864_100130937 3300005618 Bacteria 2253
130 Ga0068861_100005435 3300005719 Bacteria 8623
131 Ga0068861_100093106 3300005719 Bacteria 2382
132 Ga0068851_10037225 3300005834 Bacteria 2438
133 Ga0068870_10148890 3300005840 Bacteria 1377
134 Ga0068863_100000034 3300005841 Bacteria 168359
135 Ga0068863_100002388 3300005841 Bacteria 18667
136 Ga0068863_100004012 3300005841 Bacteria 14535
137 Ga0068863_100006118 3300005841 Bacteria 11804
138 Ga0068863_100270233 3300005841 Bacteria 1646
139 Ga0068858_100011572 3300005842 Bacteria 8322
140 Ga0068858_100013052 3300005842 Bacteria 7835
141 Ga0068858_100040890 3300005842 Bacteria 4300
142 Ga0068860_100000001 3300005843 Bacteria 703043
143 Ga0068860_100029076 3300005843 Bacteria 5315
144 Ga0068860_100110864 3300005843 Bacteria 2623
145 Ga0068860_100112729 3300005843 Bacteria 2600
146 Ga0068860_100539211 3300005843 Bacteria 1168
147 Ga0068862_100000033 3300005844 Bacteria 176515
148 Ga0068862_100001230 3300005844 Bacteria 24152
149 Ga0081455_10002904 3300005937 Bacteria 20117
150 Ga0070716_100138673 3300006173 Bacteria 1548
151 Ga0097621_100022233 3300006237 Bacteria 4921
152 Ga0097621_100070851 3300006237 Bacteria 2879
153 Ga0097621_100188315 3300006237 Bacteria 1786
154 Ga0068871_100006708 3300006358 Bacteria 8171
155 Ga0097620_100002070 3300006931 Bacteria 20476
156 Ga0097620_100082031 3300006931 Bacteria 3267
157 Ga0105250_10009842 3300009092 Bacteria 4014
158 Ga0105245_10005641 3300009098 Bacteria 10996
159 Ga0105245_10297043 3300009098 Bacteria 1583
160 Ga0105247_10018127 3300009101 Bacteria 4223
161 Ga0105242_10006705 3300009176 Bacteria 8883
162 Ga0105248_10000091 3300009177 Bacteria 101191
163 Ga0105248_10000096 3300009177 Bacteria 97519
164 Ga0105248_10053785 3300009177 Bacteria 4517
165 Ga0105248_10173813 3300009177 Bacteria 2428
166 Ga0105248_10202777 3300009177 Bacteria 2235
167 Ga0105237_10058417 3300009545 Bacteria 3860
168 Ga0105238_10009110 3300009551 Bacteria 9932
169 Ga0105249_10000026 3300009553 Bacteria 232053
170 Ga0105239_10165072 3300010375 Bacteria 2476
171 Ga0105239_10992516 3300010375 Bacteria 965
172 Ga0157373_10010767 3300013100 Bacteria 6730
173 Ga0157373_10070975 3300013100 Bacteria 2461
174 Ga0157371_10033884 3300013102 Bacteria 3667
175 Ga0157371_10073442 3300013102 Bacteria 2422
176 Ga0157371_10073983 3300013102 Bacteria 2413
177 Ga0157370_10001103 3300013104 Bacteria 33826
178 Ga0157370_10007621 3300013104 Bacteria 11756
179 Ga0157370_10099484 3300013104 Bacteria 2726
180 Ga0157369_10085942 3300013105 Bacteria 3360
181 Ga0157369_10089608 3300013105 Bacteria 3284
182 Ga0157369_10178800 3300013105 Bacteria 2233
183 Ga0157369_10350681 3300013105 Bacteria 1533
184 Ga0157374_10028621 3300013296 Bacteria 5035
185 Ga0157374_10155727 3300013296 Bacteria 2223
186 Ga0157374_10192925 3300013296 Bacteria 1993
187 Ga0157378_10028843 3300013297 Bacteria 4899
188 Ga0157378_10302349 3300013297 Bacteria 1549
189 Ga0163162_10013012 3300013306 Bacteria 8120
190 Ga0163162_10028826 3300013306 Bacteria 5494
191 Ga0163162_10063826 3300013306 Bacteria 3727
192 Ga0163162_10080188 3300013306 Bacteria 3331
193 Ga0163162_10173217 3300013306 Bacteria 2283
194 Ga0163162_10213907 3300013306 Bacteria 2058
195 Ga0163162_10494780 3300013306 Bacteria 1353
196 Ga0157372_10727589 3300013307 Bacteria 1154
197 Ga0157372_10732960 3300013307 Bacteria 1149
198 Ga0157375_10005156 3300013308 Bacteria 11342
199 Ga0163163_10011444 3300014325 Bacteria 8049
200 Ga0163163_10013075 3300014325 Bacteria 7583
201 Ga0163163_10019659 3300014325 Bacteria 6346
202 Ga0163163_10031056 3300014325 Bacteria 5152
203 Ga0163163_10181814 3300014325 Bacteria 2150
204 Ga0157380_10000209 3300014326 Bacteria 34445
205 Ga0157380_10000495 3300014326 Bacteria 24048
206 Ga0157380_10005216 3300014326 Bacteria 9084
207 Ga0157377_10051559 3300014745 Bacteria 2321
208 Ga0157379_10015207 3300014968 Bacteria 6748
209 Ga0157376_10008170 3300014969 Bacteria 7530
210 Ga0157376_10438870 3300014969 Bacteria 1271
211 Ga0163161_10000008 3300017792 Bacteria 294642
212 Ga0209257_1017985 3300025304 Bacteria 2748
213 Ga0207697_10018378 3300025315 Bacteria 2867
214 Ga0207656_10053738 3300025321 Bacteria 1749
215 Ga0207710_10116667 3300025900 Bacteria 1272
216 Ga0207688_10002334 3300025901 Bacteria 10193
217 Ga0207688_10085206 3300025901 Bacteria 1809
218 Ga0207680_10000004 3300025903 Bacteria 827324
219 Ga0207680_10007362 3300025903 Bacteria 5358
220 Ga0207680_10011823 3300025903 Bacteria 4425
221 Ga0207680_10026892 3300025903 Bacteria 3194
222 Ga0207647_10004106 3300025904 Bacteria 10807
223 Ga0207647_10015256 3300025904 Bacteria 5275
224 Ga0207647_10039169 3300025904 Bacteria 2993
225 Ga0207647_10057243 3300025904 Bacteria 2390
226 Ga0207647_10087058 3300025904 Bacteria 1867
227 Ga0207645_10017372 3300025907 Bacteria 4748
228 Ga0207643_10167019 3300025908 Bacteria 1326
229 Ga0207705_10031274 3300025909 Bacteria 3797
230 Ga0207705_10051879 3300025909 Bacteria 2952
231 Ga0207705_10089909 3300025909 Bacteria 2247
232 Ga0207705_10115878 3300025909 Bacteria 1983
233 Ga0207705_10171006 3300025909 Bacteria 1636
234 Ga0207705_10228685 3300025909 Bacteria 1414
235 Ga0207654_10001498 3300025911 Bacteria 12324
236 Ga0207707_10066825 3300025912 Bacteria 3131
237 Ga0207707_10297164 3300025912 Bacteria 1397
238 Ga0207695_10004440 3300025913 Bacteria 19138
239 Ga0207671_10003387 3300025914 Bacteria 15960
240 Ga0207660_10048258 3300025917 Bacteria 3012
241 Ga0207657_10010408 3300025919 Bacteria 9285
242 Ga0207657_10022074 3300025919 Bacteria 5974
243 Ga0207657_10048370 3300025919 Bacteria 3714
244 Ga0207649_10020768 3300025920 Bacteria 3770
245 Ga0207649_10049103 3300025920 Bacteria 2604
246 Ga0207649_10081489 3300025920 Bacteria 2096
247 Ga0207649_10132121 3300025920 Bacteria 1697
248 Ga0207649_10186526 3300025920 Bacteria 1455
249 Ga0207652_10235495 3300025921 Bacteria 1650
250 Ga0207681_10000014 3300025923 Bacteria 353422
251 Ga0207681_10000178 3300025923 Bacteria 52013
252 Ga0207681_10147870 3300025923 Bacteria 1757
253 Ga0207681_10234456 3300025923 Bacteria 1426
254 Ga0207694_10017125 3300025924 Bacteria 5475
255 Ga0207694_10031695 3300025924 Bacteria 4040
256 Ga0207694_10197804 3300025924 Bacteria 1634
257 Ga0207650_10000015 3300025925 Bacteria 369173
258 Ga0207650_10003932 3300025925 Bacteria 10168
259 Ga0207650_10009776 3300025925 Bacteria 6556
260 Ga0207650_10053429 3300025925 Bacteria 2994
261 Ga0207650_10159575 3300025925 Bacteria 1786
262 Ga0207650_10175935 3300025925 Bacteria 1703
263 Ga0207659_10066901 3300025926 Bacteria 2609
264 Ga0207659_10092978 3300025926 Bacteria 2256
265 Ga0207659_10220110 3300025926 Bacteria 1526
266 Ga0207687_10066297 3300025927 Bacteria 2566
267 Ga0207700_10087137 3300025928 Bacteria 2455
268 Ga0207664_10010269 3300025929 Bacteria 6611
269 Ga0207644_10000235 3300025931 Bacteria 38139
270 Ga0207644_10000480 3300025931 Bacteria 25749
271 Ga0207644_10002193 3300025931 Bacteria 12661
272 Ga0207644_10005323 3300025931 Bacteria 8398
273 Ga0207644_10006566 3300025931 Bacteria 7578
274 Ga0207644_10011734 3300025931 Bacteria 5799
275 Ga0207690_10043295 3300025932 Bacteria 2962
276 Ga0207690_10119510 3300025932 Bacteria 1912
277 Ga0207706_10007429 3300025933 Bacteria 10135
278 Ga0207706_10042336 3300025933 Bacteria 4037
279 Ga0207706_10053757 3300025933 Bacteria 3555
280 Ga0207706_10062269 3300025933 Bacteria 3285
281 Ga0207706_10068199 3300025933 Bacteria 3130
282 Ga0207706_10073354 3300025933 Bacteria 3010
283 Ga0207706_10078440 3300025933 Bacteria 2905
284 Ga0207706_10150333 3300025933 Bacteria 2048
285 Ga0207686_10049148 3300025934 Bacteria 2617
286 Ga0207670_10036047 3300025936 Bacteria 3214
287 Ga0207669_10378759 3300025937 Bacteria 1102
288 Ga0207704_10015845 3300025938 Bacteria 3855
289 Ga0207665_10083935 3300025939 Bacteria 2198
290 Ga0207691_10004948 3300025940 Bacteria 12851
291 Ga0207691_10045761 3300025940 Bacteria 4022
292 Ga0207691_10046368 3300025940 Bacteria 3994
293 Ga0207691_10092297 3300025940 Bacteria 2711
294 Ga0207711_10001481 3300025941 Bacteria 21836
295 Ga0207711_10002373 3300025941 Bacteria 16857
296 Ga0207711_10003731 3300025941 Bacteria 13137
297 Ga0207711_10004888 3300025941 Bacteria 11374
298 Ga0207711_10005994 3300025941 Bacteria 10274
299 Ga0207689_10015644 3300025942 Bacteria 6425
300 Ga0207679_10068893 3300025945 Bacteria 2660
301 Ga0207679_10116062 3300025945 Bacteria 2122
302 Ga0207679_10332935 3300025945 Bacteria 1318
303 Ga0207667_10023457 3300025949 Bacteria 6793
304 Ga0207651_10004134 3300025960 Bacteria 7251
305 Ga0207651_10005811 3300025960 Bacteria 6374
306 Ga0207712_10000001 3300025961 Bacteria 750309
307 Ga0207668_10050122 3300025972 Bacteria 2875
308 Ga0207668_10155142 3300025972 Bacteria 1778
309 Ga0207640_10004572 3300025981 Bacteria 7507
310 Ga0207640_10045258 3300025981 Bacteria 2825
311 Ga0207640_10059350 3300025981 Bacteria 2525
312 Ga0207640_10132299 3300025981 Bacteria 1805
313 Ga0207658_10005300 3300025986 Bacteria 8868
314 Ga0207658_10005800 3300025986 Bacteria 8452
315 Ga0207658_10006952 3300025986 Bacteria 7703
316 Ga0207658_10021158 3300025986 Bacteria 4511
317 Ga0207658_10031667 3300025986 Bacteria 3757
318 Ga0207658_10082729 3300025986 Bacteria 2466
319 Ga0207658_10134485 3300025986 Bacteria 1991
320 Ga0207677_10003757 3300026023 Bacteria 8055
321 Ga0207677_10018683 3300026023 Bacteria 4165
322 Ga0207677_10032197 3300026023 Bacteria 3368
323 Ga0207703_10012097 3300026035 Bacteria 6723
324 Ga0207703_10039068 3300026035 Bacteria 3791
325 Ga0207639_10004054 3300026041 Bacteria 9882
326 Ga0207678_10006822 3300026067 Bacteria 10127
327 Ga0207678_10015624 3300026067 Bacteria 6674
328 Ga0207678_10015932 3300026067 Bacteria 6602
329 Ga0207678_10022829 3300026067 Bacteria 5478
330 Ga0207678_10027098 3300026067 Bacteria 4998
331 Ga0207678_10034401 3300026067 Bacteria 4413
332 Ga0207678_10131271 3300026067 Bacteria 2137
333 Ga0207678_10304810 3300026067 Bacteria 1369
334 Ga0207702_10002323 3300026078 Bacteria 18167
335 Ga0207702_10069392 3300026078 Bacteria 3030
336 Ga0207702_10110538 3300026078 Bacteria 2442
337 Ga0207702_10413214 3300026078 Bacteria 1303
338 Ga0207641_10000057 3300026088 Bacteria 168603
339 Ga0207641_10000711 3300026088 Bacteria 35681
340 Ga0207641_10017731 3300026088 Bacteria 5832
341 Ga0207641_10030638 3300026088 Bacteria 4456
342 Ga0207641_10112829 3300026088 Bacteria 2412
343 Ga0207648_10004358 3300026089 Bacteria 14561
344 Ga0207648_10033869 3300026089 Bacteria 4504
345 Ga0207648_10036608 3300026089 Bacteria 4323
346 Ga0207676_10000021 3300026095 Bacteria 296572
347 Ga0207676_10002574 3300026095 Bacteria 12940
348 Ga0207676_10003395 3300026095 Bacteria 11252
349 Ga0207676_10028584 3300026095 Bacteria 4166
350 Ga0207676_10037835 3300026095 Bacteria 3680
351 Ga0207676_10053314 3300026095 Bacteria 3165
352 Ga0207676_10104403 3300026095 Bacteria 2357
353 Ga0207676_10263799 3300026095 Bacteria 1556
354 Ga0207674_10006197 3300026116 Bacteria 14098
355 Ga0207674_10083919 3300026116 Bacteria 3184
356 Ga0207674_10094734 3300026116 Bacteria 2972
357 Ga0207674_10170668 3300026116 Bacteria 2129
358 Ga0207674_10392306 3300026116 Bacteria 1342
359 Ga0207675_100000571 3300026118 Bacteria 35943
360 Ga0207675_100002138 3300026118 Bacteria 19611
361 Ga0207683_10003116 3300026121 Bacteria 14485
362 Ga0207683_10003428 3300026121 Bacteria 13817
363 Ga0207683_10026449 3300026121 Bacteria 5007
364 Ga0207683_10064322 3300026121 Bacteria 3232
365 Ga0207683_10331667 3300026121 Bacteria 1395
366 Ga0207698_10000847 3300026142 Bacteria 17770
367 Ga0207698_10008362 3300026142 Bacteria 6540
368 Ga0207698_10009031 3300026142 Bacteria 6330
369 Ga0207698_10024453 3300026142 Bacteria 4239
370 Ga0207698_10080539 3300026142 Bacteria 2624
371 Ga0268266_10000042 3300028379 Bacteria 316826
372 Ga0268266_10169587 3300028379 Bacteria 1980
373 Ga0268265_10000013 3300028380 Bacteria 341536
374 Ga0268265_10000233 3300028380 Bacteria 63492
375 Ga0268265_10261375 3300028380 Bacteria 1539
376 Ga0268264_10000006 3300028381 Bacteria 827324
377 Ga0268264_10032269 3300028381 Bacteria 4296
378 Ga0268264_10196672 3300028381 Bacteria 1841
379 Ga0307405_10378220 3300031731 Bacteria 1102
380 Ga0307410_10009286 3300031852 Bacteria 5509
381 Ga0307406_10030198 3300031901 Bacteria 3288
382 Ga0307407_10347415 3300031903 Bacteria 1049
383 Ga0307412_10034152 3300031911 Bacteria 3239
384 Ga0307412_10076586 3300031911 Bacteria 2298
385 Ga0307412_10096685 3300031911 Bacteria 2079
386 Ga0307412_10212805 3300031911 Bacteria 1476
387 Ga0307409_100101851 3300031995 Bacteria 2384
388 Ga0307409_100253575 3300031995 Bacteria 1610
389 Ga0307409_100316241 3300031995 Bacteria 1459
390 Ga0307414_10417306 3300032004 Bacteria 1169
391 Ga0307414_10485913 3300032004 Bacteria 1090
392 Ga0307411_10003005 3300032005 Bacteria 7686
393 Ga0307411_10052476 3300032005 Bacteria 2666
394 Ga0307415_100002556 3300032126 Bacteria 9100
395 Ga0395899_0049094 3300037312 Bacteria 3138
396 Ga0395899_0069775 3300037312 Bacteria 2573
397 Ga0395899_0179402 3300037312 Bacteria 1487
398 Ga0395900_0038883 3300037418 Bacteria 4904
399 Ga0395900_0101979 3300037418 Bacteria 2948
400 Ga0395900_0113487 3300037418 Bacteria 2781
401 Ga0395900_0174706 3300037418 Bacteria 2185
402 Ga0395900_0193044 3300037418 Bacteria 2064
403 Ga0395898_0010117 3300037466 Bacteria 9873
404 Ga0395898_0093201 3300037466 Bacteria 2895
405 Ga0395898_0202780 3300037466 Bacteria 1893
406 Ga0395905_0004125 3300037471 Bacteria 15214
407 Ga0395905_0004550 3300037471 Bacteria 14359
408 Ga0395905_0011553 3300037471 Bacteria 8533
409 Ga0395905_0015707 3300037471 Bacteria 7193
410 Ga0395905_0036984 3300037471 Bacteria 4586
411 Ga0395905_0097878 3300037471 Bacteria 2755
412 Ga0395905_0163692 3300037471 Bacteria 2090
413 Ga0395905_0266835 3300037471 Bacteria 1597
414 Ga0395901_0000447 3300038443 Bacteria 47979
415 Ga0395901_0061277 3300038443 Bacteria 3915
416 Ga0395901_0077844 3300038443 Bacteria 3461
417 Ga0395901_0100630 3300038443 Bacteria 3032
418 Ga0436365_0735741 3300039437 Bacteria 1829
419 Ga0439448_0001796 3300042005 Bacteria 5671
420 Ga0439458_0000869 3300042157 Bacteria 7824
421 Ga0466957_0080757 3300044842 Bacteria 2025
422 Ga0466967_0063952 3300045976 Bacteria 3271
423 Ga0466967_0132853 3300045976 Bacteria 2312
424 Ga0466967_0315653 3300045976 Bacteria 1506
425 Ga0495616_0000887 3300046513 Bacteria 21617
426 Ga0495654_0005438 3300046530 Bacteria 7397
427 Ga0495622_0051376 3300046557 Bacteria 1912
428 Ga0495668_0021589 3300046616 Bacteria 3689
429 Ga0495668_0031375 3300046616 Bacteria 2995
430 Ga0495669_0124017 3300046684 Bacteria 1213
431 Ga0495671_0023690 3300046692 Bacteria 3206
432 Ga0495589_0059991 3300046794 Bacteria 1869
433 Ga0496102_0000043 3300048905 Bacteria 189201
434 Ga0496102_0022877 3300048905 Bacteria 5542
435 Ga0496103_0000086 3300048906 Bacteria 104765
436 Ga0496103_0011704 3300048906 Bacteria 5203
437 Ga0496104_0112979 3300048907 Bacteria 2605
438 Ga0496105_0109301 3300048908 Bacteria 2283
439 Ga0496106_0158143 3300048909 Bacteria 1791
440 Ga0496109_0002390 3300048912 Bacteria 15690
441 Ga0496109_0008457 3300048912 Bacteria 8748
442 Ga0496109_0104251 3300048912 Bacteria 2633
443 Ga0496110_0325758 3300048913 Bacteria 1399
444 Ga0496111_0017925 3300048914 Bacteria 4897
445 Ga0496111_0135398 3300048914 Bacteria 1824
446 Ga0496112_0129220 3300048915 Bacteria 2497
447 Ga0496112_0371034 3300048915 Bacteria 1372
448 Ga0496113_0012937 3300048916 Bacteria 5629
449 Ga0496113_0041800 3300048916 Bacteria 3385
450 Ga0496116_0007459 3300048919 Bacteria 9696
451 Ga0496117_0000104 3300048920 Bacteria 189201
452 Ga0496117_0005462 3300048920 Bacteria 13330
453 Ga0496118_0000080 3300048921 Bacteria 189201
454 Ga0496118_0048616 3300048921 Bacteria 3273
455 Ga0496121_0069673 3300048924 Bacteria 2837
456 Ga0496124_0000093 3300048927 Bacteria 189201
457 Ga0496125_0046152 3300048928 Bacteria 3658
458 Ga0501038_0099632 3300049574 Bacteria 2422
459 Ga0501223_000015 3300049663 Bacteria 68826
460 Ga0501225_0000167 3300049705 Bacteria 19939
461 nmdc:mga05p37_481510_c1 3300050507 Bacteria 1429
462 Ga0500643_001092 3300053087 Bacteria 16292
463 Ga0500592_002049 3300053116 Bacteria 3248
464 Ga0500594_0005092 3300053118 Bacteria 2905
465 Ga0500627_0001222 3300053158 Bacteria 7069
466 Ga0500627_0009380 3300053158 Bacteria 3522
467 Ga0500611_005866 3300053727 Bacteria 1755
468 Ga0500645_024531 3300053730 Bacteria 1843
469 2644039036 2643221605 Bacteria 4772303
470 2848299791 2848297114 Bacteria 3608511
471 Ga0495668_0000001
472 JGI24736J21556_1000050
473 JGI24736J21556_1002839
474 JGI24752J21851_1000063
475 JGI24740J21852_10007380
476 JGI24740J21852_10031029
477 JGI24737J22298_10001804
478 JGI24750J21931_1000405
479 JGI24748J21848_1000113
480 JGI24738J21930_10001588
481 JGI24749J21850_1000119
482 JGI24034J26672_10000034
483 JGI24742J22300_10000852
484 JGI24751J29686_10000280
485 JGI24751J29686_10002456
486 Ga0055536_1008468
487 Ga0065707_10085948
488 Ga0065707_10086498
489 Ga0070658_10034595
490 Ga0070658_10182099
491 Ga0070658_10281999
492 Ga0070676_10023913
493 Ga0070676_10052576
494 Ga0070683_100055813
495 Ga0070683_100058349
496 Ga0070690_100000068
497 Ga0070670_100000024
498 Ga0070670_100013695
499 Ga0070670_100023422
500 Ga0070670_100080450
501 Ga0070670_100154360
502 Ga0070670_100178438
503 Ga0068869_100093149
504 Ga0070666_10000002
505 Ga0070666_10002231
506 Ga0070666_10002277
507 Ga0070666_10015714
508 Ga0070666_10029943
509 Ga0070666_10039248
510 Ga0070680_100404648
511 Ga0070682_100078148
512 Ga0068868_100032573
513 Ga0068868_100059294
514 Ga0070660_100002041
515 Ga0070660_100135444
516 Ga0070660_100218596
517 Ga0070689_100002548
518 Ga0070661_100052323
519 Ga0070661_100060829
520 Ga0070661_100131753
521 Ga0070661_100176995
522 Ga0070692_10072251
523 Ga0070668_100065058
524 Ga0070669_100000047
525 Ga0070669_100000055
526 Ga0070669_100101229
527 Ga0070675_100132632
528 Ga0070675_100283251
529 Ga0070671_100003765
530 Ga0070671_100003919
531 Ga0070671_100004086
532 Ga0070671_100017964
533 Ga0070674_100105278
534 Ga0070673_100004341
535 Ga0070673_100257421
536 Ga0070688_100006989
537 Ga0070659_100026260
538 Ga0070659_100126604
539 Ga0070659_100135556
540 Ga0070659_100207399
541 Ga0070659_100425964
542 Ga0070667_100007536
543 Ga0070667_100007975
544 Ga0070667_100016730
545 Ga0070667_100028334
546 Ga0070667_100083646
547 Ga0070667_100168452
548 Ga0070713_100067864
549 Ga0070663_100019395
550 Ga0070663_100030722
551 Ga0070663_100265214
552 Ga0070678_100001675
553 Ga0070678_100003048
554 Ga0070678_100014022
555 Ga0070678_100081151
556 Ga0070662_100003498
557 Ga0070662_100010408
558 Ga0070662_100041431
559 Ga0070662_100167333
560 Ga0070681_10051860
561 Ga0068867_100072554
562 Ga0070685_10000337
563 Ga0070679_100185740
564 Ga0070684_100022302
565 Ga0070684_100282837
566 Ga0070684_100412808
567 Ga0068853_100071557
568 Ga0070672_100001974
569 Ga0070672_100026483
570 Ga0070686_100000003
571 Ga0070665_100000036
572 Ga0070665_100061780
573 Ga0070665_100064762
574 Ga0068855_100566300
575 Ga0070664_100011244
576 Ga0070664_100022722
577 Ga0070664_100023812
578 Ga0070664_100039375
579 Ga0070664_100062865
580 Ga0070664_100150247
581 Ga0068857_100009975
582 Ga0068857_100069795
583 Ga0068854_100006274
584 Ga0068854_100322726
585 Ga0068856_100062685
586 Ga0068856_100147399
587 Ga0068852_100000973
588 Ga0068852_100064100
589 Ga0068852_100072583
590 Ga0068859_100002070
591 Ga0068859_100082026
592 Ga0068864_100000036
593 Ga0068864_100005293
594 Ga0068864_100006618
595 Ga0068864_100008310
596 Ga0068864_100011993
597 Ga0068864_100024410
598 Ga0068864_100053440
599 Ga0068864_100130937
600 Ga0068861_100005435
601 Ga0068861_100093106
602 Ga0068851_10037225
603 Ga0068870_10148890
604 Ga0068863_100000034
605 Ga0068863_100002388
606 Ga0068863_100004012
607 Ga0068863_100006118
608 Ga0068863_100270233
609 Ga0068858_100011572
610 Ga0068858_100013052
611 Ga0068858_100040890
612 Ga0068860_100000001
613 Ga0068860_100029076
614 Ga0068860_100110864
615 Ga0068860_100112729
616 Ga0068860_100539211
617 Ga0068862_100000033
618 Ga0068862_100001230
619 Ga0081455_10002904
620 Ga0070716_100138673
621 Ga0097621_100022233
622 Ga0097621_100070851
623 Ga0097621_100188315
624 Ga0068871_100006708
625 Ga0097620_100002070
626 Ga0097620_100082031
627 Ga0105250_10009842
628 Ga0105245_10005641
629 Ga0105245_10297043
630 Ga0105247_10018127
631 Ga0105242_10006705
632 Ga0105248_10000091
633 Ga0105248_10000096
634 Ga0105248_10053785
635 Ga0105248_10173813
636 Ga0105248_10202777
637 Ga0105237_10058417
638 Ga0105238_10009110
639 Ga0105249_10000026
640 Ga0105239_10165072
641 Ga0105239_10992516
642 Ga0157373_10010767
643 Ga0157373_10070975
644 Ga0157371_10033884
645 Ga0157371_10073442
646 Ga0157371_10073983
647 Ga0157370_10001103
648 Ga0157370_10007621
649 Ga0157370_10099484
650 Ga0157369_10085942
651 Ga0157369_10089608
652 Ga0157369_10178800
653 Ga0157369_10350681
654 Ga0157374_10028621
655 Ga0157374_10155727
656 Ga0157374_10192925
657 Ga0157378_10028843
658 Ga0157378_10302349
659 Ga0163162_10013012
660 Ga0163162_10028826
661 Ga0163162_10063826
662 Ga0163162_10080188
663 Ga0163162_10173217
664 Ga0163162_10213907
665 Ga0163162_10494780
666 Ga0157372_10727589
667 Ga0157372_10732960
668 Ga0157375_10005156
669 Ga0163163_10011444
670 Ga0163163_10013075
671 Ga0163163_10019659
672 Ga0163163_10031056
673 Ga0163163_10181814
674 Ga0157380_10000209
675 Ga0157380_10000495
676 Ga0157380_10005216
677 Ga0157377_10051559
678 Ga0157379_10015207
679 Ga0157376_10008170
680 Ga0157376_10438870
681 Ga0163161_10000008
682 Ga0209257_1017985
683 Ga0207697_10018378
684 Ga0207656_10053738
685 Ga0207710_10116667
686 Ga0207688_10002334
687 Ga0207688_10085206
688 Ga0207680_10000004
689 Ga0207680_10007362
690 Ga0207680_10011823
691 Ga0207680_10026892
692 Ga0207647_10004106
693 Ga0207647_10015256
694 Ga0207647_10039169
695 Ga0207647_10057243
696 Ga0207647_10087058
697 Ga0207645_10017372
698 Ga0207643_10167019
699 Ga0207705_10031274
700 Ga0207705_10051879
701 Ga0207705_10089909
702 Ga0207705_10115878
703 Ga0207705_10171006
704 Ga0207705_10228685
705 Ga0207654_10001498
706 Ga0207707_10066825
707 Ga0207707_10297164
708 Ga0207695_10004440
709 Ga0207671_10003387
710 Ga0207660_10048258
711 Ga0207657_10010408
712 Ga0207657_10022074
713 Ga0207657_10048370
714 Ga0207649_10020768
715 Ga0207649_10049103
716 Ga0207649_10081489
717 Ga0207649_10132121
718 Ga0207649_10186526
719 Ga0207652_10235495
720 Ga0207681_10000014
721 Ga0207681_10000178
722 Ga0207681_10147870
723 Ga0207681_10234456
724 Ga0207694_10017125
725 Ga0207694_10031695
726 Ga0207694_10197804
727 Ga0207650_10000015
728 Ga0207650_10003932
729 Ga0207650_10009776
730 Ga0207650_10053429
731 Ga0207650_10159575
732 Ga0207650_10175935
733 Ga0207659_10066901
734 Ga0207659_10092978
735 Ga0207659_10220110
736 Ga0207687_10066297
737 Ga0207700_10087137
738 Ga0207664_10010269
739 Ga0207644_10000235
740 Ga0207644_10000480
741 Ga0207644_10002193
742 Ga0207644_10005323
743 Ga0207644_10006566
744 Ga0207644_10011734
745 Ga0207690_10043295
746 Ga0207690_10119510
747 Ga0207706_10007429
748 Ga0207706_10042336
749 Ga0207706_10053757
750 Ga0207706_10062269
751 Ga0207706_10068199
752 Ga0207706_10073354
753 Ga0207706_10078440
754 Ga0207706_10150333
755 Ga0207686_10049148
756 Ga0207670_10036047
757 Ga0207669_10378759
758 Ga0207704_10015845
759 Ga0207665_10083935
760 Ga0207691_10004948
761 Ga0207691_10045761
762 Ga0207691_10046368
763 Ga0207691_10092297
764 Ga0207711_10001481
765 Ga0207711_10002373
766 Ga0207711_10003731
767 Ga0207711_10004888
768 Ga0207711_10005994
769 Ga0207689_10015644
770 Ga0207679_10068893
771 Ga0207679_10116062
772 Ga0207679_10332935
773 Ga0207667_10023457
774 Ga0207651_10004134
775 Ga0207651_10005811
776 Ga0207712_10000001
777 Ga0207668_10050122
778 Ga0207668_10155142
779 Ga0207640_10004572
780 Ga0207640_10045258
781 Ga0207640_10059350
782 Ga0207640_10132299
783 Ga0207658_10005300
784 Ga0207658_10005800
785 Ga0207658_10006952
786 Ga0207658_10021158
787 Ga0207658_10031667
788 Ga0207658_10082729
789 Ga0207658_10134485
790 Ga0207677_10003757
791 Ga0207677_10018683
792 Ga0207677_10032197
793 Ga0207703_10012097
794 Ga0207703_10039068
795 Ga0207639_10004054
796 Ga0207678_10006822
797 Ga0207678_10015624
798 Ga0207678_10015932
799 Ga0207678_10022829
800 Ga0207678_10027098
801 Ga0207678_10034401
802 Ga0207678_10131271
803 Ga0207678_10304810
804 Ga0207702_10002323
805 Ga0207702_10069392
806 Ga0207702_10110538
807 Ga0207702_10413214
808 Ga0207641_10000057
809 Ga0207641_10000711
810 Ga0207641_10017731
811 Ga0207641_10030638
812 Ga0207641_10112829
813 Ga0207648_10004358
814 Ga0207648_10033869
815 Ga0207648_10036608
816 Ga0207676_10000021
817 Ga0207676_10002574
818 Ga0207676_10003395
819 Ga0207676_10028584
820 Ga0207676_10037835
821 Ga0207676_10053314
822 Ga0207676_10104403
823 Ga0207676_10263799
824 Ga0207674_10006197
825 Ga0207674_10083919
826 Ga0207674_10094734
827 Ga0207674_10170668
828 Ga0207674_10392306
829 Ga0207675_100000571
830 Ga0207675_100002138
831 Ga0207683_10003116
832 Ga0207683_10003428
833 Ga0207683_10026449
834 Ga0207683_10064322
835 Ga0207683_10331667
836 Ga0207698_10000847
837 Ga0207698_10008362
838 Ga0207698_10009031
839 Ga0207698_10024453
840 Ga0207698_10080539
841 Ga0268266_10000042
842 Ga0268266_10169587
843 Ga0268265_10000013
844 Ga0268265_10000233
845 Ga0268265_10261375
846 Ga0268264_10000006
847 Ga0268264_10032269
848 Ga0268264_10196672
849 Ga0307405_10378220
850 Ga0307410_10009286
851 Ga0307406_10030198
852 Ga0307407_10347415
853 Ga0307412_10034152
854 Ga0307412_10076586
855 Ga0307412_10096685
856 Ga0307412_10212805
857 Ga0307409_100101851
858 Ga0307409_100253575
859 Ga0307409_100316241
860 Ga0307414_10417306
861 Ga0307414_10485913
862 Ga0307411_10003005
863 Ga0307411_10052476
864 Ga0307415_100002556
865 Ga0395899_0049094
866 Ga0395899_0069775
867 Ga0395899_0179402
868 Ga0395900_0038883
869 Ga0395900_0101979
870 Ga0395900_0113487
871 Ga0395900_0174706
872 Ga0395900_0193044
873 Ga0395898_0010117
874 Ga0395898_0093201
875 Ga0395898_0202780
876 Ga0395905_0004125
877 Ga0395905_0004550
878 Ga0395905_0011553
879 Ga0395905_0015707
880 Ga0395905_0036984
881 Ga0395905_0097878
882 Ga0395905_0163692
883 Ga0395905_0266835
884 Ga0395901_0000447
885 Ga0395901_0061277
886 Ga0395901_0077844
887 Ga0395901_0100630
888 Ga0436365_0735741
889 Ga0439448_0001796
890 Ga0439458_0000869
891 Ga0466957_0080757
892 Ga0466967_0063952
893 Ga0466967_0132853
894 Ga0466967_0315653
895 Ga0495616_0000887
896 Ga0495654_0005438
897 Ga0495622_0051376
898 Ga0495668_0021589
899 Ga0495668_0031375
900 Ga0495669_0124017
901 Ga0495671_0023690
902 Ga0495589_0059991
903 Ga0496102_0000043
904 Ga0496102_0022877
905 Ga0496103_0000086
906 Ga0496103_0011704
907 Ga0496104_0112979
908 Ga0496105_0109301
909 Ga0496106_0158143
910 Ga0496109_0002390
911 Ga0496109_0008457
912 Ga0496109_0104251
913 Ga0496110_0325758
914 Ga0496111_0017925
915 Ga0496111_0135398
916 Ga0496112_0129220
917 Ga0496112_0371034
918 Ga0496113_0012937
919 Ga0496113_0041800
920 Ga0496116_0007459
921 Ga0496117_0000104
922 Ga0496117_0005462
923 Ga0496118_0000080
924 Ga0496118_0048616
925 Ga0496121_0069673
926 Ga0496124_0000093
927 Ga0496125_0046152
928 Ga0501038_0099632
929 Ga0501223_000015
930 Ga0501225_0000167
931 nmdc:mga05p37_481510_c1
932 Ga0500643_001092
933 Ga0500592_002049
934 Ga0500594_0005092
935 Ga0500627_0001222
936 Ga0500627_0009380
937 Ga0500611_005866
938 Ga0500645_024531
939 2644039036
940 2848299791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00274

Glycolytic

Fructose-bisphosphate aldolase class-I

4

192

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.9798 2 295
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.97 2 295
6ald-assembly1.cif.gz_B rabbit muscle aldolase a/fructose-1,6-bisphosphate complex 0.8564 3 296
6xmh-assembly1.cif.gz_B-2 human aldolase a wild type 0.8549 3 296
3dft-assembly1.cif.gz_C phosphate ions in d33s mutant fructose-1,6-bisphosphate aldolase from rabbit muscle 0.8548 3 297
ID Description Score Start End Superfamily
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.993 4 295 3.20.20.70
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.983 4 295 3.20.20.70
af_A0A1D6JVQ3_1_141_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8412 17 140 3.20.20.70
3mbdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8346 5 293 3.20.20.70
af_A0A1D6FD79_26_183_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8138 2 138 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A432GXV0-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.002 234 292 GO:0004332
AF-A0A521W7U5-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9974 227 293 GO:0004332
AF-A0A509Y451-F1-model_v4 deleted 0.9967 211 293
AF-A0A7Y2NTH3-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9962 217 292 GO:0004332
AF-A0A1H7A9F4-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) 0.9951 3 301 GO:0004332
GO:0006096

Map